Interrelación entre elementos en cis

Transcripción

Interrelación entre elementos en cis
Universidad Nacional de San Martín
Instituto de Investigaciones Biotecnológicas
Regulación post-transcripcional en Trypanosoma
cruzi: Interrelación entre elementos en cis y
proteínas de unión a ARN.
“Estudio funcional-estructural”
Iván D’Orso
Tesis presentada para optar por el título de
Doctor en Biología Molecular y Biotecnología.
Director: Dr. Alberto Carlos Frasch
2003
INDICE
Página
Resumen
3
Summary
5
Abreviaturas
9
Introducción
11
Objetivos y Antecedentes
45
Resultados
46
Estudio de la regulación de la expresión génica
de TcSMUG
-Parte I:
47
-Parte II: Identificación de secuencias de ARN en cis
capaces de regular la expresión de TcSMUG
53
-Parte III: Identificación de proteínas que reconocen
los elementos ARE y GRE
61
-Parte IV: Estructura y Función de proteínas de unión
a ARN (TcUBPs
73
-Parte V: Análisis Estructural de las proteínas TcUBPs:
Ensayos de Dinámica Molecular
97
Discusión
105
-Conclusiones
115
-Perpectivas futuras
116
Materiales y Métodos
117
-Anexo
-Anexo
-Anexo
-Anexo
I
II
III
IV
139
140
141
142
Referencias
143
2
RESUMEN
Las mucinas son O-glicoproteínas que participan en procesos de protección,
lubricación y adhesión. En T. cruzi, existen dos grupos diferentes de mucinas que
presentan patrones de expresión y características especiales (ver revisión en Di Noia,
2000). Una de esas familias, TcSMUG, está codificada por alrededor de 70 genes por
genoma haploide y está compuesta por dos grupos denominados S y L, los cuales se
expresan preferencialmente en el estadío replicativo epimastigote. Dado que las mucinas
son importantes intermediarios en los mecanismos de adhesión celular y protección, el
objetivo de esta tesis fue caracterizar el/los mecanismo(s) involucrados en la regulación
de la expresión génica de TcSMUG durante el desarrollo del parásito. En primer lugar, se
describió que la expresión de TcSMUG se regula a nivel post-transcripcional. Mientras
que la tasa de transcripción de TcSMUG no varía entre los diferentes estadíos del parásito,
los niveles de ARNms en el estado estacionario difieren entre las formas epimastigote y
tripomastigote. Más aún, la vida media del ARNm para los grupos L y S de TcSMUG es
> 6hr) en el estadío replicativo epimastigote y baja (t
alta (t
1/2
< 0.5hr) en el estadío
1/2
infectivo tripomastigote. A partir de experimentos de transfección de parásitos en forma
estable, se describen dos elementos funcionalmente diferentes, que están localizados en
la región 3’ no codificante del grupo L y que regulan la estabilidad del ARNm TcSMUG
durante el desarrollo del parásito. El primer elemento, denominado GRE por su alto
contenido en residuos de Guanosina, está compuesto por 27 nt y confiere estabilidad al
ARNm sólo en el estadío epimastigote. El segundo elemento denominado ARE (“AU-rich
element”), está compuesto por 44 nt y funciona en la desestabilización del ARNm TcSMUG
sólo en el estadío tripomastigote. Ambos elementos, GRE y ARE, son reconocidos
específicamente en geles de retardo por proteínas de lisados totales de parásitos. Mientras
que las proteínas que reconocen el elemento GRE se expresan en forma constitutiva
durante el desarrollo, las proteínas AREBPs (“ARE-binding proteins”) se expresan en
forma estadío específica y a partir de ensayos de entrecruzamiento con luz UV se determinó
que presentan diferentes masas moleculares. La proteína que interacciona con el ARE
en el estadío epimastigote (eAREBP), se purificó parcialmente y analizó por espectrometría
de masa. Por comparación con la base de datos PROFound se identificó su posible
identidad con la proteína de unión a ARN murina DEF3.
Además, se clonó y caracterizó un grupo de proteínas de unión al ARE diferentes
a las AREBPs, denominadas TcUBP-1 y TcUBP-2 (por “Uridine-binding protein”). Estas
proteínas presentan un único dominio de unión a ARN del tipo RRM (“RNA-recognition
motif”) y dominios auxiliares ricos en Glutamina y/o Glicina. Presentan la capacidad de
homo-heterodimerizar a partir de residuos de Tirosina ubicados en la región C-terminal
rica en Glicina. Las proteínas TcUBPs forman parte de un complejo ribonucleoproteico
de ~450kDa, el cual también contiene la proteína de unión a poli(A) (TcPABP1).
Experimentos “in vivo” demostraron que la proteína TcUBP-1 está involucrada en la
desestabilización selectiva de ARNms conteniendo secuencias AREs, como los grupos L
y S de TcSMUG, cuando se sobre-expresa en el estadío epimastigote.
3
A partir de ensayos de Resonancia Magnética Nuclear se estudiaron los mecanismos
de reconocimiento del ARN por las proteínas TcUBPs. Por un lado, se utilizaron técnicas
de resonancia-triple estándares con el objetivo de asignar residuos de cadena principal.
Por otro lado, a partir de experimentos de titulación con ARN, monitoreados por espectros
de correlación cuántica simple heteronuclear, se describieron los residuos del motivo
RRM que podrían interaccionar con el ARN. No sólo se desplazan químicamente residuos
de las hojas β1 y β3, sino que también existen perturbaciones considerables en las hojas
β2 y β4. A partir de estos experimentos se compararon los residuos que sufren
desplazamientos químicos en las proteínas con un dominio RRM, TcUBPs, y los residuos
que interaccionan con ARN en proteínas con múltiples dominios de unión a ARN de
otros tipos celulares.
Palabras clave
Trypanosoma cruzi
Expresión génica
Regulación post-transcripcional
Estabilidad de ARNms
Proteínas de unión a ARN
Proteína de unión a poli(A)
Resonancia Magnética Nuclear
4
Post-transcriptional regulation in Trypanosoma cruzi: Interplay between ciselements and RNA-binding proteins. “Functional and structural study”.
SUMMARY.
Mucins are O-glicoproteins that can function as a protective barrier, serve for
lubrication and act as adhesion molecules. In the protozoan parasite T. cruzi, two different
gene groups exists with special features and expression patterns (reviewed in Di Noia,
2000). One group, named TcSMUG, is composed by about 70 genes per haploid genome
and is formed by two different groups, named L and S. Group S mRNA is present in the
insect related stages. Besides, group L mRNA is present in all the stages, although is
much more abundant in the replicative ones. Because of the great importance of mucin
molecules in cell-adhesion and the immune system evasion response, the aim of this
thesis is to characterize the mechanism(s) involved in the regulatory process of TcSMUG
gene expression during parasite development. Firstly, TcSMUG mRNA family was
described to be regulated at the post-transcriptional level. While the transcription rate of
TcSMUG did not change during parasite development, mRNA steady-state levels change
drastically upon differentiation. Moreover, the half-life for the L and S groups of TcSMUG
> 6 hr) in the epimastigote stage, whereas they are short-lived in the
is higher (t
1/2
trypomastigote stage (t < 0.5 hr). In order to determine the presence of cis-elements
1/2
involved in the stabilization process, stable parasite transfection experiments were
performed. Two functionally different elements were identified, localized in the 3’untranslated region (UTR) of TcSMUG-L group. The first element was named GRE, since
it is a G-rich element composed by 27 nt and it is involved in confer mRNA stability only
in the epimastigote stage. The second element was named ARE, since its resemblance
with AU-rich elements of mammalian cells. It is composed by 44 nt and is involved in
TcSMUG mRNA decay in the trypomastigote stage. Both elements, GRE and ARE, are
specifically recognized in gel shift experiments, by proteins of total parasite lisates and
were named GREBPs and AREBPs, respectively. While GREBPs are constitutively
expressed during parasite development, AREBPs are expressed with a stage-specific
pattern. By UV cross-linking assays it was determined that AREBPs from the different
stages present distinct apparent molecular masses. The epimastigote stage specific protein
eAREBP was partially purified and analyzed by MALDI-TOF mass-spectrometry. By
comparison with the PROFound database, we showed its identity with murin RNA-binding
protein DEF3.
Two different RNA-binding proteins that recognize the ARE sequence were cloned
and characterized and named TcUBP-1 and TcUBP-2, for T. cruzi Uridine-binding protein.
TcUBPs proteins present a common single RNA-recognition motif (RRM) and auxiliary
domains rich in Gln and/or Gly. They can homo-heterodimerize in vitro and in vivo by
Tyr residues present within the C-terminal Gly-rich region. TcUBP-1 and TcUBP-2 proteins
form part of a ribonucleoprotein complex of ~450kDa, which also contains the poly(A)binding protein, TcPABP1. TcUBP-1 protein was involved in selective destabilization of
ARE-containing mRNAs in vivo, such as TcSMUG L and S, when over-expressed in the
epimastigote stage of the parasite.
Nuclear Magnetic Resonance experiments were used to study the mechanism of
5
RNA-recognition in TcUBPs proteins, since they are single RRM-type RNA-binding proteins.
Triple-resonance standard techniques were used for the backbone assignment. In addition,
RNA titration experiments monitored by heteronuclear simple quantum correlation (HSQC)
were used to identify the residues in the RRM motif involved in RNA recognition. Residues
within β1, β3 but also β2 and β4 sheets showed the highest chemical shifts upon RNA
addition. All these information was used to compare the residues perturbed in single
RRM-type RNA-binding proteins (TcUBPs) and compared with the ones that interact in
multiple RRM-type proteins.
Key words
Trypanosoma cruzi
Gene Expression
Post-transcriptional regulation
mRNA-stability
RNA-binding protein
poly(A)-binding protein
Nuclear Magnetic Resonance
6
Para los que hacen las cosas simples en la vida, y siempre en positivo,
Ileana,.......sin palabras.
Mis padres Laura y Carlos,
y mi hermana Vera.
Gracias.....
Carlos Frasch..... por “LA” oportunidad, confianza, apoyo, entusiasmo, su visión de la
ciencia.......y por nunca un No!!!!,
Daniel Sánchez, también por su apoyo desde los comienzos, allá en 1997,
Kalle Gehring, por brindarme tal enorme oportunidad y abrir mi pequeña cabecita
molecular a las bases de la espectroscopía.......,
Javier Di Noia, por la compañia y dirección en los primeros experimentos “pegajosos”
con las mucinas,
Javier De Gaudenzi, con quien nos “codeamos” durante mi última parte del Doctorado
y escuchamos música por las mañanas, a veces del palo, y otras no tanto,
Marcelo Guerin, por su buena onda, amistad y bioquímica; aunque las cosas no
siempre fueron positivas....Gracias,
A las distintas generaciones del lab-3 con quienes compartí muchos mates y tortas:
Javier, Carlos, Alejandro, Laura, Gastón, Guido, Vanina, Julieta, Marcela, Roxi, Geo,
Adriana, Laura II, Natalia
A mi laboratorio en Canadá.....y la enorme compañía y amistad que encontré: Pablito
Gutierrez (por “Colombia”), Nadeem Siddiqui (“up Canadien”), Laurent “le grand”,
Jean-Francois, Tara y Marta,
A Joaquin, Charlie, Rafa y Juampi, por las escaladas a la montaña que nos
permitieron olvidarnos de la ciencia....al menos de forma pasajera,
A Fabio...por sus hermosas palabras cuando amablemente le pedía inocentes ratones
y conejos,
A Berta y Lili... por los no tan inocentes parásitos,
A la asistencia indiscutida de Andrea Meras en todas las corridas cromatográficas en
el HPLC,
A la gente de otros labos, por la amistad, bicicleteadas, mates y “locuras” juntos:
Cristian “el calabaza”, Augusto “o cabeça”, Ramiro,
A Zulmita y Nelly...por esperarme tempranito con los mates “casi” todos los días,
A todos los que supieron bancarme en las cortadas “sólo” y en la locura que la ciencia
a veces arremete,
A Roberto “Bob” Marley.......por su reggae y la atmósfera rastafari siempre en el
ambiente positive,
KuKi por traer al mundo la “cosita” más hermosa del planeta, Ile....,
A la vida....y su creador.
“........Jah Rastafari”
8
Abreviaturas
ADN
ADNc
ácido desoxirribonucleico
ADN copia
ARN
ARNm
ARNr
ácido ribonucléico
ARN mensajero
ARN ribosomal
ARNt
cpm
dNTP
ARN transferencia
cuentas por minuto
mezcla de dATP, dTTP, dGTP y dCTP
EDTA
EST
g
ácido etilen-di-amino-tetra-acético
del inglés “Expressed Sequence Tag”
aceleración de la gravedad
kpb
min
MOPS
kilopares de bases
minuto(s)
ácido 3-(N-morfolino) propanosulfónico
nt
ºC
K
pb
kDa
PCR
PM
RT
NC
SDS
PAGE
ARNP
ActD
CHX
PABP
HnRNP
ARE
snARN
nucleótidos
grados centígrados
grados Kelvin
pares de bases
kiloDalton
reacción en cadena de la polimerasa
peso molecular
transcripción reversa
No Codificante
dodecilsulfato de sodio
electroforesis en geles de poliacrilamida
ARN-polimerasa
Actinomicina D
Cicloheximida
Proteína de unión a poli(A)
del inglés “heteronuclearRiboNucleoprotein”
del inglés “AU-rich-element”
del inglés “small nuclear ARNs”
siARN
SL
NLS
del inglés “small interfering ARNs”
del inglés “spliced leader”
del inglés “Nuclear Localization Signal”
NES
RMN
HSQC
del inglés “Nuclear Export Signal”
Resonancia Magnética Nuclear
del inglés “Heteronuclear Simple Quantum Correlation”
NOE
NOESY
TOCSY
del inglés “Nuclear Overhause Effect”
del inglés “NOE SpectroscopY”
del inglés “TOtal Correlation SpectroscopY”
9
Los resultados presentados en esta tesis fueron incluídos en los siguientes trabajos:
The Trypanosoma cruzi mucin family is transcribed from hundreds of genes
having hipervariable regions. (1998). Di Noia J.M., D’Orso I., Aslund L., Sánchez
D.O. and Frasch A.C. J. Biol. Chem 273, 10843-10850
AU-rich elements in the 3’ UTR of a new mucin-type gene family of
Trypanosoma cruzi confers mRNA instability and modulates translation
efficiency. (2000) Di Noia, J.M., D’Orso, I., Sánchez, D.O. and Frasch, A.C. J.
Biol. Chem. 275, 10218-10227.
Functionally different AU- and G-rich cis-elements confer developmentally
regulated mRNA stability in Trypanosoma cruzi by interaction with specific
RNA-binding proteins. (2001) Iván D’Orso and Alberto C. Frasch. J. Biol. Chem.
276, 15783-15793.
TcUBP-1, a developmentally regulated U-rich RNA-binding protein involved
in selective mRNA destabilization in trypanosomes. (2001) Iván D’Orso and
Alberto C. Frasch. J. Biol. Chem. 276, 34801-34809.
TcUBP-1, a mRNA destabilizing factor from trypanosomes, homodimerizes
and interacts with a novel AU-rich element and poly(A)-binding proteins
forming a ribonucleoprotein complex. (2002) Iván D’Orso and Alberto C. Frasch.
J. Biol. Chem, 277, 50520-50528.
The Trypanosoma cruzi mucin coat: Structure, Regulation of the expression
and relevance in the host-parasite relationship. (2002) Javier Di Noia, Iván
D’Orso and Alberto C. Frasch. In: Molecular Mechanisms in the Pathogenesis of
Chagas Disease, Chapter 3. edited by John M. Kelly. Landes Bioscience/Eurekah.
RNA-binding proteins and mRNA turnover in trypanosomes. Iván D’Orso, Javier
G. De Gaudenzi and Alberto C. Frasch. TRENDS in Parasitology, en prensa.
10
“Todo lo difícil empieza siendo fácil, y toda
cosa grande empieza siendo pequeña.
El árbol que no pueden rodear los brazos de un hombre
crece a partir de un tierno brote.
La torre más alta, surge de un puñado de tierra.
Un viaje de cien millas empieza a nuestros pies.....”
Lao Tse
INTRODUCCION
Introducción
1- Trypanosoma cruzi y otros parásitos kinetoplástidos.
Los protozoos son organismos eucariotas unicelulares primitivos, actualmente
considerados un subreino dentro de los protistas. Trypanosoma cruzi se ubica dentro
del “phylum” Sarcomastigophora, clase Zoomastigophora, orden Kinetoplastida, familia
Trypanosomatidae, sección Estercoraria (Levine et al., 1980). Esta especie no es una
población homogénea, sino está compuesta por un conjunto de cepas con diferentes
características biológicas, bioquímicas e inmunológicas (Brener, 1973). Las evidencias
indican que, a pesar de ser un organismo diploide, la recombinación sexual está por lo
menos severamente restringida y se sugiere una estructura multiclonal para las
poblaciones de T. cruzi (Tibayrenc et al., 1986). Dada la importante variación intraespecífica
que existe en T. cruzi, es de relevancia médica y biológica el análisis de las particularidades
de cada población ya que distintas poblaciones difieren en el tropismo por determinados
tejidos, virulencia y susceptibilidad a drogas o mecanismos efectores del sistema inmune
(Revollo et al., 1998).
T. cruzi es un parásito digenético, es decir, posee dos hospedadores naturales: un
insecto hematófago, que funciona como vector y un mamífero en el cual se desarrolla la
patología. Los insectos pertenecen a la familia Reduvidae, cuya especie Triatoma infestans
es la más común en Argentina. El rango de hospedadores mamíferos es amplio, incluyendo
al hombre y animales salvajes y domésticos, que actúan como reservorios de la enfermedad
(Brener, 1973). El parásito es ingerido por el insecto a partir de un mamífero infectado
junto con la sangre que constituye su dieta y pasa por una serie de transformaciones
morfológicas irreversibles a lo largo del tubo digestivo. En el intestino medio las formas
ingeridas, denominadas tripomastigotes sanguíneos, se diferencian al estadío de
epimastigote, que se divide activamente por fisión binaria. Al migrar a la ampolla rectal,
los epimastigotes se adhieren al intestino, como condición indispensable para diferenciarse
al siguiente estadío llamado tripomastigote metacíclico. La infección es iniciada en el
vertebrado por el estadío tripomastigote. Este último, al ser eliminado junto con las
heces del insecto durante la ingesta de sangre, penetra en el organismo por las mucosas
y/o heridas en la piel. Este estadío no es capaz de dividirse. Por lo tanto, para multiplicarse
penetra rápidamente a una célula y se diferencia al estadío replicativo. Para lograr su
objetivo, debe atravesar la dermis y matriz extracelular y establecer una infección local.
El parásito, escapa del fagolisosoma en que penetra hacia el citoplasma utilizando factores
hemolíticos activos a bajo pH (Andrews et al., 1990), en donde se diferencia al estadío de
amastigote (Tomlinson et al., 1995). El amastigote se divide intracelularmente por fisión
binaria y posteriormente se diferencia a tripomastigote sanguíneo. Este estadío, incapaz
de dividirse, es liberado al lisarse la célula huésped, y de esta manera, llega a la sangre
donde circula por un período variable antes de invadir otras células, o ser ingerido por el
vector, en donde se diferencia al estadío epimastigote, para cerrar el ciclo de vida (Figura
1).
La magnitud de la parasitemia diferencia dos etapas de la infección. Durante un
período corto posterior a la infección, la parasitemia aumenta hasta llegar a un máximo.
La mayoría de los individuos infectados, logran controlar la infección después de 8 a 10
semanas y la parasitemia disminuye hasta hacerse indetectable por análisis
microscópicos. Este punto determina el límite entre las fases agudas y crónica de la
12
Introducción
infección, que puede prolongarse por años en forma asintomática hasta causar las
patologías asociadas a la enfermedad. Durante la fase crónica, el parásito persiste en
forma intracelular en regiones determinadas como por ejemplo el bazo, corazón, cólon o
nervios periféricos según el tropismo de la cepa, y se cree que en este punto la respuesta
inmune humoral del mamífero es capaz de destruir rápidamente a los parásitos liberados
al torrente sanguíneo, principalmente por anticuerpos líticos dirigidos contra el epitope
Gal(α 1-3) presente en mucinas de la membrana del parásito (Almeida et al., 1994;
Gazzinelli et al., 1991). Sin embargo, la respuesta celular no logra montarse en forma
adecuada o suficiente para eliminar al parásito y por lo tanto se establece una infección
crónica.
Figura 1- Ciclo de vida del Trypanosoma cruzi
Otras dos especies de parásitos kinetoplástidos relacionados con T. cruzi, son T.
brucei y Leishmania spp. Ambos son parásitos digenéticos, pero el primero de ellos no
presenta estadío intracelular dentro del hospedador mamífero. En T. brucei, a pesar de
que existen varios estadíos reconocidos como intermediarios, podemos mencionar a las
formas más diferentes y de mayor importancia. En primer lugar, la forma procíclica
presente en la glándula salival del insecto vector tsetse (Glossina sp.) y en segundo lugar,
la forma sanguínea presente en el hospedador mamífero y es la que establece la infeccion
crónica. En cuanto a Leishmania spp. su ciclo de vida consta de dos estadíos bien
diferentes, una forma replicativa no infectiva, el promastigote, y una forma no-replicativa
pero infectiva para el hospedador mamífero, el amastigote intracelular (Sacks and Sher,
2002).
1.1-Proteínas tipo-mucinas, O-glicoproteínas de superficie del T. cruzi.
Las mucinas, son moléculas altamente glicosiladas, en las cuales los carbohidratos
representan alrededor del 80% de la masa molecular. El núcleo proteico está compuesto
por residuos de Serina/Treonina y también Prolina. El agente etiológico del mal de Chagas
presenta una gran cantidad de genes que codifican para proteínas tipo-mucina. Estas
13
Introducción
proteínas han sido muy estudiadas debido a su rol como aceptores de ácido siálico
(Schenkman et al., 1993) en la reacción catalizada por la trans-sialidasa (Frasch, 1994;
Schenkman et al., 1994). La actividad enzimática de la trans-sialidasa es única y parece
haber sido seleccionada durante la evolución para solucionar la falta de la síntesis “de
novo” de ácido siálico en T. cruzi (Schauer et al., 1983).
En el laboratorio del Dr. Frasch, se describieron tres grupos de genes de mucinas
de T. cruzi, los cuales pertenecen a la familia denominada TcMUC, por “T. cruzi Mucins”
(Di Noia et al., 1998; Di Noia et al., 1995). La familia de genes TcMUC se parece a los
genes que codifican las mucinas de los mamíferos (Di Noia et al., 1995), y está compuesta
por 500-700 miembros por genoma haploide (Aguero et al., 2000; Di Noia et al., 1998).
Esta familia se divide en tres subgrupos los cuales presentan divergencias en las regiones
centrales, aunque se caracterizan por presentar un alto contenido de residuos de Serina/
Treonina (Di Noia et al., 1998). A diferencia de la región central, las regiones N- y Cterminales, las cuales codifican para un péptido de señalización a retículo endoplásmico
y una señal de anclaje a la membrana por glicofosfatidilinositol, respectivamente, están
muy conservadas. Recientemente se ha clonado y caracterizado una segunda familia de
genes de mucina, denominada TcSMUG, por “Small Mucin Genes” (Di Noia et al., 2000).
El clonado de los genes de la familia TcSMUG permitió demostrar que existen dos subgrupos denominados L y S, en los cuales la principal diferencia reside en el tamaño de
los ARNms por diferencias en el largo de la región 3’-no codificante (NC). Hasta el momento,
no existe evidencia alguna, que indique como se regula la expresión de estas dos familias
de genes de mucinas durante el desarrollo del parásito.
2-Regulación de la expresion génica.
2.1- Un compendio de mecanismos acoplados en eucariotas superiores.
La finalización de la secuencia del genoma humano en el año 2001 (Lander et al.,
2001) y como así también de otros organismos tanto procariotas como eucariotas, marcó
una nueva era en la biología y medicina moderna. Sin embargo, la identificación de
secuencias génicas sin la descripción de la función y regulación de los productos finales
generados, es de valor limitado. Sabemos que los distintos tipos celulares que componen
un organismo multicelular expresan productos diferentes y presentan, por ende, una
identidad propia. De esta manera, la remarcable diversidad encontrada en la
especialización celular se logra a través de un estricto control en la expresión y regulación
génica. Una gran cantidad de trabajos recientes en el área de biología molecular y celular,
permitieron revelar algo nunca evidenciado hasta el momento. Varias etapas o caminos
regulatorios de la expresión de genes se encuentran acoplados (Orphanides and Reinberg,
2002).
En la Figura 2 se muestra un esquéma donde se resumen los procesos de expresión
génica conocidos en células eucariotas, desde la activación de reguladores
transcripcionales hasta la síntesis de una proteína funcional. Los niveles de expresión
de varios genes son regulados por factores transcripcionales que reconocen secuencias
regulatorias de ADN situadas antes del sitio de inicio de la transcripción, excepto para
genes controlados por la ARN polimerasa (ARNP) tipo III. El hecho de que más del 5% de
14
Introducción
nuestros genes codifican factores de transcripción, demuestra la importancia de esta
familia proteica (Tupler et al., 2001). Los factores transcripcionales, una vez activados
por diferentes señales intra o extracelulares, se unen a los elementos regulatorios y a
través de interacciones con otros componentes de la maquinaria transcripcional,
promueven el acceso al ADN y facilitan el reclutamiento de la ARNP en el sitio de inicio
de la transcripción. Luego de que la ARNP-II comienza la transcripción de genes que
codifican proteínas, el ARN naciente es modificado por la adición de una estructura
denominada “cap” en el extremo 5’-terminal (“capping”). Esta modificación sirve para
proteger al ARN del ataque de las nucleasas y también como sitio de unión de factores
involucrados en el transporte del ARNm del núcleo al citoplasma para su posterior
traducción (Proudfoot et al., 2002). El proceso del “capping” también parece coordinar
eventos transcripcionales primarios, regulando la transición entre el inicio transcripcional,
durante el cual la ARNP-II comienza la síntesis de ARN y la elongación, en el cual la
polimerasa se mueve en sentido 5’-3’. Una vez que la ARNP-II alcanza el fin del gen, la
transcripción cesa (terminación) por el reconocimiento de secuencias y/o estructuras
que impiden el paso de la maquinaria transcripcional. Este pre-ARNm luego se cliva y se
poliadenila por agregado de una cola de poli(A) en el extremo 3’ (ver más adelante).
Los procesos por los cuales la información génica se transfiere desde el ADN al
ARN, transcripción, y desde el ARN a la proteína, traducción, están físicamente separados
en las células eucariotas por una membrana que rodea el núcleo, a diferencia de lo que
ocurre en procariotas donde ambos procesos están acoplados en forma temporal y espacial.
En las células eucariotas los ARNms sintetizados en el núcleo deben ser transportados
al citoplasma para su traducción. Gracias a proteínas que se localizan en los poros
nucleares, el transporte de macromoléculas es regulado en forma bidireccional (ver revisión
en Reed and Hurt, 2002). Este proceso de transporte es mediado por factores que
reconocen secuencias en las moléculas del ARNm en el núcleo y lo trasladan al citoplasma.
Por su parte, la traducción del ARNm para generar proteínas es llevada a cabo en complejos
ribonucleoproteicos llamados ribosomas (Ramakrishnan, 2002) y es mecanísticamente
análoga a la transcripción (ver secciones siguientes). Los polipéptidos ahí sintetizados en
ribosomas, luego son plegados en forma correcta y modificados químicamente (Fersht
and Daggett, 2002) para generar un producto final maduro activo y correctamente
localizado (Figura 2).
2.2- Regulación de la expresión génica en tripanosomas.
Todos los parásitos helmintos y protistas de importancia médica deben ajustarse
a una amplia variedad de cambios en el medio ambiente (condiciones químicas y estrés)
durante el pasaje de un hospedador a otro. Para sobrevivir en condiciones ambientales
tan variables, estos organismos se protegen utilizando cubiertas proteicas y glico-proteicas.
Como parte del proceso adaptativo pueden cambiar su metabolismo y los patrones de
expresión de las moléculas esenciales para su supervivencia a partir de la regulación de
diferentes etapas del control de la expresión génica.
A lo largo de la introducción se presentará una breve comparación entre los procesos
regulatorios en tripanosomas y eucariotas superiores. Los tripanosomas presentan rasgos
15
Introducción
característicos en sus procesos regulatorios, entre los que cabe mencionar la producción
de largas unidades policistrónicas durante la transcripción, el proceso de trans-“splicing”
durante el procesamiento del pre-ARNm, su localización y traducción en el citoplasma.
Traduccion
exosoma
ARE
PABP
e IF
A
PARN
AAAAAAAAAAAA
HuR
PABP
A
AAA
4G
ARE
eIF4E
hnR
NPD
A
A
PABP
eIF
m7G-cap
4G
eIF4E
m7G-cap
AAAAAAAAAAAA
Estabilizacion ARNm
P
AUB
ARE
Clivaje exonucleolitico 3'-5'
"Decapping"
PABP
PABP
eI F
4G
Desestabilizacion ARNm
eIF4E
m7G-cap
AUBP
m7G-cap
PABP
PABP
AAAAAAAAAAAAAAA
ARE
p15
TAP
RAN-GDP
XPO1
Citoplasma
NPC
Nucleo
RAN-GTP
hnRNPs
Transporte de ARNm
XPO1
NES
AUBP
m7G-cap
PABP
PABP
AAAAAAAAAAAAAAA
p15
TAP
m7G-cap
EJC
"Splicing"
AAAAAAAAAAAAAAA
EJC
cis-"splicing"
procesamiento 3'
hnRNPs
m7G-cap
In
In
Transcripcion-"splicing" acoplados
ADN
TBP
ARNP-II
TBP
pre-ARNm
"Capping"
Decompactacion
de la Cromatina
Cromosomas condensados
Figura 2 - Visión contemporanea de la regulación de la expresión génica nuclear en
células eucariotas superiores. Estudios recientes sugieren que cada etapa de la
regulación de la expresión génica, desde la transcripción a la traducción, forma parte
de un proceso continuo. De acuerdo con esta visión , cada etapa regulatoria, está física
y funcionalmente acoplada a la siguiente, asegurando de esta manera una transferencia
eficiente de la información entre etapas (ver revisión en Orphanides and Reinberg, 2002).
EJC, “Exon Junction complex”; NPC, “Nuclear Pore Complex; NES, “Nuclear export
signal”; In, Intrón; hnRNPs, proteínas heteronucleares; AUBP, “AU-rich binding protein”.
16
Introducción
3- Comparación de los procesos regulatorios entre eucariotas superiores y
tripanosomas.
3.1- Transcripción y origen de largas unidades policistrónicas en
tripanosomas.
La estructura genómica y los patrones de transcripción de los parásitos del orden
Kinetoplastida son únicos en la evolución. En lugar de presentar un estricto control
transcripcional a partir de un promotor por gen, muchos genes son controlados a partir
de una misma región promotora; es decir, la transcripción se caracteriza por ser
policistrónica (Vanhamme and Pays, 1995). Varios marcos abiertos de lectura separados
por largas regiones intergénicas forman parte del mismo ARN todavía no maduro. Además,
el arreglo de genes en el genoma de estos parásitos es reminiscente de los operones
bacterianos, especialmente por el hecho de que los marcos abiertos de lectura
generalmente no están interrumpidos por intrones. Se ha descripto una sola excepción
en donde el gen que codifica para la poli(A)-polimerasa de T. cruzi y T. brucei (Mair et al.,
2000) presenta un intrón que es eficientemente procesado “in vivo” (ver más adelante).
Otro rasgo característico del genoma de estos organismos protozoarios es la
distribución y orientación de los genes en el genoma, los cuales no presentan un patrón
común. El cromosoma I de Leishmania major, por ejemplo, presenta ~285 kpb de largo.
Existe en este cromosoma, una región de 1.6 kpb que no contiene ningún marco abierto
de lectura. A su izquierda se encuentran 29 marcos abiertos de lectura todos orientados
hacia el mismo telomero, y a la derecha del mismo y orientados hacia el telómero opuesto,
hay 50 marcos abiertos de lectura (McDonagh et al., 2000; Myler et al., 1999). Según
experimentos de transcripción y sensibilidad a la droga α-amanitina, se describió que
esta región de 1.6 kpb contiene un promotor para ARNP-II. Otro ejemplo interesante, es
la presencia de unidades transcripcionales sentido y antisentido solapadas en el genoma
de T. brucei (Liniger et al., 2001), las cuales pueden servir para mecanismos de regulacion
de la expresión a partir de la interferencia por ARN (ver más adelante). Estas unidades
transcripcionales provienen de un simple locus cromosómico y la transcripción se extiende
hasta más de 10 kpb en forma estadío específica. Más interesante aún, es que en los
genomas de los tripanosomas, la frecuencia de unidades transcripcionales antisentido
es alta. De esta manera, el hecho de que ARNms estables puedan provenir de las diferentes
hebras del ADN, permite hipotetizar que el potencial codificante del genoma puede ser
mayor al que se describió previamente (Liniger et al., 2001). Recientemente, se demostró
que las tasas transcripcionales de la ARNP-I y ARNP-II, disminuyen drásticamente cuando
T. cruzi se diferencia de las formas replicativas no infectivas (epimastigotes y amastigotes)
a las formas infectivas no-replicativas (tripomastigotes). Estos cambios transcripcionales
parecen estar acoplados a cambios en la estructura nuclear y al remodelamiento de la
cromatina (Elias et al., 2001) (ver más adelante).
3.1.1- ARN polimerasas en tripanosomas y su rol en la transcripción.
Se han descripto tres tipos de ARNP a partir de la resistencia a la droga α-amanitina,
17
Introducción
ARNP-I, -II y -III. La subunidad grande de cada una de las ARNP fue caracterizada por el
clonado de su gen (Evers et al., 1989; Jess et al., 1989; Kock et al., 1988). De todas, la
ARNP-I fue la más estudiada en tripanosomas. En primer lugar, se sabe que tiene la
capacidad de transcribir no sólo genes ribosomales sino también genes que codifican
proteínas como los mayores antígenos de superficie del estadío sanguineo infectivo de T.
brucei, conocidos como VSG (“Variable Surface Antigen”). En segundo lugar, también
sintetizan los ARNms del mayor antígeno de superficie del estadío asociado al insecto
vector en T. brucei, conocido como PARP (“Procyclic Acid Repetitive Protein”) y compuesto
por dos grupos, EP y GPEET. Una razón por la cual esta ARNP es utilizada por los
tripanosomas, puede estar relacionada con su alta eficiencia transcripcional (Vanhamme
and Pays, 1995). Finalmente, también se describió que la ARNP-I, es resistente a la
droga α-amanitina (Clayton et al., 1990) y su localización intracelular demuestra que
está presente alrededor del nucleolo y co-localiza con transcriptos nacientes de la PARP
(Lee and Van der Ploeg, 1997). Los promotores para ARNP-I se caracterizaron usando
ensayos de “run-on”, ensayos de extensión del cebador y transfecciones con plásmidos
conteniendo genes reporteros bajo el control de las secuencias de ADN. A partir de estos
ensayos se demostró que la estructura de los promotores para ARNr, VSG y EP se asemejan
a los promotores para ARNr descriptos en eucariotas superiores (Clayton, 2002). Además,
en ensayos de transcripción “in vitro”, ambos tipos de promotores compiten por los
mismos factores celulares (Laufer et al., 1999). Por otro lado, el gen que codifica el factor
“TATA-binding protein”, está en la base de datos de Leishmania; por lo tanto, otros
factores basales de la transcripción pueden estar presentes en el genoma de tripanosomas
(Clayton, 2002).
En lo que respecta a la ARNP-III en kinetoplástidos, se sabe que transcribe los U
ARNs además de los ARN de transferencia (ARNt). Los promotores para la ARNP-III se
mapearon en detalle a partir del uso de sistemas de transcripción “in vitro” y transfecciones
transientes de plásmidos diseñados para la producción de ARNs específicos. La
transcripción de U ARNs depende de dos regiones A y B ubicadas adelante de los genes
para ARNt (Nakaar et al., 1997).
Otros ARNs pequeños, los “small nuclear” ARNs o snARNs, son transcriptos por
una ARNP-II como parte de una unidad transcripcional única (Xu et al., 2001b). En
varias especies de tripanosomas, se han descripto dos genes muy similares que codifican
para la ARNP-II. La subunidad grande de esta holoenzima carece de las típicas repeticiones
hexapeptídicas ricas en Serina, aunque de todas maneras tiene un alto contenido en
Serina y es fosforilada como en otros organismos eucariotas (Smith et al., 1989). En lo
que respecta a los promotores tipo II, las pruebas no son concluyentes. Varios reportes
describieron la presencia de secuencias promotoras putativas, las cuales han sido
mapeadas por ensayos de extensión del cebador y transfecciones transientes (Downey
and Donelson, 1999; McAndrew et al., 1998), aunque aún no se han confirmado. El
primer promotor identificado para ARNP-II fue descripto recientemente en el gen para el
“spliced leader” (SL) de Leptomonas, y presenta un bloque variable con la secuencia
CYAC/AYR(+1) (Gilinger and Bellofatto, 2001). Este elemento, así como dos elementos
promotores basales adicionales, divergen de los elementos típicos transcripcionales
descriptos en eucariotas superiores (ver revisión en Lewin, 1997). El precursor para el
18
Introducción
ARN del SL en otros organismos presenta promotores claramente identificados y con
una pequeña secuencia iniciadora (Luo et al., 1999). A partir de experimentos de retardo
en gel, se caracterizaron varios factores que reconocen el promotor del SL (Gilinger and
Bellofatto, 2001; Matkin et al., 2001). Un elemento, denominado PBP-1E, y localizado
entre -70 y -60 pbs antes del sitio de inicio de la transcripción es requerido para una
eficiente transcripción del ARN del SL. Recientemente se demostró que existe un complejo,
compuesto por tres proteínas, que reconoce el elemento PBP-1E (Das and Bellofatto,
2003). Una de estas proteínas es ortóloga a la subunidad (SNAP)50 de las células humanas,
involucrada en la regulación de la transcripción de snARNs (Das and Bellofatto, 2003).
3.2- Posicionamiento de la Cromatina.
3.2.1- Su rol en el control transcripcional en eucariotas superiores.
El ADN en las células eucariotas se encuentra empaquetado en una estructura
nucleoproteica compacta y altamente organizada llamada cromatina. La unidad de
organización básica de la cromatina es el nucleosoma, el cual consiste de 146 pbs de
ADN envuelta, generalmente 2 veces alrededor de un núcleo proteico que contiene dos
copias de histonas del tipo H2A, H2B, H3 y H4 (Luger et al., 1997). Estas pequeñas
proteínas presentan una alta carga positiva y están conservadas durante la evolución.
Aunque anteriormente se pensaba que la cromatina formaba una estructura estática
para el ADN, actualmente se sabe que cumple un rol principal en la regulación de la
transcripción génica (Narlikar et al., 2002). Las regiones del genoma que no se transcriben
están empaquetadas en una cromatina altamente condensada llamada “heterocromatina”,
mientras que la región que presenta unidades transcripcionales se denomina
“eucromatina” (Richards and Elgin, 2002). Cada tipo celular empaqueta sus genes con
un patrón único de heterocromatina y eucromatina, y este patrón se mantiene también
durante la división celular. El patrón de empaquetamiento depende de que genes serán
activos en una nueva división celular, asegurando de esta manera las características
únicas de cada linaje celular. Para la activación de la expresión génica los factores
transcripcionales deben, por lo tanto, abrirse camino en estructuras de cromatina de
difícil acceso al ADN. Esto es generado por eventos que conllevan a un aumento en la
accesibilidad al ADN (Orphanides and Reinberg, 2002).
3.2.2- Cromatina y transcripción en tripanosomas.
En tripanosomas se demostró que existen diferentes tasas de inicio de la
transcripción mediadas por ARNP-I y ARNP-II durante las distintas etapas del ciclo de
vida del parásito. Además, se observó que estos cambios transcripcionales ocurren en
paralelo con modificaciones de la estructura nuclear. Los núcleos de las formas replicativas
(epimastigote y amastigote intracelular) son redondeados, contienen pequeñas cantidades
de “heterocromatina” periférica y un nucleolo grande. En cambio, los núcleos de las
formas infectivas (tripomastigote) son alargados, el nucleolo desaparece y la
“heterocromatina” ocupa la mayoría del compartimento nuclear. La disminución de la
tasa transcripcional cuando el parásito se diferencia de la forma no-infectiva a la infectiva,
se correlaciona con la ruptura del nucleolo (Elias et al., 2001). Sin embargo, hasta el
19
Introducción
momento no han sido descriptos factores que regulen el ensamblado y la accesibilidad a
la cromatina. No sólo existen diferencias estructurales entre la cromatina de T. cruzi y la
de eucariotas superiores, sino también entre los diferentes estadíos del ciclo de vida de
este organismo. Dentro del estadío epimastigote, las diferencias existen en las formas de
fase exponencial y estacionaria. La cromatina de la forma epimastigote en la fase
exponencial está más compactada de acuerdo a ensayos de digestión con ADNasa I
(Spadiliero et al., 2002b), mientras que en las formas de fase estacionaria la cromatina
se encuentra desplegada extendiéndose hacia el centro del núcleo. Estas observaciones
sugieren que, en comparación con células eucariotas superiores, en T. cruzi la cubierta
nuclear juega un papel principal e inusual en la interfase y mitosis del ciclo celular
(Spadiliero et al., 2002a). Recientemente se describió que en T. cruzi los cromosomas se
mueven y, después de entrar en la fase S, se localizan en la periferia nuclear, lugar en
donde ocurre la replicación. Una vez finalizada la replicación se observan nuevamente
en el interior del núcleo (Elias et al., 2002).
En T. brucei se conoce que por mecanismos de variación antigénica (Borst, 2002;
Vanhamme et al., 2001), se expresa por vez un miembro de la familia multigénica VSG
en un sitio de expresión telomérico. En la forma procíclica la VSG no se expresa, pero sí
en la forma infectiva sanguínea. Un estudio de accesibilidad transcripcional con la ARNP
del bacteriófago T7, demostró que la transcripción está reprimida solamente (en el sitio
de expresión) en el estadío procíclico. Esto sugiere que la cromatina accesible (del sitio
de expresión inactivo) en el estadío sanguineo es remodelada después de la diferenciación
para producir una estructura que sea accesible a la ARNP. Descubrimientos recientes
demuestran que el gen de la proteína VSG a expresar se localiza en un cuerpo
extranucleolar el cual contiene la ARNP-I en un estado transcripcionalmente activo
(Navarro and Gull, 2001).
3.3- “Splicing” de ARN.
Cabe mencionar en esta sección que mientras las células eucariotas utilizan el
proceso nuclear de cis-“splicing” como mecanismo de maduración de sus pre-ARNms,
los tripanosomas se caracterizan por procesar los transcriptos policistrónicos a través
del trans-“splicing” nuclear.
3.3.1- trans-“splicing” y poliadenilación: dos procesos acoplados en
tripanosomas.
Como se mencionó anteriormente, la transcripción en tripanosomas es
policistrónica. Es decir, se generan unidades transcripcionales largas, las cuales deben
procesarse para la producción de ARNms maduros. En teoría, este procesamiento puede
lograrse por una simple reacción de clivaje en la molécula precursora de ARN. Sin embargo,
en la práctica se requieren dos reacciones de procesamiento las cuales se determinó que
están acopladas: (1) trans-“splicing” en el extremo 5’ terminal y (2) poliadenilación en el
extremo terminal 3’ del ARNm (Figura 3) (Matthews et al., 1994; Ullu et al., 1993). La
señal para estos procesos se encuentra adelante del sitio 5’-aceptor de “splicing” (señal
AG), el cual normalmente contiene un tracto de polipirimidina (ver Figura 3). Esta
20
Introducción
secuencia señaliza el trans-“splicing” de la secuencia del SL al extremo 5’-terminal del
ARN, compuesto por el dinucleótido AG. La poliadenilación del pre-ARNm precedente
está espacial y temporalmente acoplada al “splicing”, y por lo tanto, se piensa que también
está mecanísticamente acoplada. La poliadenilación ocurre, generalmente, entre 100400 nt adelante del sitio 5’ aceptor de “splicing”, dependiendo de las especies (LeBowitz
et al., 1993; Matthews et al., 1994).
orf-1
ag
orf-2
PA
ag
pPy
orf-3
PA
ag
pPy
pre-ARNm policistronico
SL nativo
orf-1
ag
poli(A)
SL
orf-2
poli(A)
SL
ag
orf-3
poli(A)
ag
ARNms maduros
Figura 3 - Procesamiento de policistrones de ARN en tripanosomas. El
acoplamiento de procesos regulatorios también ocurre en tripanosomas y
primariamente fue descripto en el procesamiento de policistrones, en donde existe
un acoplamiento entre el trans-“splicing” y la poliadenilación como procesos de
maduración del pre-ARNm. Tan rápido como son sintetizadas, las unidades
policistrónicas son cortadas en sitios específicos, por la supuesta acción de una
maquinaria que reconoce tractos de polipirimidina (pPy) en las regiones
intergénicas. AG, sitio aceptor 5’ de “splicing”; SL, “spliced leader”; pA, sitio de
corte y agregado de la cola de poli(A). orf, marco abierto de lectura.
Durante el trans-“splicing”, el ARNm sufre un proceso de “capping”, a partir del
cual se transfiere el SL más el “cap” a todos los extremos 5’-terminales de los pre-ARNms.
Se sabe que en las células eucariotas la ubicua estructura del “cap” de los ARNms y de
los precursores de los snARNs, es el resultado de modificaciones químicas esenciales
que ocurren durante la elongación transcripcional. En los tripanosomas, sin embargo,
la estructura del “cap” está restringida al ARN del SL y también a los precursores de los
snARNs U2, U3 y U4 (Silva et al., 1998). Se sabe que el “cap-SL” es una de las estructuras
más elaboradas de la naturaleza y consiste de un residuo 7mGpppG seguido de 4
nucleótidos metilados. En 1998, se caracterizó y purificó la enzima guanililtransferasa
de Chritidia fasciculata, encargada de la transferencia de GMP desde el GTP, al extremo
difosfato del ARNm. Esta enzima tiene un C-terminal con motivos similares a los descriptos
en levaduras y un N-terminal que no presenta homología aparente con otras proteínas
involucradas en la generación del “cap” (Silva et al., 1998). Por homología de secuencias
se observó que esta enzima también está conservada en otras especies de parásitos
kinetoplástidos incluyendo T. brucei (Silva et al., 1998).
Por el momento no hay evidencias firmes que indiquen que el trans-“splicing”
pueda estar involucrado en la regulación de la expresión de genes durante el desarrollo,
salvo el ejemplo de genes acoplados al sitio de expresión de las VSG (Vanhamme et al.,
1999). Sin embargo, lo que sí se sabe es que existen sitios 5’-aceptores del “splicing” que
son más eficientes que otros. Por ejemplo, los sitios 5’-aceptores de los genes que codifican
21
Introducción
las proteínas ribosomales TcP2β son potencialmente fuerte (Vázquez et al., 1994), en
comparación con el del ARNm fosfoglicertato-quinasa-a (pgka) en T. brucei (Kapotas and
Bellofatto, 1993) y tuzina en T. cruzi (Teixeira et al., 1999). En cuanto a la región 5’-no
codificante (NC) de algunos transcriptos de α-tubulina en T. brucei, se describió que
contienen elementos que pueden servir como regiones exónicas que modularían la tasa
de trans-“splicing” (Lopez-Estrano et al., 1998). En el laboratorio del Dr. Levin, fue de
gran interés el estudio de un retrotransposón llamado SIRE por “Short interspersed
repetitive element”, el cual puede actuar como sitio 3’-aceptor de “splicing” (Vazquez et
al., 1994) y además, como sitio aceptor de poliadenilación (Vazquez et al., 2000).
Aproximadamente 1500 copias de SIRE están distribuidas en todos los cromosomas del
clon Cl Brener y asociado a una gran variedad de genes (Vazquez et al., 1999). En resúmen,
no sólo las regiones intergénicas ubicadas entre los sitios aceptores de trans-“splicing” y
de poliadenilación son importantes en la regulación del “splicing”, sino también existen
secuencias reguladoras en las regiones no codificantes que pueden actuar como
reguladores positivos o negativos. De esta manera, el control de la maduración y el
procesamiento del pre-ARNm puede ocurrir en varias etapas diferentes, acopladas y a
nivel post-transcripcional.
3.3.2- cis-“splicing” en tripanosomas.
A diferencia de lo que ocurre en la mayoría de los organismos eucariotas, el genoma
de los tripanosomas carece prácticamente de intrones. Sólo un ejemplo de intrón fue
descripto hasta el momento, el cual parece ser la excepción a la regla. El gen que codifica
la poli(A)-polimerasa de T. cruzi y T. brucei presenta un intrón de 302 y 653 pbs,
respectivamente (Mair et al., 2000). Este intrón presenta las secuencias consenso que
funcionan como sitio aceptor 5’ y sitio dador 3’ en la reacción de cis-“splicing” (Mair et
al., 2000), y puede ser removido en forma eficiente “in vivo”. Sorprendentemente, este
ARNm también puede sufrir trans-“splicing” y el sitio aceptor para cis-“splicing” puede
también funcionar como sitio aceptor en trans. No se ha determinado aún si este proceso
puede tener una función regulatoria en la actividad polimerasa de la proteína.
3.4- Edición mitocondrial de pre-ARNms en tripanosomas.
En el año 1986 se demostró por primera vez que en la mitocondria de los
tripanosomas ocurre un proceso post-transcripcional relacionado con la inserción y/o
deleción de residuos de Uridina en 12 de 18 transcriptos analizados (Benne et al., 1986).
Más adelante, se determinó que el genoma mitocondrial está compuesto por maxicírculos,
los cuales codifican ARNms mitocondriales no funcionales, y minicírculos, los cuales
codifican pequeños ARNs guías (ARNg), que son quienes proveen la información genética
requerida para la edición del ARNm. Las proteínas que forman la maquinaria de la edición
del pre-ARNm, están codificadas en el genoma nuclear y son importadas a la mitocondria
(ver revisión en Madison-Antenucci et al., 2002). Por lo tanto, esto demuestra que la
edición del pre-ARNm necesita tanto de información mitocondrial como nuclear.
22
Introducción
3.5- Transporte de ARNms del núcleo al citoplasma.
3.5.1- Transporte de ARNms en eucariotas superiores.
El transporte de ARNms está acoplado a pasos anteriores del control de la expresión
génica, como son el “splicing” y eventos posteriores, como es el proceso de NMD (“Nonsense
Mediated Decay”), el cual se discute en la sección siguiente. El complejo del poro nuclear
(NPC) contiene nucleoporinas que forman un canal central a través del cual el cargo o
molécula sustrato es transportada. Este canal tiene un diámetro de ~9 nm y puede
expandirse hasta ~26 nm durante el transporte activo de moléculas. Además de las
nucleoporinas, contiene un “basket” o canasta nuclear, anillos nucleares y citoplasmáticos
y un complejo central llamado “spoke” o radio (Vasu and Forbes, 2001). El transporte del
cargo, requiere miembros de una familia de proteínas llamadas karioferinas, que incluye
a las exportinas e importinas. Estos receptores interaccionan con proteínas cargo vía
señales específicas de localización, conocidas como NLS por “Nuclear Localization Signal”
y NES por “Nuclear Export Signal”. Ambas karioferinas requieren para el transporte otra
molécula llamada RanGTPasa, que es la que regula la interacción entre el cargo y el
receptor. Es así como se forma un complejo ternario Cargo-Karioferina-RanGTPasa, el
cual cumple un papel regulador en el transporte de moléculas. Para el importe nuclear,
el cargo y la importina se translocan al núcleo y luego se libera el cargo del receptor por
unión del RanGTP. En cambio para el exporte nuclear, el cargo y la exportina se unen
cooperativamente a RanGTP. Este complejo se trasloca al citoplasma y el cargo se libera
con la concomitante hidrólisis de GTP en Ran. De esta manera, la direccionalidad del
transporte está mantenida por la presencia de RanGTP en el núcleo y RanGDP en el
citoplasma y la acción de una RanGTPasa específica (Reed and Hurt, 2002).
El mejor receptor caracterizado hasta el momento es la proteína exportina-1
(CRM1/Xpo1), la cual se requiere para el transporte de proteínas y/o complejos
ribonucleoproteicos desde el núcleo hacia el citoplasma. Este receptor se une directamente
a secuencias ricas en Leu del tipo NES presentes en las moléculas cargo (Mattaj and
Englmeier, 1998). La proteína CRM1/Xpo1 es capaz de transportar ARNms, como así
también los precursores de los U snARNs (ver revisión en Macara, 2001). Los U snARNs
son transportados como precursores al citoplasma, lugar en donde se ensamblan
correctamente en partículas ribonucleoproteicas. El transporte de U snARNs depende de
la estructura del “cap”, el complejo de unión al “cap” (CBC), CRM1/Xpo1 y Ran-GTP.
Además, se requiere una molécula adaptadora denominada PHAX la cual interacciona
con CRM1/Xpo1 y CBC (Ohno et al., 2000). El transporte de otras clases de ARNs,
incluyendo ARNt, ARNr y snARN requiere otros miembros de la familia de las karioferinas
(Nakielny and Dreyfuss, 1999).
Existen proteínas de unión a ARN del tipo hnRNP “heteronuclear
RiboNucleoProteins”, que pueden viajar entre el núcleo y el citoplasma. El hecho de que
éstas proteínas se muevan entre los dos compartimentos, permitió proponer que además
sirven para transportar ARNms. Estudios recientes relacionados con el transporte de
ARNms, permitieron identificar una nueva serie de factores no relacionados con las
karioferinas que forman una familia de proteínas conservadas, NXF o TAP (Herold et al.,
2000). En metazoos, se sabe que TAP heterodimeriza con p15, y el hetero-dímero es
23
Introducción
esencial para el transporte de ARNms a través del complejo del poro nuclear (Herold et
al., 2001). Es interesante destacar que los componentes de la maquinaria de transporte
de ARNm, están física y funcionalmente acoplados al “splicing”. Este descubrimiento
permitió entender el acoplamiento que existe entre el “splicing” y NMD, un mecanismo
de “vigilancia” utilizado para degradar ARNms que presentan codones prematuros de la
traducción (ver sección siguiente).
3.5.2- Transporte nucleo-citoplasmático en tripanosomas.
Es intersante destacar que estudios recientes permitieron describir la presencia
de una estructura semejante al poro nuclear de eucariotas superiores en células de
tripanosomas (Rout and Field, 2001). Además, se describió la presencia de proteínas con
secuencias NLS activas, como la histona del tipo H2B y la proteína de unión a ARN La
(Marchetti et al., 2000). Recientemente, la proteína exportina-1 (tCRM1/tXpo1) fue
identificada en T. cruzi y T. brucei (D’Orso et al., manuscrito en preparación). Existen
proteínas en T. cruzi que presentan secuencias NES putativas, las cuales podrían formar
parte del camino de transporte de proteínas del núcleo al citoplasma mediado por tCRM1/
tXpo1.
3.6- Degradación de ARNms conteniendo codones prematuros. Acoplamiento
entre “splicing”, transporte de ARNm y NMD en eucariotas superiores.
Una vez que el pre-ARNm es procesado a través del “capping”, “splicing” y
poliadenilación, se genera un ARNm maduro el cual está sujeto a nuevos pasos
regulatorios. En primer lugar, existen secuencias específicas del ARNm las cuales son
reconocidas por factores proteicos que determinan su destino final en términos de
estabilidad, localización y/o modulación de la traducción. Todos estos pasos forman
parte de lo que se llama control de la calidad de la función del ARNm (Maquat and
Carmichael, 2001). Si el ARN presenta codones prematuros, o los procesos de “splicing”
y/o poliadenilación ocurren en forma aberrante, el ARNm puede ser degradado. Parte de
este último paso de control, está relacionado con la retención nuclear y con procesos de
control antes de que el ARNm sea transportado al citoplasma. En tripanosomas, hasta el
momento no hay resultados significativos en esta área de investigación. Sin embargo en
otros tipos celulares, incluyendo levaduras y mamíferos, se conocen los mecanismos
que regulan el control de la calidad del ARNm sintetizado. Estos se basan en el
acoplamiento de los procesos de “splicing” y NMD (Figura 4), cuyas maquinarias están
estrictamente interelacionadas (ver revisión en Dreyfuss et al., 2002).
Como se mencionó anteriormente, el NMD elimina ARNms que presentan codones
prematuros de la traducción (Ishigaki et al., 2001). En metazoos, se sabe que la presencia
de codones prematuros, más de 50 nt adelante de la unión exón-exón, desencadena
NMD en el citoplasma y está acoplado al “splicing” en el núcleo (Lykke-Andersen et al.,
2000). El proceso de NMD se desencadena por la localización de la proteína hUpf3 después
del codón prematuro de la traducción (Lykke-Andersen et al., 2000).
24
Introducción
Y14 Aly
Upf3
magoh
TAP
SRm160
Figura 4 - Acoplamiento entre “splicing” y NMD durante el procesamiento
de pre-ARNms en células eucariotas.
El complejo EJC (“Exon-Junction Complex”) se ensambla en los ARNms como
resultado del “splicing”. La proteína TAP/
p15 se une a los componentes del EJC y
media la interacción del complejo
ribonucleoproteico con receptores del poro
nuclear (NPC). Durante el transporte de
ARNms, e inmediatamente más tarde, la
composición del complejo se modifica, ya
que varios de sus componentes se
disocian dejando sólo a Y14, magoh, Upf3
y RNPS1, en la misma posición en la que
el complejo se ensambló inicialmente en
el núcleo. Upf2 probablemente se une a
Upf3 luego del transporte al citoplasma
(Dreyfuss et al., 2002). Este complejo
controla el destino celular del ARNm. NPC,
“Nuclear Pore Complex”; In, Intrón.
Upf2
p15
Upf2
RNPS1
Citoplasma
NPC
Nucleo
transporte
ARNm
TAP
p15
EJC
EJC
Upf3
Aly
magoh
Y14
RNPS1
SRm160
splicing
pre-ARNm
In
In
Sin embargo, el mecanismo que recluta a hUpf3 en el ARNm se desconocía hasta
hace un año. Recientemente, dos grupos de trabajo, el del Dr. G. Dreyfuss y el de la Dra.
J. Steitz, encontraron en forma simultánea indicios que permiten explicar cómo procede
este mecanismo (Figura 5). Existe un complejo llamado EJC por “Exon Junction Complex”
que presenta varios componentes conservados entre NMD y la maquinaria de exporte de
ARNm (Kim et al., 2001; Lykke-Andersen et al., 2001). Entre ellas, la proteína Y14 (Kataoka
et al., 2000), el factor de “splicing” RNPS1 (Mayeda et al., 1999) y hUpf3 (Lykke-Andersen
et al., 2000), las cuales pueden movilizarse entre el núcleo y el citoplasma. De esta
manera, el complejo EJC funciona en ambos procesos (Figura 5), transmitiendo una
marca en la unión exón-exón durante el transporte al citoplasma. Después del transporte
del ARNm, otros factores relacionados con el NMD como hUpf1 y hUpf2, se reclutan a
través de la interacción con hUpf3. Este complejo, produce la degradación del ARNm si
la maquinaria de traducción encuentra el codón prematuro de la traducción. Esta
degradación se desencadena por eliminación del “cap” sin deadenilación, seguido por
degradación en sentido 5’-3’ mediado por la exoribonucleasa Xrn1. En ARNms normales,
es decir sin codones prematuros para la terminación de la traducción, el complejo de
NMD es desplazado por el ribosoma durante la traducción, y de esta manera se evita su
degradación (Kim et al., 2001; Lykke-Andersen et al., 2001). También se encontró que
los factores CBP80-CBP20, ambos componentes del complejo que unen el “cap” en forma
co-transcripcional en el núcleo, están involucrados en el proceso de NMD. Ambos realizan
una ronda pionera de traducción, después de ser reemplazados por el factor de traducción
citoplasmático eIF4E, momento en que las proteínas hUpf2 y hUpf3 se disocian de la
unión exón-exón (Ishigaki et al., 2001). De esta manera, el proceso de control nuclear
NMD ocurre mientras los ARNms están unidos por las proteínas que reconocen el “cap”
25
Introducción
y la proteína de unión a poli(A) (PABP) nuclear o PABP2 (Ishigaki et al., 2001).
3.7- Degradación nuclear y citoplasmática de ARNms y la maquinaria
involucrada en células eucariotas superiores.
En células de mamíferos se sabe que al menos del 5% de los enlaces fosfodiester
nacientes correspondientes a transcriptos sintetizados por ARNP-II finalizan en ARNms
citoplasmáticos maduros (Jackson et al., 2000). Resultados similares se observaron para
ARNs sintetizados a partir de las ARNP-I y ARNP-III. Estos datos permiten concluir que
el principal volúmen de recambio de ARN en las células de mamíferos ocurre en el núcleo
en vez del citoplasma. De la misma manera que sucede con el recambio de proteínas, el
recambio y la degradación del ARN intracelular debe estar muy regulado para evitar la
eliminación aberrante de los transcriptos. Se sabe que la principal maquinaria de
degradación intracelular de ARN es exonucleolítica, es decir, a partir de los extremos 5’
o 3’ del ARNm. Por lo tanto, las moléculas de ARN se protegen del ataque promiscuo,
evitando exponer sus extremos terminales. El extremo 5’ de los ARNms se protege a
partir de la estructura del “cap”, cuya estructura protege al ARNm a partir de proteínas
que lo reconocen, como CBP-80 y CBP-20 en el núcleo de la célula (Ishigaki et al., 2001).
Un ARNm puede ser degradado por deadenilación, desplazamiento de las proteínas unidas
que lo estabilizan, ruptura de su estructura terciaria o clivaje endonucleolítico en sitios
de reconocimiento internos ya no protegidos. Una vez que un extremo del ARN está
accesible, existen exonucleasas que atacan el ARN en ambos sentidos 3’-5’ y 5’-3’ (Moore,
2002). La maquinaria que degrada el ARNm nuclear ha sido extensivamente caracterizada
en levaduras, en donde los caminos de ataque exonucleolítico por deadenilación del
transcripto son predominantes (Bousquet-Antonelli et al., 2000). La mayor parte de esta
actividad exonucleolítica es provista por el exosoma (Mitchell and Tollervey, 2000; van
Hoof and Parker, 1999). El exosoma, descubierto en el laboratorio del Dr. Tollervey, es
un complejo de 11 proteínas de las cuales la mayoría son exonucleasas del tipo 3’-5’.
Además, existen factores accesorios que incluyen ARN helicasas, una GTPasa y proteínas
que trasladan o localizan al exosoma a una secuencia particular del ARN (Mitchell and
Tollervey, 2000). Todas las subunidades del exosoma están conservadas en humanos
(van Hoof and Parker, 1999). El exosoma también funciona en el citoplasma de la célula,
donde es requerido para la degradación en sentido 3’-5’ de los ARNms deadenilados (van
Hoof and Parker, 1999). La diferencia entre el complejo exosoma entre ambos
compartimentos celulares reside en que el citoplasmático carece de una subunidad, la
proteína Rrp6p, una ARNasa de tipo D con actividad 3’ exo-hidrolasa. Esta proteína es la
única subunidad del exosoma no requerida para la viabilidad celular (Allmang et al.,
1999).
También hay evidencias sobre la existencia de un camino nuclear de degradación
con sentido 5’-3’. La levadura S. cerevisiae contiene dos exonucleasas 5’-3’ conocidas
como Rat1p y Xrn1p, las cuales están conservadas también en humanos. La primer
proteína es esencial para el crecimiento. En cambio, Xrn1p aunque no es esencial, forma
parte del camino más importante de degradación para ARNms deadenilados y del proceso
de recambio NMD como se indicó en la sección anterior. Además se encontró que el
26
Introducción
exosoma es atraído a ARNms de vida-media corta por proteínas que se unen a elementos
desestabilizantes como los ARE (Chen et al., 2001) (ver más adelante). Esto sugiere un
mecanismo paralelo para la atracción del exosoma a transcriptos que están destinados a
sufrir NMD (Moore, 2002).
Upf3
Upf2
SRm160
magoh
Y14
RNPS1
ribosoma
ter
EJC
EJC
ter
EJC
eRFs
ARNms normales
Upf1
ter
CPT
ribosoma
PROXIMA RONDA
DE TRADUCCION
EJC
EJC
EJC
ARNms con codones
prematuros traduccion
INICIACION
ter
ter
CPT
EJC
EJC
eRFs
DEGRADACION
DEL ARNm
"Deccaping"
Upf1
ELONGACION
Disociacion del EJC
TERMINACION
Vigilancia
Figura 5 - Rol del EJC en la degradación de ARNms que contienen codones
prematuros para la terminación de la traducción. En el caso de ARNms normales,
los codones de terminación (ter) están generalmente río abajo del extremo 3’, es decir,
~55 nt antes de la última unión exón-exón. De esta manera, los ribosomas remueven
el complejo entre Y14-Upf2-Upf3 (EJC, “Exon-Junction Complex”) al término de la
traducción. Durante la terminación, Upf1 y el factor de liberación traduccional (eRF3)
se reclutan y forman parte del complejo de vigilancia, el cual rastrea por posibles
remanentes del complejo Y14-Upf. A menos que el complejo de vigilancia encuentre el
complejo Y14-Upf, la traducción procede a una nueva ronda de síntesis. En caso de
que el ARNm presente codones prematuros para el término de la traducción (CPT),
localizados más de 55 nt antes de la última unión exón-exón, la traducción se frena
antes de que el complejo Y14-Upf se remueva. El complejo Y14-Upf remanente
interacciona con el complejo de vigilancia y desencadena el “decapping” del ARNm,
generando su degradación.
3.8- Degradación de ARNms en tripanosomas.
En los parásitos kinetoplástidos, más específicamente en T. brucei, también se
encontró la maquinaria del exosoma, tanto en núcleo como en citoplasma, aunque ambos
complejos son más pequeños que los de levadura, ya que están compuestos por 8
subunidades (Estévez et al., 2001).
Los experimentos relacionados con el estudio de mecanismos de degradación de
ARNms en kinetoplástidos han sido principalmente restringidos a observaciones
relacionadas con la utilización de inhibidores de la transcripción y traducción (ver más
adelante). Básicamente, permitieron determinar que la abundancia de transcriptos
particulares es incrementada o disminuida por alguno de estos tratamientos (Brittingham
et al., 2001; Graham and Barry, 1996; Teixeira et al., 1995).
27
Introducción
3.9- Interferencia por ARN (RNAi).
3.9.1- RNAi en células eucariotas superiores.
Este mecanismo se refiere al silenciamiento génico en forma post-transcripcional
a través del cual ARN doble cadena (ARNdc) gen específico, desencadena la degradación
del ARNm celular homólogo. La interferencia por ARN es un proceso que está distribuído
en todos los organismos eucariotas y está mecanísticamente relacionado al silenciamiento
de genes en forma post-transcripcional en plantas (Kooter et al., 1999) y “quelling” en
Neurospora (Cogoni and Macino, 1999). Es considerado un mecanismo de defensa contra
transcriptos aberrantes los cuales pueden ser producidos por una infección viral o por
movilización de transposones (Ketting et al., 1999). Los modelos actuales sugieren que
después de la entrada a la célula del ARNdc, una nucleasa produce ARNs pequeños de
entre 21-25 nt o “small interfering” ARNs (siARNs), los cuales sirven de secuencias guía
para la degradación del ARN blanco (Zamore et al., 2000). Estudios “in vitro” permitieron
demostrar que la adición de ARNdc sintético en un extracto de Drosophila, produce el
clivaje del ARNm homólogo, generando ARNs pequeños con una periodicidad de corte
entre 21-23 nt (Zamore et al., 2000). A partir de estudios de fraccionamiento bioquímico
en extractos libre de células de Drosophila, se demostró que existe una actividad que
degrada el ARNm blanco y que co-purifica con los siARNs. Recientemente, se identificó
un candidato de la actividad ARNasa tipo-III, la cual se llamó Dicer por su habilidad por
digerir ARNdc y generar fragmentos homogéneos en tamaño y equivalentes a los siARNs
(Bernstein et al., 2001). Algunas proteínas homólogas a Dicer se encontraron en C. elegans
y en células humanas (Grishok et al., 2001; Hutvagner et al., 2001).
3.9.2- RNAi en tripanosomas.
En tripanosomas, el proceso de interferencia mediada por ARNdc se demostró en
el año 1998 (Ngo et al., 1998). El ARN blanco para la degradación es citoplasmático ya
que los pre-ARNms no son sustratos de la actividad de degradación. Además, se demostró
por primera vez en el laboratorio de la Dra. E. Ullu, que la degradación puede ser
desencadenada por ARNdc introducido por electroporación o ARNdc producido “in vivo”
a partir de la transfección de un plásmido que contenga promotores opuestos a la
secuencia a transcribir (Shi et al., 2000), o también inducido por “hairpins” de ARN
transcriptos a partir de promotores inducidos con el sistema de tetraciclina (Bastin et
al., 2000; Shi et al., 2000). Más recientemente en T. brucei, se demostró que la activación
de la interferencia por ARN resulta en la producción de los siARNs y que el 10% de estos
ARNs sedimentan en complejos de alto peso molecular (Djikeng et al., 2001). Se observó
que algunos de estos siARNs provienen de la degradación de retro-transposones. Aunque
todavía no se ha identificado y caracterizado la(s) proteína(s) que forman parte de este
complejo en T. brucei, se especula que la interferencia por ARN en tripanosomas podría
servir como un mecanismo de control constitutivo involucrado en el silenciamiento de
transposones.
3.10- Control traduccional.
28
Introducción
3.10.1- Traducción en general.
El inicio de la traducción en eucariotas comienza con la unión de factores
iniciadores a la estructura del “cap”, seguido de la unión de la subunidad ribosomal
pequeña y la lectura a partir del primer sitio de inicio de la traducción (ver revisión en
Sachs et al., 1997). La presencia de una estructura secundaria larga en la región 5’-NC
del ARNm puede impedir la lectura por el ribosoma y además, proteínas que reconocen
secuencias en esa región, pueden evitar la traducción en forma efectiva. Está claramente
establecido que la mayoría de los ARNms activos para la traducción, se encuentran
circularizados debido a la interacción de la proteína PABP1 y el complejo de iniciación
eIF4 en el extremo 5’ del ARNm (Dreyfuss et al., 2002). De alguna manera, esto explica
porque la traducción es mucho más eficiente y capaz de amplificarse en ARNms que
presentan una cola de poli(A) en su extremo 3’-terminal. Sin embargo, no está descripto
hasta el momento si el tamaño de la cola del poli(A) regula la eficiencia de traducción.
3.10.2- Regulación a nivel traduccional en tripanosomas.
Es probable que el control traduccional juegue un papel importante en la regulación
de la expresión génica en tripanosomas; sin embargo, hay pocos resultados en esta área
de investigación. La metodología se basa en la comparación de los niveles de ARNms en
el estado estacionario, con los niveles o actividades enzimáticas de los productos proteicos
finales en diferentes estadíos de desarrollo del parásito. De este modo, se evidenciaron
algunas indicaciones de control traduccional. Entre ellas se encuentran como ejemplo
las prociclinas EP del tripanosoma africano (Hotz et al., 1998). Por otro lado, los niveles
del ARNm de la fructosa bifosfatasa aldolasa son 6 veces mayores en el estadío sanguíneo,
sin embargo la proteína está expresada 30 veces más en ese estadío (Hotz et al., 1995).
Resultados similares se encontraron durante el estudio de la regulación del gen que
codifica el citocromo c de T. brucei, la proteína se expresa 100 veces más en el estadío
procíclico, pero el ARNm sólo 3-5 veces más (Priest and Hajduk, 1994; Torri and Hajduk,
1988). De esta manera, los resultados relacionados con el control traduccional en estos
organismos, sólo se desprenden de la comparación de los niveles relativos de los productos
finales (ARNms y proteínas), durante las diferentes etapas del ciclo de vida del parásito.
En tres especies de organismos kinetoplástidos diferentes se determinó que el largo de
ambas regiones, 3’-NC y cola de poli(A), no tiene un efecto regulatorio en la traducción
(ter Kuile and Salles, 2000).
Pocas proteínas se identificaron como posible reguladores de la traducción. La
proteína citoplasmática PABP1 en T. cruzi, T. brucei y Leishmania, la cual interacciona
con la cola de poli(A) de los ARNms (Bates et al., 2000; Batista et al., 1994; Hotchkiss et
al., 1999). Se describió un factor relacionado con la traducción, EF-1α (Billaut-Mulot et
al., 1996), aunque ninguna función se asignó “in vivo”. Por último, se clonó un gen de T.
cruzi llamado DnaJ que codifica la proteína TcJ6, la cual presenta identidad a la chaperona
Sis-1 de S. cerevisiae (Salmon et al., 2001). Esta proteína está localizada en el retículo
endoplásmico y se requiere para el inicio de la traducción.
3.10.3 -Función de la proteína PABP1 en la traducción en mamíferos.
29
Introducción
La mayoría de los ARNms de eucariotas presentan una cola de poli(A) en su extremo
3’, la cual varía de 50 a 250 pbs en levaduras y eucariotas (Jacobson and Peltz, 1996). La
poliadenilación se regula en estos organismos por la presencia de una típica secuencia
en la región 3’-NC (5’-AAUAAA-3’), y de un elemento involucrado en la poliadenilación
citoplasmática, llamado CPE (“citoplasmic polyadenylation element”). Ambas secuencias
interaccionan con diferentes factores celulares. La proteína CPEB interacciona con CPE
y recluta al factor de especificidad de poliadenilación y clivaje (CPSF), mientras que la
proteína poli(A)-polimerasa, se encarga de la polimerización de la cola de poli(A) de todos
los ARNms en el núcleo de la célula (Wahle and Ruegsegger, 1999). También se describió
la presencia de una proteína del tipo PAP llamada Gld-2, la cual adiciona tractos de
poli(A) a ARNms pero en el citoplasma de la célula (Wang et al., 2002). Una vez que la
cola de poli(A) ha sido sintetizada, tanto en núcleo como en el citoplasma, esta porción
no codificante del ARNm interacciona con la proteina PABP1.
Paip2
eRF3
PABC
PABC
PABP1
PABP1
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
PABP1
PABP1
eIF4G
ARNm
eIF4E
5'-Cap
PABC
PABC
eIF4A Paip1
Figura 6 - Modelo de la interacción entre
PABP1 y eIF4 y su rol en la traducción.
PABP1 presenta 4 motivos RRM unidos al
dominio PABC por una extensa región no
plegada. Múltiples moléculas de PABP1 pueden
interaccionar con la cola de poli(A) de un ARNm
vía los motivos RRM para formar un complejo
ARN-proteína. La circularización del ARNm
ocurre a través de la unión con eIF4E unido al
extremo 5’-terminal “cap” y los dominios RRM
de PABP1. El dominio PABC une péptidos de
secuencia lineal para reclutar factores proteicos
al complejo ARN-proteína. Algunas de las
moléculas que interaccionan son Paip1, Paip2
y el factor de liberación traduccional eRF3, que
hacen de conectores para atraer a eIF4A y
posiblemente otros factores no descriptos hasta
el momento. Paip, “PABP-interacting-protein”.
La PABP1 es una proteína citoplasmática abundante, involucrada en la regulación
de la traducción (Figura 6). Estructuralmente está compuesta por dos porciones, una
región N-terminal que contiene 4 motivos RRM (“RNA-recognition motif”) y una región Cterminal que contiene un dominio conservado en todas las proteínas de unión a poli(A),
llamado PABC (“poly(A)-binding C-terminal), está compuesto por ~75 residuos (Kozlov et
al., 2001). Con una periodicidad de 27 nt de tractos de Adenosina se une una proteína
PABP1; por lo tanto, múltiples proteínas pueden unirse en la cola de poli(A) de un ARNm.
Este fenómeno de multimerización es requerido para la traducción eficiente del ARNm
(Tarun and Sachs, 1995). Además, la PABP1 es capaz de mediar la circularización del
ARNm a través de su interacción con el complejo de iniciación de la traducción, eIF4E
(Figura 7), el cual a su vez está asociado con la estructura del “cap” en el extremo 5’
(Tarun and Sachs, 1996). Este evento de circularización produce la amplificación de la
traducción, ya que facilita el reciclado de los ribosomas (Jacobson and Peltz, 1996). De
esta manera, PABP1 funciona como un “andamio” proteico, reclutando varios factores
traduccionales en el ARNm. Además de la subunidad eIF4G, existen otras moléculas que
interaccionan con PABP1, como Paip1, Paip2, y el factor de terminación traduccional
30
Introducción
eRF3 (“eukaryotic Release Factor”). La interacción con estos factores regula positiva o
negativamente la traducción (Craig et al., 1998; Khaleghpour et al., 2001). Además,
PABP1 puede evitar la degradación del ARNm a partir de la cola de poli(A), inhibiendo
indirectamente el ensamblado de una exonucleasa 3’-5’ (Ford et al., 1997) (ver Figura 7).
3.10.4 -Función del dominio C-terminal de PABP1 en la traducción.
El extremo C-terminal de la PABP1 (PABC), no fue el centro de atención en
comparación con la importancia dada al estudio de los motivos RRM. Sin embargo, durante
los últimos años se demostró su función en estructurar la cola de poli(A) del ARNm para
la traducción y en regular la localización celular de PABP1. Estas hipótesis fueron
confirmadas por estudios que demostraron que PABC es importante para la
multimerización proteica y para un correcto transporte núcleo-citoplasmático (Kuhn
and Pieler, 1996; Afonina et al., 1998). El dominio PABC presenta una región altamente
conservada (residuos 68-72), cuya identidad varía del 40 al 54% entre mamíferos, plantas,
levaduras y tripanosomas (Kozlov et al., 2002). La estructura en solución del dominio
PABC humano (hPABC), levaduras (yPABC) y T. cruzi (TcPABC), fue resuelta en el
laboratorio del Dr. Kalle Gehring (Kozlov et al., 2002; Kozlov et al., 2001; Siddiqui et al.,
2003). Las estructuras de hPABC y TcPABC presentan rasgos similares, con una
estructura de α-hélice globular, mientras que yPABC carece de la primera de las 5 hélicesα que componen hPABC (Kozlov et al., 2002) y TcPABC (Siddiqui et al., 2003).
Existe un gran número de proteínas conocidas que interaccionan con el dominio
hPABC. Entre ellas, Pbp1p (Mangus et al., 1998), la cual promueve una correcta
poliadenilación de los pre-ARNms; el factor de iniciación de la traducción eIF4G (Tarun
et al., 1997); el factor de liberación de la traducción eRF3 (Hoshino et al., 1999); una
proteína de mamíferos que muestra identidad con eIF4G, denominada Paip1, y Paip2
(Craig et al., 1998; Khaleghpour et al., 2001). El rango de función de las proteínas que
interaccionan con PABP1 es bastante amplio, desde la formación del extremo 3’-terminal
del pre-ARNm y poliadenilación, (Pbp1p); regulación de la estabilidad de ARNms, (eRF3);
circularización del ARNm y activación traduccional (eIF4G y Paip1) o represión
traduccional (Paip2).
4- Elementos en cis y regulación post-transcripcional.
4.1- Elementos en el 3’-NC y su función en la regulación de la estabilidad de
ARNms en tripanosomas.
El control del inicio de la transcripción es esencial en casi todos los organismos,
pero existen ciertas circunstancias en las cuales se requieren niveles adicionales de
regulación con el objetivo de obtener un correcto patrón de la expresión. Se sugirió que
la regulación a nivel post-transcripcional cumple una función importante en el
procesamiento y maduración de los pre-ARNms en tripanosomas (Vanhamme and Pays,
1995). En esta sección se discuten cuáles son las señales en cis- que se caracterizaron y
que cumplen un rol fundamental en la regulación de la expresión génica a nivel posttranscripcional. El predominio del control post-transcripcional sobre el transcripcional,
está probablemente correlacionado con la organización del genoma de los tripanosomas
31
Introducción
en unidades policistrónicas. Los primeros elementos reguladores identificados son de la
región 3’-NC del ARNm de los antígenos VSG de los tripanosomas africanos (Berberof et
al., 1995). Se demostró que existen elementos en la región 3’-NC de la VSG capaces de
regular la expresión de un gen reportero. Más específicamente, una secuencia de ~97 nt,
localizada antes de la señal de poliadenilación, es la responsable de regular la estabilidad
del ARNm de la VSG. En el estadío sanguíneo, se manifiesta un aumento de la estabilidad
del ARNm, mientras que en procíclicos el bajo nivel de proteína madura estaría relacionado
con una reducción en la eficiencia de maduración del transcripto (Berberof et al., 1995).
Por otro lado, la región 3’-NC de los ARNms que codifican las PARP EP y GPEET de
T. brucei, provee el mejor ejemplo de una región regulatoria identificada hasta el momento
en tripanosomas. Esta región 3’-NC contiene dos elementos diferentes: un “stem-loop”
de 16 nt y una secuencia rica en Uridina de 26 nt. El primer elemento aumenta la
traducción de un gen reportero en el estadío procíclico por un mecanismo aún desconocido,
pero no juega un rol en la regulación durante el desarrollo del parásito (Furger et al.,
1997). El segundo elemento rico en Uridina juega un papel en la regulación de la expresión
durante el desarrollo y se demostró que su deleción o mutaciones puntuales reducen o
suprimen su función (Hotz et al., 1997; Schurch et al., 1997). Otros dos ejemplos claros
se demostraron en el laboratorio de la Dra. C. Clayton. Se observó que la región 3’-NC del
ARNm de la fosfoglicerato-quinasa b (pgkb) presenta una secuencia rica en Uridina
desestructurada, que también regula la expresión en forma estadío específica. La deleción
de este elemento suprime la regulación a nivel de ARNm y de la proteína (Quijada et al.,
comunicación personal). En segundo lugar, un elemento de 26 nt del ARNm EP1 tiene
un rol desestabilizante en el estadío sanguíneo y es el responsable de la destrucción de
su 3’-NC por mecanismos de deadenilación o clivaje endonucleolítico (Irmer and Clayton,
2001). Estos dos elementos regulatorios presentan una gran similitud con los elementos
desestabilizantes ricos en Adenosina y Uridina, conocidos como “AU-rich elements” (AREs)
(Mitchell and Tollervey, 2000).
4.2- Motivos ARE y su función en la degradación de ARNms en mamíferos.
El recambio de ARNms es un proceso que está rigurosamente controlado en
cualquier célula. Varios elementos pueden regular el destino del recambio de un ARNm
en particular, promoviendo su degradación (elementos desestabilizantes) o inhibiendola
(elementos estabilizantes). Uno de los mejores elementos regulatorios caracterizados son
los ARE, localizados en la región 3’-NC de ARNms de citoquinas y factores de crecimiento,
entre otros (Bakheet et al., 2001; Chen and Shyu, 1995). Hay varias clases de AREs que
presentan leves variantes de secuencias y que a su vez, son caracterizados por su habilidad
de promover la rápida deadenilación y subsiguiente degradación del cuerpo del ARNm
(Chen and Shyu, 1995). Los diferentes grupos de AREs identificados hasta el momento
en eucariotas están resumidos en la Tabla 1. Básicamente hay tres grupos I, II y III. El
grupo I se caracteriza por la presencia de un pentámero AUUUA localizado en una región
rica en Uridina como en el ARNm de los proto-oncogenes c-fos y c-myc. El grupo II,
puede dividirse en cinco subgrupos dependiendo del contenido de motivos AUUUA
solapados. Por último, el grupo III se caracteriza por presentar regiones ricas en Uridina,
32
Introducción
pero carecen de los típicos pentámeros AUUUA de los grupos I y II, como por ejemplo los
presentes en el ARNm del proto-oncogen c-jun. La variedad de secuencias ricas en
Adenosina-Uridina presentes en las regiones 3’-NC de los ARNms, está relacionada con
la presencia de distintos grupos de proteínas de unión a ARN que los reconocen y cumplen
un papel determinado en el control post-transcripcional de la expresión génica (ver más
adelante).
Grupo
Motivos
Ejemplos
I
WAUUUAW y una región rica en Uridina.
c-fos, c-myc
IIA
AUUUAUUUAUUUAUUUAUUUA
GM-CSF, TNF-α
IIB
AUUUAUUUAUUUAUUUA
Interferon-α
IIC
WAUUUAUUUAUUUAW
Cox-2, IL-2, VEGF
I ID
WWAUUUAUUUAWW
FGF2
IIE
WWWWAUUUAWWWW
receptor u-PA
III
Región rica en Uridina, sin AUUUA.
c-jun
Tabla 1 - Tipos de elementos AREs involucrados en la desestabilización de ARNms.
Los elementos AREs se definen por su habilidad de promover una rápida degradación del
ARNm. Los AREs descriptos pueden agruparse en tres clases según se describió (Xu et al.,
1997). Se indican los diferentes grupos I, II y III; el motivo característico de cada grupo y
los ejemplos de cada uno. W, significa cualquier ribonucleótido.
4.3- Interrelación entre los procesos de degradación de ARNms y traducción:
rol de la cola de poli(A) y elementos en cis en la formación de complejos proteicos
en eucariotas superiores.
El recambio de ARNms esta mediado tanto por la cola de poli(A), como por
secuencias localizadas a lo largo de todo el ARN, las cuales regulan la interacción y
formación de complejos proteicos. En el ARNm c-fos, se describió un determinante de
inestabilidad (mCRD) localizado en su región codificante, el cual ilustra cómo los procesos
de recambio del ARNm y traducción están, en algunos casos, mutuamente
interrelacionados (Grosset et al., 2000). La función del mCRD depende de su distancia
con respecto a la cola de poli(A), y el mismo interacciona con 5 proteínas formando un
complejo multiproteico. La sobre-expresión de cualquiera de estos 5 factores (PABP1,
hnRNP D, Paip1, NSAP1 y Unr), aumenta la estabilidad de ARNms que contienen el
determinante mCRD, impidiendo su deadenilación (Grosset et al., 2000). En ese trabajo,
además se propuso que la formación del complejo multiproteico entre la cola de poli(A) y
el mCRD, dificulta el tránsito del ribosoma o el ribosoma puede desarmar el complejo
produciendo un rápido decaimiento del ARNm c-fos.
Recientemente, se describió que la PABP1 también forma parte de un complejo
multiproteico (Figura 7), el cual se forma en la región 3’-NC de ARNms que contienen
secuencias ARE (Wilusz et al., 2001). La unión de algunos factores como hnRNP D al
ARE, puede alterar la interacción entre PABP1 y las proteínas de unión al “cap” en el
extremo 5’-NC, como eIF4G. Este fenómeno facilita el acceso de la poli(A)-ribonucleasa y
el ataque exonucleolítico en sentido 3’-5’ (Chen et al., 2001). De esta manera, las proteínas
de unión al ARE desencadenan la degradación del transcripto por ruptura de la interacción
33
Introducción
del complejo multiproteico del cual forma parte PABP1 (Figura 7). Este evento genera un
ARN lineal sin cola de poli(A) por el ataque del exosoma y sin protección en el extremo 5’terminal, por la acción de enzimas que remueven el “cap”. En resúmen, se demostró que
existe una conexión funcional entre la actividad del exosoma y el “decapping” del ARNm
(Wang and Kiledjian, 2001).
DEGRADACION POR
DEADENILACION
AA
PARN
NPD
ARE
A
A
AAAAA
PABP1
hnR
PABC
eIF
4G
5'-Cap
ARNm
ESTABILIZACION
eIF4E
AAAAAAAAAAAA
ARE
PD
N
hnR
PABP1
eIF
4G
AAAAAAAAAAAA
ARE
R
Hu
PABC
eIF4E
ARNm
PABP1
eIF
4G
PABC
eIF4E
ARNm
5'-Cap
Union hnRNP D
5'-Cap
Union HuR
Figura 7 - Modelo de regulación de
la estabilidad de ARNms mediado por
motivos ARE. La interacción del ARE
con el factor desestabilizante hnRNPD
puede promover una rápida
deadenilación del ARNm, ya que esta
interacción reduce la afinidad de
PABP1 por la cola de poli(A). En
cambio, los factores estabilizantes,
como proteínas de la familia Hu, HuR,
pueden promover el aumento de la
interacción de PABP1 con la cola de
poli(A). De esta manera, se bloquea la
deadenilación y la degradación del
ARNm.
AAAAAAAAAAAA
ARE
PABP1
eIF
4G
PABC
eIF4E
ARNm
5'-Cap
4.4- Efecto de inhibidores de la traducción en la estabilidad de ARNms en
tripanosomas.
La inhibición de la síntesis proteica aumenta la abundancia de varios ARNms
inestables en tripanosomas. En general se utilizó cicloheximida, que inhibe la elongación
de la traducción por detención de los ribosomas sin liberación de los ARNms (Ross,
1997). De esta manera, la estabilización se puede interpretar de la siguiente forma: (1) la
asociación con los polisomas de alguna manera inhibe su degradación, o (2) la degradación
de los ARNms, requiere una proteína que es inestable o de vida-media corta; es decir,
inhibible por cicloheximida. Esta proteína regulatoria puede ser un componente de la
maquinaria de degradación en vez de un factor particular para cada ARNm. Algunos de
los ejemplos descriptos en la literatura son:
- El ARNm EP1 se estabiliza por inhibición de la traducción en T. brucei (Dorn et
al., 1991; Graham and Barry, 1995), en forma independiente del inhibidor que se utilize
(cicloheximida, anisomicina, puromicina o emetina). Estos experimentos permitieron
concluir que la estabilización no se debe a una asociación del ARNm con los polisomas,
ya que los diferentes inhibidores utilizados generaron el mismo efecto (Dorn et al., 1991).
Por lo tanto, la ausencia de algún factor proteico debe ser requerida para la degradación
del ARNm EP1.
- En el estadío amastigote de T. cruzi, la cicloheximida produce una reducción de
34
Introducción
casi 3 veces en los niveles de estado-estacionario del ARNm de la amastina y un aumento
de 7 veces del ARNm de la tuzina (Teixeira et al., 1995). Sin embargo, la vida-media de
ambos ARNms no fue descripta en tal trabajo. Un rasgo interesante es que ambos ARNms
provienen de la misma unidad transcripcional (Teixeira et al., 1994) y son regulados en
forma diferente durante el desarrollo del parásito.
- En L. chagasi, el ARNm mspl es muy estable en la forma virulenta promastigote
y de vida-media corta en la fase estacionaria del crecimiento. Experimentos “in vivo” con
cicloheximida, demostraron un aumento de la abundancia de entre 4 a 6 veces en la fase
estacionaria solamente (Brittingham et al., 2001).
- Otros estudios relacionados con el análisis de los niveles de ARNms en ausencia
o presencia de inhibidores de la traducción pueden encontrarse en la literatura (Argaman
et al., 1994; Quijada et al., 1997). Aunque la mayoría de los resultados obtenidos permiten
concluir que los inhibidores utilizados aumentan la estabilidad de ARNms inestables,
el(los) mecanismo(s) por el cual/los cuales se regula el metabolismo de estos ARNms no
se describió hasta el momento y es sujeto de estudios futuros.
5- Proteínas de unión a ARN: Función y Estructura.
Los ARNms están generalmentes asociados con proteínas de unión a ARN, las
cuales controlan cada aspecto del metabolismo del mensajero, incluyendo la formación
de los extremos 5’- y 3’-terminales maduros, “splicing”, transporte, localización, estabilidad
y eficiencia traduccional. Por lo tanto, es de total importancia entender cómo el ARN y
las proteínas que lo reconocen interaccionan mutuamente, para finalmente comprender
cómo se logran los procesos de regulación de la expresión génica. En general, las proteínas
de unión a ARN contienen una estructura modular y presentan dominios de unión a
ARN compuestos por 70-150 aminoácidos (Mattaj, 1993). En los últimos tres años se
observó un gran progreso en el estudio de la relación estructura-función para los tres
grupos más importantes de proteínas en eucariotas. Entre ellas: (1) proteínas con motivos
del tipo RRM o “RNA-Recognition motif”; (2) proteínas con motivos KH y (3) proteínas que
reconocen ARN doble cadena (“dsRBD”), entre otras. Más aún, estudios computacionales
y de dinámica molecular por Resonancia Magnética Nuclear, proveyeron un enorme avance
en relación con los aspectos energéticos y dinámicos relacionados con el reconocimiento
de moléculas de ARN o complejos ARN-proteína (Perez-Canadillas and Varani, 2001).
5.1- Proteínas con motivos RRM.
El motivo RRM o también denominado RNP (“RiboNucleoProtein”) es el dominio
de unión a ARN mejor caracterizado y es también el más generalizado en cuanto al
número de proteínas que lo contienen (Burd and Dreyfuss, 1994; Varani and Nagai,
1998). Los motivos RRM contienen módulos de entre 80-90 aminoácidos y están
compuestos por dos regiones características, un octapéptido ribonucleoproteico-1 (RNP1)
y un hexapéptido ribonucleoproteico-2 (RNP2) (Burd and Dreyfuss, 1994). Los motivos
RRM interaccionan con una gran variedad de moléculas de ARN y muchos de ellos lo
hacen en forma secuencia específica. Todos los motivos RRM estudiados hasta el momento
presentan la misma topología y estructura tridimensional (Varani and Nagai, 1998).
35
Introducción
Presentan cuatro hojas-β antiparalelas empaquetadas con 2 hélices-α, formando la
estructura globular βαββαβ. La única excepción a esta regla se determinó en el tercer
RRM de la proteína PTB o “Polypyrimidin-tract Binding Protein”, la cual contiene una
quinta hoja-β en su región C-terminal (Conte et al., 2000). Se han resuelto varias
estructuras proteicas, incluyendo la proteina humana U1A involucrada en “cis-splicing”,
la proteína de unión a tractos de poli(A) (PABP1), hnRNP A1, Sex-lethal (Sxl) y una de las
proteínas humana que se une a los ARE (HuC) (Deo et al., 1999; Ding et al., 1999; Handa
et al., 1999; Inoue et al., 2000; Nagai et al., 1990). Varias de éstas estructuras también
se resolvieron en presencia de ARN y permitieron identificar los contactos específicos
ARN-proteína; así como también, evidenciar los cambios conformacionales que ocurren
durante la interacción con el ligando o fenómeno de “induced fit” (Williamson, 2000). La
mayoría de las proteínas contienen motivos RRM múltiples, los cuales median la unión
a ARN en forma cooperativa. Estos dominios, como en Sxl o PABP1, están separados por
secuencias conectoras de entre 8-11 residuos (Deo et al., 1999; Handa et al., 1999), las
cuales no están estructuradas en la conformación de la proteína libre (Perez-Canadillas
and Varani, 2001). El análisis de la covarianza de 300 motivos RRM se describió
recientemente (Crowder et al., 2001) y reveló que existe una red de grupos de aminoácidos
que covarían, comprendiendo por un lado el núcleo del RRM y por otro lado la superficie
del mismo. Este análisis permitió identificar un importante número de residuos, que
aunque no están directamente involucrados en el contacto con ARN, pueden influir en la
especificidad de la unión (Crowder et al., 2001).
5.2- Cómo dos motivos RRM en una proteína interaccionan con el ARN ?
Muchas proteínas de unión a ARN presentan múltiples dominios o superficies de
contacto que forman módulos en la organización y estructura final. Recientemente se
resolvieron cuatro estructuras del tipo RRM, que permiten entender cómo es la forma en
que las proteínas con múltiples dominios reconocen su sustrato. Las proteínas son los
motivos RRM1 y RRM2 de Sxl de Drosophila unida a una secuencia rica en Uridina
(Handa et al., 1999); la proteína neuronal HuC en presencia de un elemento ARE (Wang
and Tanaka Hall, 2001); los RRM1 y RRM2 de la PABP1 humana en presencia de un
tracto de poli(A) (Deo et al., 1999) y por último, la proteína nuclear nucleolina en presencia
de un “hairpin” de ARN (Ding et al., 1999). Como se mencionó anteriormente, cada una
de estas proteínas presentan espaciadores entre los dominios. Se sabe que estas regiones
presentan una alta flexibilidad en la proteína libre, permitiendo que los dos dominios
sean estructuralmente independientes (Crowder et al., 1999; Inoue et al., 2000). En el
complejo ribonucleoproteico, ese espaciador forma una pequeña hélice-α la cual presenta
un papel importante en el contacto con el ARN. Los extremos 5’- y 3’-terminales del ARN
interaccionan con las regiones N- y C-terminales de las proteínas, respectivamente (PerezCanadillas and Varani, 2001).
5.3- Proteínas con motivos KH.
El motivo KH fue identificado por primera vez en la proteína hnRNP K y es otro
dominio de unión a ARN bastante común. Consiste de un clásico plegado α-β con una
36
Introducción
topología similar a la descripta en varias proteínas ribosomales (Grishin, 2001; Musco et
al., 1997). Al igual que los RRM, los motivos KH se identificaron en múltiples copias en
más de 100 proteínas y muchas de ellas forman parte de una compleja red de interacciones
proteína-proteína y proteína-ARN que regulan la expresión génica. Se ha sugerido también
que la unión de los motivos KH al ARN ocurre a través de un mecanismo de cambio
conformacional inducido por la interacción (Musco et al., 1996). Una de las proteínas
con motivos KH mejor caracterizada hasta el momento es Nova. Por estudios de SELEX
(“Systematic Evolution of Ligands by Exponential Enrichment”), se identificó que Nova
reconoce secuencias repetitivas del tipo 5’-UCAU-3’ separadas por pequeños tractos de
ARN (Buckanovich and Darnell, 1997). Estas secuencias están presentes en ARNms
para Nova-1 y Nova-2 y también en un receptor para Glicina. El motivo KH también se lo
asoció con una gran variedad de funciones celulares y se lo implicó en diversas
enfermedades genéticas, como por ejemplo el síndrome X-frágil, el cual puede ser
ocasionado por una reducción en los niveles de expresión de Nova o por un evento de
mutación simple, que ocasiona el desplegamiento del dominio KH de la proteína (Siomi
et al., 1993).
Estudios de espectroscopía por RMN (Musco et al., 1997; Musco et al., 1996) y
más recientemente, de Cristalografía de Rayos-X (Lewis et al., 1999), permitieron revelar
que los motivos KH comparten la misma topología α-β que los dominios RRM y dsRBD
(ver más adelante), los cuales reconocen ARN doble cadena (ver más adelante). La
estructura expone segmentos con la secuencia Gli-X-X-Gli (donde X puede ser Lisina,
Arginina o Glicina), en los “loops” que conectan las hélices-α1 y α2. A partir de
experimentos de RMN, se demostró que pueden participar en la unión con el ARN y son
conformacionalmente flexibles (Musco et al., 1997). En contraste con lo esperado, las
proteínas con motivos KH, se unen al ARN de una manera completamente diferente a
proteínas del tipo RRM y dsRBD. Esto sugiere que la convergencia evolutiva de los dominios
de unión a ARN con estructuras comunes del tipo αβ tiene poco que ver con el mecanismo
de reconocimiento del ARN (Perez-Canadillas and Varani, 2001). Los contactos entre los
“loops” de la proteína y los fosfatos del tetranucleótido 5’-UCAC-3’, juegan un papel
importante en el reconocimiento. Sin embargo, no existen interacciones de tipo “stacking”
intermolecular como se observa en proteínas con motivos RRM, ni contactos específicos
con el OH-2’ como en las proteínas del tipo dsRBD (ver sección siguiente).
5.4- Proteínas de unión a ARN doble cadena (dsRBD).
Las proteínas del tipo dsRBD presentan motivos de unión a ARN doble cadena
(dsRBM), compuestos por ~70 aminoácidos que forman una estructura terciaria. Ésta
puede unir un “dúplex” de ARN y hasta híbridos ARN-ADN, sin ninguna clara especificidad
de secuencia (Fierro-Monti and Mathews, 2000). Existen por lo menos 9 sub-grupos de
diversas proteínas que contienen uno o más motivos dsRBD el cual participa en
interacciones proteína-proteína (Fierro-Monti and Mathews, 2000). Desde el punto de
vista estructural, dos estructuras descriptas recientemente permiten clarificar cómo las
proteínas del tipo dsRBD reconocen el ARN. Estas son la estructura cristalina del segundo
dsRBD de la proteína Xlrbpa de Xenopus laevis (Ryter and Schultz, 1998) y la estructura
en solución del tercer dsRBD de la proteína Staufen de Drosophila, unida a un “hairpin”
37
Introducción
de ARN (Ramos et al., 2000). A diferencia del cambio conformacional inducido cuando
las proteínas con motivos RRM o KH reconocen el ARN, no se identificaron cambios
conformacionales significativos en los complejos dsRBD-ARN, en comparación con la
estructura de la proteína libre. Sin embargo, a partir de las estructuras dsRBD se
determinó la importancia de dos “loops” básicos, los cuáles son necesarios para el contacto
y reconocimiento con el ARN doble cadena y también para la discriminación del ADN
doble cadena (Ramos et al., 2000). Staufen, el caso más estudiado, reconoce un juego
determinado de ARNs en la célula, pero ninguno de ellos tiene un sitio específico de
unión. Este tipo de proteínas, contienen múltiples dominios de unión al ARN y se cree
que es lo que puede definir su actividad en forma cooperativa (Micklem et al., 2000;
Ramos et al., 2000).
5.5- Proteínas de la familia PUF.
PUF es otra familia de proteínas reguladoras, que aunque no están
estructuralmente relacionadas, se unen a secuencias del 3’-NC de ARNms específicos y
pueden modular los niveles de expresión en diferentes tipos celulares. Estas proteínas
están involucradas en procesos de degradación de ARNms y en la represión de la
traducción, y actúan en combinación con otros factores (Wickens et al., 2002). Se
describieron por primera vez en C. elegans y D. Melanogaster y se caracterizan por la
presencia de ocho repeticiones consecutivas (repeticiones PUF), cada una de las cuales
presenta ~40 aminoácidos. Cada repetición tiene un núcleo consenso que contiene
residuos básicos y aromáticos, y se sabe que se requiere el conjunto entero de repeticiones
para la unión del ARN (Zamore et al., 1997). La estructura de la proteína Pumilio de
Drosophila, miembro de la familia PUF, demostró que se pliega en un dominio con tres
hélices-α (Edwards et al., 2001). Desde el punto de vista de la interacción con el ARN, se
sabe que dos son los sustratos que se regulan por Pumilio en Drosophila, el ARNm de
“hunchback”, el cual participa en la embriogénesis y el ARNm de la ciclina b, cuya represión
retarda el ciclo celular.
5.6- Proteínas de unión a ARN con motivos RGG.
El motivo o “box” RGG, se identificó inicialmente en la proteína hnRNP U (Kiledjian
and Dreyfuss, 1992). Este motivo se define por la presencia de repeticiones RGG (ArgininaGlicina-Glicina) generalmente separadas por residuos aromáticos. Sin embargo, no se
conoce el número mínimo de repeticiones requeridas para la unión a ARN. Ejemplos en
la literatura muestran que algunas proteínas como hnRNP A1 presentan sólo 6 repeticiones
y otras como GAR1 tienen hasta 18 copias (ver revisión en Burd and Dreyfuss, 1994). La
alta densidad de residuos de Glicina y las desviaciones dentro del motivo RGG sugieren
que éste no es una estructura rígida, aunque ciertos análisis espectroscópicos y de
modelado molecular de las repeticiones RGGF de la nucleolina predicen que podría formar
una estructura β-espiral (Ghisolfi et al., 1992a). Los motivos RGG también aparecen en
proteínas del tipo RRM; por ejemplo en la nucleolina, proteína que reconoce pre-ARNr a
partir de sus dos motivos RRM. La región RGG ubicada en el C-terminal del motivo RRM
aumenta la afinidad de unión del ARN hasta 10 veces (Ghisolfi et al., 1992b). Esto sugiere
38
Introducción
que la unión mediada por el “box” RGG es secuencia específica y facilita el reconocimiento
por uno o más dominios, como es el caso de hnRNP U (Kiledjian and Dreyfuss, 1992). Un
aspecto interesante del residuo Arginina de los motivos RGG, es el gran potencial de unir
hidrógeno, en comparación con otros aminoácidos de carga positiva. Además, el residuo
de Arginina puede sufrir modificaciones post-traduccionales como la metilación y la
formación de dimetil-Arginina (Liu and Dreyfuss, 1995). Por un lado, la metilación de las
proteínas hnRNPs facilita el transporte de hnRNPs del núcleo al citoplasma (Shen et al.,
1998) y por otro lado, la fosforilación de residuos de Arginina es una modificación que
también regula la actividad de proteínas que contienen motivos RGG (Cobianchi et al.,
1993).
5.7- Dominios Auxiliares presentes en las proteínas de unión a ARN.
Las proteínas de unión a ARN presentan no sólo los motivos de reconocimiento de
sus secuencias blanco, sino también dominios accesorios o auxiliares localizados en los
extremos N- y/o C-terminal. Estos dominios auxiliares suelen estar involucrados en
procesos de interacción proteína-proteína. Existen dos grandes grupos de dominios
auxiliares que se caracterizan por presentar similitudes estructurales y funcionales. En
primer lugar, los dominios ricos en Glicina, descriptos principalmente en proteínas hnRNPs
básicas, presentan varios residuos de Glicina y aromáticos distribuídos en forma periódica.
En segundo lugar, los dominios ricos en Serina-Argininia (SR) (ver revisión en Biamonti
and Riva, 1994).
El análisis de algunos dominios auxiliares en varios tipos de células eucariotas
revela la presencia de rasgos frecuentemente encontrados en los dominios de activación
de factores transcripcionales. Algunos de estos dominios son ricos en residuos de
Glutamina, Prolina y/o Metionina, capaces de conferir flexibilidad a estas porciones
proteicas. Otro tipo de dominios, están compuestos por residuos básicos como Lisina o
Arginina, o residuos ácidos, como Aspártico o Glutámico. Se observó en algunos casos,
que los dominios auxiliares tienen la capacidad de interaccionar con el ARN o contribuir
significativamente en la energía libre de unión con el sustrato. Estos dominios pueden
interaccionar con el ARN también en forma inespecífica, anclando la proteína al sustrato
ribonucleico y permitiendo que el dominio de unión a ARN pueda adquirir una superficie
de contacto en forma específica y directa (Biamonti and Riva, 1994).
6- Proteínas de unión a ARN en tripanosomas.
Pocas son las proteínas descriptas con capacidad de unir ARN en tripanosomas.
Más aún, a muy pocas se les asignó una función en algún paso del metabolismo y/o
procesamiento de ARN. Sin embargo, se pueden definir algunos grupos dependiendo del
tipo de dominio y la función asignada a partir de las secuencias que reconocen “in vitro”
o “in vivo”.
6.1- Proteínas con motivos RRM.
Una de las primeras proteínas con motivos RRM identificadas fue la proteína de
unión a poli(A) o TcPABP1 de T. cruzi (Batista et al., 1994), la cual años más tarde se
39
Introducción
caracterizó en otras especies de parásitos (Bates et al., 2000; Hotchkiss et al., 1999). En
T. brucei, se reportaron dos proteínas (p34 y p37) muy similares en secuencia primaria,
y que contienen un sólo dominio del tipo RRM (Zhang et al., 1998), y también se demostró
que ambas tienen la capacidad de reconocer “in vivo” al ARNr 5S (Pitula et al., 2002).
Esto sugiere un posible papel de estas proteínas en la biogénesis del ARNr. También se
identificó la presencia de proteínas con motivos RRM y dominios auxiliares del tipo SR.
Estas son capaces de interaccionar con el extremo 5’ del SL de T. brucei y tendrían una
función en la regulación del trans-“splicing” (Ismaili et al., 2000; Ismaili et al., 1999).
Además, se identificó una proteína de 45kDa (XB1) que reconoce el SL de T. cruzi, y es
homóloga al factor PRP31p esencial para el “splicing” en S. cerevisiae, lo que indica que
podría estar involucrada en el proceso de trans-“splicing” (Xu et al., 2001a). Además, se
reportó la presencia de una secuencia genómica que presenta un marco abierto de lectura
de 335 aminoácidos y que codifica para una proteína homóloga a la proteína La con un
dominio del tipo RRM y un sitio putativo de unión a ATP en el C-terminal (Westermann
and Weber, 2000).
6.2- Proteínas con otros motivos en tripanosomas.
Las proteínas de unión a ARN de mayor consideración y estudio desde 1990, son
las que forman parte de complejos ribonucleoproteicos involucrados en la edición del
ARNm, llamado “editosoma” (ver revisión en Madison-Antenucci et al., 2002), pero no
serán descriptas en esta tesis doctoral. Por otro lado, se describió la presencia de proteínas
con dedos de zinc o CCCH (TbZFP1 y TbZFP2) en T. brucei y se las implicó en la modulación
de la tasa de diferenciación del parásito (Hendriks et al., 2001).
Un paso requerido en casi todas las reacciones de procesamiento de ARN es el
desplegado de las hebras inter- o intra-moléculas de ARN. De esta manera, y al igual que
ocurre en otros tipos celulares existen helicasas de ARN, enzimas claves para las reacciones
de catálisis de separación de las hebras del ARN (Schmid and Linder, 1992). Las helicasas
forman una superfamilia conocida como proteínas con un “box” DEAD/H, a partir de la
presencia de secuencias altamente conservadas del tipo LDEAD/HXXL. Una helicasa de
ARN con motivos DEAD-“box” se identificó en T. brucei (Missel et al., 1999). También se
identificaron en este microrganismo, proteínas con motivos RGG las cuales forman parte
de una familia multigénica con diferentes número de repeticiones (Das et al., 1996). Por
úlitmo, se identificó en T. brucei una proteína Pumilio que forma parte de la familia PUF
y la cual puede regular la estabilidad de ARNms (Hoek et al., 2002).
7- Comparación de las proteínas de unión a ARN a lo largo de la evolución.
En diversos tipos de organismos, desde bacterias, parásitos, levaduras, plantas y
células de mamífero se identificaron proteínas con motivos RRM y KH, entre otros. Algunas
son específicas de “phylum”, mientras que otras se preservaron en todos los linajes
eucariontes durante la evolución: aquellas proteínas requeridas para mecanismos básicos
en la regulación post-transcripcional.
El genoma de plantas, en particular el de A. thaliana, codifica para 196 proteínas
de unión a ARN del tipo RRM y 26 del tipo KH, algo más complejo a lo identificado en C.
elegans y D. melanogaster (Lorkovic and Barta, 2002). Un subgrupo interesante dentro
40
Introducción
del grupo de proteínas con motivos RRM, es el que presenta una región C-terminal rica
en residuos Glicina. Estas proteínas, también de gran diversidad, están involucradas en
respuesta a varios tipos de estrés ambiental. Más interesante aún, es la caracterización
de distintos grupos de proteínas específicas de organelas como cloroplasto (Lorkovic and
Barta, 2002), y mitocondria (Vermel et al., 2002). Por su parte, en cianobacterias hay dos
tipos de proteínas con motivos RRM, aquellas que presentan una región C-terminal
pequeña rica en Glicina y son reguladas por temperatura, y aquellas que carecen del
dominio rico en Glicina y se expresan de forma constitutiva (Sato, 1994). Las proteínas
de unión a ARN de cianobacterias y las que presentan regiones ricas en Glicina de
eucariotas son similares en estructura y en la forma en que se regulan por temperatura.
De esta manera, se sugiere que tal similitud puede ser el resultado de un proceso de
evolución convergente (Maruyama et al., 1999). Aunque la función de los dominios ricos
en Glicina no está clara hasta el momento, deben ser funcionalmente importantes tanto
para cianobacterias como para las proteínas de eucariotas. Es interesante mencionar
que muchas especies de bacterias, incluyendo Escherichia coli y Bacilus subtilis, como
así también arqueobacterias, carecen de genes que codifiquen proteínas con motivos
RRM.
Un análisis filogenético (Maruyama et al., 1999) permitió definir un posible origen
y camino evolutivo del motivo RRM. Este dominio está presente tanto en procariotas
como en eucariotas y todos parecen ser de origen monofilético, es decir, descendientes
de un ancestro común. También es interesante resaltar la duplicación intragénica del
dominio RRM en un mismo organismo.
8- Formación de complejos ribonucleoproteicos como mecanismo de regulación.
Es evidente que todos los mecanismos de regulación de la expresión génica se
basan en la formación de complejos compuestos por múltiples componentes proteicos
los cuales interaccionan en forma específica y selectiva entre ellos y con moléculas de
ARN. Como se mencionó anteriormente, las proteínas de unión a ARN presentan dominios
auxiliares. Estas porciones polipeptídicas son las efectoras de la función proteica y
modulan la respuesta en forma “downstream” a la unión. Así como los factores
transcripcionales presentan dominios de unión a ADN y dominios de activación, las
proteínas que unen ARN también presentan similares dominios efectores responsables
del reclutamiento de factores adicionales en el ARNm. Aunque se identificaron muchos
complejos o partículas ribonucleoproteicas involucradas en los distintos procesos de
regulación de la expresión génica (como se mencionó en las secciones anteriores), la
conexión funcional entre la formación de estos complejos y la señalización celular está
por ser dilucidada. Como se describió, las proteínas y moléculas de ARN están asociadas
en forma de complejos, y estas partículas ribonucleoproteícas son las que goviernan el
destino de un ARNm particular o un conjunto de ARNms. Entre los complejos importantes
descriptos se pueden mencionar los involucrados en la regulación de la transcripción,
“splicing”, NMD, transporte del ARN, degradación y/o estabilización del ARNm (como se
mencionó con varios ejemplos durante toda la Introducción). También cabe agrupar los
motores de localización los cuales pueden estar asociados con el citoesqueleto de la
célula y la traducción (Dreyfuss et al., 2002; Orphanides and Reinberg, 2002).
41
Introducción
Actualmente, las técnicas de rastreo de alta-tecnología, conocidas como “highthroughput screenings”, permitieron empezar a revelar parte de las redes de interacción
proteica que abarcan la mayoría de las funciones celulares, especialmente en S. cerevisiae
(Hirsh and Fraser, 2001). Es evidente que la conectividad de proteínas conservadas en la
redes de interacción, está negativamente correlacionada con la tasa de evolución. Aquellas
proteínas que presentan mayor cantidad de interactores evolucionan más lentamente,
ya que son más importantes para el organismo, y además porque una mayor proporción
de proteínas están directamente involucradas en esta función (Fraser et al., 2002). En
sitios importantes para la interacción proteína-proteína, los cambios evolutivos deben
ocurrir por co-evolución; es decir, la sustitución en una proteína resulta en una presión
de selección la cual genera cambios recíprocos en las proteínas que interaccionan. Esto
conlleva a que las proteínas que interaccionan y forman parte de un mismo complejo
regulatorio, evolucionen con tasas similares. Sin embargo, también es posible que las
proteínas que interaccionan, evolucionen en tasas similares porque exhiben homología
estructural y por lo tanto, tendrían una distribución similar de los sitios restrictivos. El
origen más común de la homología estructural entre proteínas que interaccionan, es la
duplicación de un gen que codifica una proteína homodimérica, seguido de la evolución
de una de las copias génicas (Fraser et al., 2002).
9- Análisis estructural de proteínas de unión a ARN.
Los últimos años fueron de una tremenda explosión en cuanto al número de
estructuras de complejos ARN-proteína. Es decir, existen estructuras no sólo para los
dominios de unión a ARN en forma aislada sino también acomplejados con sus sustratos
ribonucleicos. La principal superfamilia de la que se cuenta con varias estructuras es la
del tipo RRM. Esto permitió entender cuáles son los principios básicos del reconocimiento
mediado por este dominio de unión. Se utilizaron diferentes enfoques con el objetivo de
resolver estructuras atómicas, entre ellos: análisis por RMN y Cristalografía de Rayos X.
9.1-Resonancia Magnética Nuclear y estudios de Dinámica Molecular.
RMN es una poderosa técnica espectroscópica que permite realizar un estudio
detallado no sólo de estructuras, sino también de dinámica de macromoléculas en solución
(Clore and Gronenborn, 1991; Clore and Gronenborn, 1998). Hay varios ejemplos de
interacciones proteína-proteína y proteína-ligando los cuales ilustran que la dinámica
puede estar relacionada de diversas maneras con la función proteica (Wand, 2001). La
RMN puede ser utilizada para monitorear el comportamiento dinámico de una proteína
en sitios específicos. Además, se puede estudiar el movimiento de una proteína en un
amplio rango de escala de tiempo utilizando diferente clase de experimentos (Ishima and
Torchia, 2000). Entre ellos, se encuentra la medida de la tasa de relajación del “spin”
nuclear, lo cual permite determinar movimientos en escalas de tiempo rápida (subnanosegundos) o lenta (micro-milisegundos), como así también la tasa de difusión
rotacional de una molécula o “tumbling”. Por otro lado, las tasas de transferencia de
magnetización entre protones con diferentes desplazamientos químicos permite
determinar movimientos de dominios proteicos en escalas de tiempo muy lentas
42
Introducción
(milisegundos a días). Esto hace de la Resonancia Magnética Nuclear, una técnica única
y poderosa para el estudio de dinámica molecular relacionada con la función proteica.
La principal fuente de información geométrica utilizada para la determinación de
cualquier estructura 3D por RMN consiste en la medición de las restricciones de distancias
menores a ~5Å, derivadas del denominado “Nuclear Overhauser Effect” (NOE). Los datos
del NOE se complementan con otro número de restricciones que dependen de la
proximidad espacial de los átomos, incluyendo las restricciones torsionales de los ángulos,
los cuales a su vez dependen de los acoplamientos escalares de 3 enlaces o “J couplings”
(Clore and Schwieters, 2002). Los datos experimentales disponibles a partir de RMN no
son suficientes “per se” para determinar la estructura 3D de una molécula. De esta
manera, éstos deben ser suplementados por datos de restricciones de geometría covalente,
como por ejemplo, el largo de los enlaces, los ángulos, la planaridad y la quilaridad
(Clore and Schwieters, 2002).
9.2-Marcado Isotópico de proteínas para estudios de dinámica.
El marcado de proteínas en forma selectiva o completa con
13
Cy
15
N provee una
oportunidad única para estudiar el movimiento intramolecular localizado en solución
(Peng and Wagner, 1994). Esto se debe a que los tiempos de relajación de 13C y 15N, a
diferencia de otros núcleos, y la magnitud de los NOEs heteronucleares 13C[1H] o 15N[1H],
está casi siempre dominado por un mecanismo, la interacción dipolo-dipolo entre los
heteronúcleos y los átomos enlazados directamente. Esta interacción depende de las
distancias internucleares y los tiempos de correlación locales (para regiones flexibles) o
generales (para una molécula rígida). Una mejor sensibilidad en los espectros se logra
midiendo los parámetros de relajación en forma indirecta; es decir, transfiriendo la
magnetización de los protones al heteronúcleo, ocasionando que la magnetización
heteronuclear evolucione en un tiempo de relajación o manera dependiente de los NOEs,
y luego transfiriendo nuevamente la magnetización al protón para observarla.
Generalmente, esto se realiza por experimentos bidimensionales y tridimensionales
tomando ventaja de la mayor dispersión del espectro (Reid, 1997).
9.3- El uso de RMN para caracterizar la dinámica de proteínas.
En la década pasada se desarrollaron cuatro áreas de trabajo en el campo de la
espectrosccopía por RMN. Los experimentos de resonancia triple por RMN, las cuales
proveen un sólido conjunto de herramientas para la asignación de las resonancias en
proteínas de tamaño significante (Clore and Schwieters, 2002). Estos métodos derivan
de estrategias de enriqueciminento isotópico, como se comentó, los cuáles se refinaron
para permitir el marcado de proteínas. Por otro lado, los experimentos bidimensionales
de relajación pueden ser utilizados para analizar los movimientos en escala de tiempo
pequeña (sub-nanosegundos) de los vectores de interacción con el cuerpo de la molécula.
Los parámetros de relajación por RMN observables, como el “spin-lattice” (T1) y el tiempo
de relajación (T2) de un “spin” nuclear, están directamente relacionados con la densidad
espectral, la cual a su vez está relacionada en forma directa con la transformada de
Fourier. Esta fórmula permite obtener un espectro de frecuencia, es decir, a partir de
esta operación se logra extraer las señales de las frecuencias de resonancia y se las
43
Introducción
convierte en un espectro de resonancia nuclear.
9.4- Cambios estructurales en el reconocimiento ARN-proteína.
La formación de casi todos los complejos ARN-proteína está acompañada de
cambios conformacionales en el ARN, la proteína o en ambos (Williamson, 2000). Sin
embargo, no hay información específica acerca de los pasos de interacción, los cuales
pueden incluir una serie de intermediarios. A pesar de ello se sabe que el ARN y la
proteína libres en solución, son flexibles o tienen conformaciones particulares, y que el
complejo final ARN-proteína es más rígido o puede presentar diferentes conformaciones
(Williamson, 2000). En los complejos ARN-proteína, los contactos intermoleculares entre
superficies complementarias de los componentes, proveen un reconocimiento molecular
exacto. En la mayoría de los complejos, existen superficies y bolsillos preformados en la
proteína, y de este modo el ARN se adapta en forma adecuada para entrar a estos sitios
(Gosser et al., 2001).
44
Objetivos y Antecedentes.
La línea de investigación comenzó en el laboratorio del Dr. Frasch aproximadamente
en 1990, estudiando cuales son las moléculas detectadas por el sistema inmune en un
organismo infectado con T. cruzi. Se clonaron varias moléculas, entre ellas la transsialidasa (Frasch, 1994) y moléculas del tipo-mucinas (Reyes et al., 1994), ambos
componentes del núcleo glicoproteico de la membrana del parásito. Dentro de todos los
genes que codifican para proteínas del tipo-mucinas, se identificaron dos familias
multigénicas con rasgos particulares: TcMUC, pertenecientes al estadío tripomastigote
(Di Noia et al., 2002; Di Noia et al., 1998) y TcSMUG, pertenecientes al estadío epimastigote
(Di Noia et al., 2000). Dada la importancia que las mucinas tienen en el proceso de
invasión celular por parte del parásito y además lo particular que son los tripanosomas
desde el punto de vista de los mecanismos de regulación de la expresión génica (Vanhamme
and Pays, 1995), se propusieron los siguientes objetivos para esta tesis doctoral:
•
Determinar los niveles de regulación de la expresión de las mucinas del estadío del
tripanosoma en el insecto vector (TcSMUG).
•
Identificar elementos en cis- en el ARNm TcSMUG y factores en trans que formen
parte del mismo camino regulatorio.
•
•
Estudiar mecanismos de regulación mediados por estos dos componentes.
Estudiar en términos funcionales y estructurales las propiedades de las proteínas de
•
unión a ARN que regulan la expresión de TcSMUG.
Describir por primera vez en tripanosomas, la topología y estructura secundaria por
RMN de una proteína de unión a ARN.
Fundamento de la Investigación.
En organismos eucariotas inferiores, como T. cruzi, en el cual no existe control
transcripcional evidente alguno, es de gran importancia estudiar cuales son los
mecanismos de regulación de la expresión génica. Se sabe que el principal punto de
control de la expresión en estos microorganismos es a nivel post-transcripcional. Sin
embargo, no se describieron hasta el momento, secuencias y proteínas involucradas en
este proceso. Por lo tanto, el objetivo general de esta tesis doctoral es el estudio de la
regulación post-transcripcional, utilizando como modelo las mucinas del tipo TcSMUG.
Como objetivos particulares, se pretende identificar y describir elementos en el ARNm y
proteínas que los reconozcan específicamente, como así también estudiar el camino
regulatorio del cual forman parte.
45
RESULTADOS
Resultados
PARTE 1 - Estudio de la regulación de la expresión génica de TcSMUG.
La familia de genes tipo-mucina TcSMUG.
La familia que codifica para genes de mucina TcSMUG fue identificada por el Dr.
Javier Di Noia en el laboratorio del Dr. Frasch. Mi trabajo comenzó en 1998 clonando,
secuenciando y caracterizando los genes que componen esta familia, junto a Javier,
quien centró su tesis doctoral en el estudio de la composición del núcleo proteico de las
mucinas (Di Noia, 2000). A partir de la secuencia de 6 clones genómicos y el análisis de
otros 28 clones de ADNc, provenientes del projecto de secuenciación del genoma de T.
cruzi, se identificaron dos grupos de genes diferentes. La dicotomia identificada fue
finalmente correlacionada con las diferencias en la estructura de los genes y ARNms.
Estos grupos se denominaron L y S (por “Long” y “Short”), de acuerdo al tamaño de los
ADNc. Ambos presentan gran identidad en las regiones N- y C- terminales pero divergen
en la región central (Di Noia, 2000).
La expresión de la familia de ARNms TcSMUG está regulada durante el desarrollo.
Como primer objetivo, se analizó la expresión de TcSMUG a partir de un ensayo
de “Northern blot” con ARN total extraído de los 4 estadíos de desarrollo de T. cruzi, y se
hibridizó con la sonda denominada N, que reconoce el N-terminal de los ARNms L y S.
En la Figura 8A se observa el patrón de expresión de TcSMUG a través de los diferentes
estadíos de desarrollo del parásito. Claramente, aparecen dos bandas de 1400 y 1000
pbs (Figura 8A). Como se detalla más adelante, los grupos L y S de ARNms, poseen las
diferencias más significativas en sus secuencias 3’-NC (no codificantes). Para corroborar
que la banda de 1400 pbs corresponda al ARNm L y la de 1000 pbs al ARNm S, se
construyeron dos sondas de ADN denominadas 3’-L y 3’-S las cuales reconocen
específicamente las regiones 3’-NC de cada grupo en forma específica. Se realizaron
ensayos de “Northern blot” con ARN total extraído del estadío epimastigote. Estas
hibridizaciones confirmaron que la banda de mayor tamaño corresponde al grupo L y la
de menor tamaño al grupo S (Figura 8B). Como control también se hibridizó el mismo
filtro con la sonda N, que revela ambas bandas.
De esta manera, concluimos que los dos grupos (L y S) están diferencialmente
regulados durante el desarrollo del parásito. Se trabajó inicialmente en los estadíos
epimastigote y tripomastigote derivado de células, ya que son estadíos representativos
de las formas presentes en el vector insecto y en el mamífero, respectivamente. Además,
fue en los estadíos en los cuales se observó la mayor diferencia en los niveles estacionarios
de ARNm (Figura 8A). En el estadío epimastigote, se detectan ambas formas y con los
mayores niveles de expresión en comparación con las demás etapas del ciclo de vida del
parásito. Sin embargo, sólo el grupo L se detectó en el estadío tripomastigote, a partir del
tiempo de exposición que se muestra, ya que la sobre-exposición del filtro demuestra
que el grupo S también se detecta (resultado no mostrado). Los niveles de ARNms en el
estado estacionario se cuantificaron luego de la normalización de las señales observadas
por hibridización del mismo filtro con la sonda ARNr 24Sα (Figura 8A, panel inferior).
Los valores obtenidos en el estadío epimastigote para el grupo L fueron 6 veces mayores
que en tripomastigote y para el grupo S la diferencia fue de 10 veces mayor en epimastigote.
47
Resultados
En los otros estadíos del desarrollo también existe una regulación. El grupo L se expresa
en todos los estadíos, pero con mayores niveles en los estadíos replicativos (epimastigote
y amastigote intracelular); pero, el ARNm del grupo S se expresa preferencialmente en
los estadíos asociados con el vector insecto, epimastigote y tripomastigote-metacíclicos
(Figura 8A).
A
B
E T Mt A
N
L
S
sonda
3'S 3'L
L
S
24Sα
rRNA
C
5'-NC
L
ORF
3'-NC
sonda 3'L
SL
An
ARE
90%
87% 82%
(SIRE)
93%
67%
S
An
sonda N
sonda 3'S
100 bases
D
L
AAUUUUAAAAUUUAUUUAAUGUUGUUUUGAUUUAUUUAUUUUAA
S
E
AUUUUAUUUUAUUUUUACUUUUUUUUU
sitio trans-"splicing"
CGGGAGAGTTTACACCGCGAGCAACAAG
1 2
3
sitio poliadenilacion
GGCGCTGAC(TG)
9
Figura 8 - Patrón de expresión de los ARNms
TcSMUG del grupo L y S. A, Ensayo de “Northern blot” realizado sobre ARN total proveniente
de los diferentes estadios de desarrollo de
T.cruzi: (E) epimastigotes, (T) tripomastigotes
derivados de células, (Mt) tripomastigotes
metacíclicos y (A) amastigotes intracelulares. El
ARN fue extraído y fraccionado en geles
desnaturalizantes, transferido a membranas de
nylon e hibridizado con la sonda TcSMUG-N.
La posición de las bandas L (1.4Kpb) y S (1Kpb),
se indica a la derecha del panel. B, Un filtro
conteniendo ARN total del estadío epimastigote
se hibridizó en forma secuencial con las sondas
indicadas: T cSMUG-N, 3’S y 3’L. C,
Comparación esquemática de la estructura de
los ARNms de los grupos L y S de la familia
TcSMUG. El porcentaje de homología entre las
regiones conservadas (recuadros grises) se indica en el medio del alineamiento de los ARNms.
Las regiones que sólo se encuentran en un sólo
tipo de ARNm se muestran como recuadros
blancos. La posición de las sondas utilizadas
en los paneles A y B, se indica con flechas. La
presencia de un bloque conteniendo secuencias
ARE se indica con un recuadro negro con la
secuencia pertinente en el panel D. D,
Secuencias ARE presentes en las regiones 3’NC
de los grupos L y S. E, Se indica las secuencias
genómicas de los sitios aceptores de trans“splicing” y poliadenilación usados en el 95%
de los clones analizados.
A partir de las diferencias observadas en los niveles de expresión de las formas L
y S durante el desarrollo del parásito, se decidió evaluar y comparar, las secuencias
nucleotídicas de las regiones NC e intergénicas de los clones de ADNc y genómicos
obtenidos. En la región 5’-intergénica existe un 95% de homología entre L y S (ver Figura
8C) y como se sabe, las regiones 5’-terminales son utilizadas para el trans-“splicing”
(Matthews et al., 1994). De los tres sitios posibles aceptores de “splicing” identificados en
las secuencias genómicas, todos son utilizados con igual frecuencia, según se obtuvo a
partir del análisis de las secuencias de diferentes clones de ADNc (resultado no mostrado).
De esta manera, por trans-“splicing” se genera una región 5’-NC que presenta alrededor
de 55 pbs, dependiendo del sitio utilizado, la cual es 90% idéntica entre las formas L y S
(Figura 8C). Por su parte, la región 3’-NC es la que muestra las diferencias más
significativas entre los dos grupos. Esto se ve reflejado principalmente en el largo de la
región NC y permite explicar las diferencias de tamaños observadas en el “Northern blot”
de la Figura 8A. Esta región está compuesta por bloques altamente conservados entre
48
Resultados
ambos grupos y también por bloques específicos de cada grupo (Figura 8C). En la Figura
8C se muestra un esquema comparativo de las regiones NC de los dos grupos de ARNms.
Se observa que las primeras 30 pbs después del codón de terminación de la traducción,
son 100% idénticas en ambos. Luego, un bloque compuesto por 40 pbs está sólo presente
en el grupo L, seguido de un bloque de 90 pbs presente en ambos y con 82% de similitud
entre grupos. Luego hay una región de 80 pbs específica del grupo S y 3’ de ésta se
observa una región de 100 pbs conservada entre ambos. Hacia el extremo 3’-terminal,
existe una región rica en Adenosina y Uridina, denominada ARE (por su similitud con los
“AU-rich element” presentes en las regiones 3’-NC de células de mamíferos). El grupo L
presenta dos motivos AUUUAUUUA, mientras que en el grupo S, ésta región es más rica
en Uridina (ver Figura 8D). Una inserción del elemento descripto como SIRE compuesto
por ~450 nt (Vázquez et al., 1994), está presente en el grupo L y es lo que ocasiona la
mayor diferencia de tamaño observada. Por último, existe una región de 40 pbs que
presenta un 67% de identidad y es en donde se adiciona la cola de poli(A) en el transcripto.
Del análisis de los diferentes clones analizados, se concluye que el sitio de poliadenilación
está conservado en ambos grupos (Figura 8E); sin embargo, una minoria de los clones de
ADNc analizados muestran que la poliadenilación también puede ocurrir dentro del
retrotransposón SIRE.
Los niveles de transcripción de TcSMUG son similares durante el desarrollo del
parásito.
Se decidió evaluar si las diferencias en los niveles estacionarios de ARNms entre
los estadíos del parásito (Figura 8A) se deben a un efecto transcripcional. Para esto, se
realizó un ensayo de transcripción o “run-on”, a partir de núcleos aislados de dos estadíos
diferentes del parásito, epimastigote y tripomastigote, los cuáles pueden ser crecidos
fácilmente en el laboratorio. En este experimento, los núcleos se incuban en presencia
de un “buffer” a 30ºC durante 30 min. y en presencia de [α-32P]-UTP, con el objetivo de
producir cadenas nacientes de ARN para determinar las tasas de transcripción de genes
diferentes. La producción total de cadenas nacientes fue significativamente diferente en
los dos estadíos. En epimastigotes los niveles transcripcionales fueron 10 veces mayores
(1.107 cpm totales) y esto podría estar relacionado con resultados recientes que indican
que las variaciones en los niveles transcripcionales entre las formas replicativa y noreplicativa se deben a modificaciones en la arquitectura nuclear y remodelamiento de la
cromatina (Elias et al., 2001). A partir de las sondas de cadenas nacientes obtenidas, se
hibridizaron filtros de Nylon conteniendo puntos de ADNc de un miembro del grupo L,
un miembro del grupo S y dos controles, ARNr 24Sα y β-tubulina (Figura 9). Luego de la
hibridización, los valores relativos de transcripción se analizaron por densitometría y los
datos normalizados se obtuvieron por sustracción de la densitometría proveniente del
fondo del experimento (plásmido sin inserto). Los valores finales obtenidos para los
miembros de los grupos L y S fueron similares entre estadíos, siendo las razones entre
epimastigotes y tripomastigotes de 1.06 para el grupo S y 1.7 para el grupo L (Figura 9).
De este modo, la presencia del ARNm del grupo S en el estadío epimastigote, en contraste
con su ausencia parcial en tripomastigote, sugiere que podría estar regulado a nivel
post-transcripcional, ya que su tasa transcripcional es idéntica en los dos estadíos
49
Resultados
analizados (Figura 9). El mismo razonamiento se aplica para el ARNm L, ya que las
diferencias mínimas observadas en las tasas transcripcionales no pueden generar las
variaciones significativas observadas en los niveles de ARNm en el estado estacionario.
De esta manera, si β-tubulina puede ser tomado como un control o indicador de la tasa
transcripcional del estadío, y los valores relativos se normalizan a éste, la diferencia
entre las tasas de inicio de la transcripción entre estadíos serían mayores. En este caso,
el control a nivel post-transcripcional sería aún de mayor importancia, en comparación
con los datos no normalizados a un gen de expresión constitutiva, como es el caso de βtubulina.
Clon
Epimastigote
Tripomastigote
Mle-1 (Grupo L)
13f5 (Grupo S)
24Sα ARNr
β-tubulina
1.9
16.4
21.1
7.5
1.1
15.5
16.2
3.6
Mle-1 13f5
ARNr β-tub
Figura 9 - Valores comparativos de las tasas de
inicio de la transcripción para los grupos L y S
entre los estadíos epimastigote y tripomastigote.
Se realizaron experimentos de “run on” a partir de
núcleos aislados de los estadíos epimastigote y
tripomastigote con el objetivo de marcar cadenas
nacientes de ARN con [α 32 P]-UTP. Las señales
obtenidas a partir de la hibridización de filtros
conteniendo un miembro del grupo S (13f5), grupo
L (mle-1) y controles (ARNr y β-tubulina), se
cuantificaron por densitometría. Las diferencias en
las señales observadas entre 13f5 y mle-1 son
debidas a diferencias en el tamaño de los clones
aplicados sobre la membrana de nylon y no producto
de los valores de transcripción relativos entre ellos.
Las diferencias observadas en los niveles de ARNms durante el desarrollo se deben
a eventos de regulación post-transcripcional.
La comparación de los niveles de ARNms durante el desarrollo del parásito así
como también de las tasas transcripcionales, indican que no existe control a nivel
transcripcional en la expresión de TcSMUG. Las variaciones evidenciadas en los ARNms
podrían deberse a una modificación en los niveles de estado estacionario, a partir de
eventos de regulación a nivel post-transcripcional. Por lo tanto, se analizó la vida-media
(t ) de los ARNms L y S en los estadíos epimastigote y tripomastigote. Para ello, los
1/2
parásitos se incubaron con Actinomicina D (ActD), una droga que inhibe la transcripción,
y después de diferentes tiempos se los colectó por centrifugación para extraer ARN total
y realizar un ensayo de “Northern blot” con la sonda N, que reconoce ambos grupos de
transcriptos (Figura 10 y 11). En el estadío epimastigote, las vidas-medias de los grupos
L y S fueron similares (t > 6 hrs) (Figura 10); en cambio, cuando el mismo experimento
1/2
se realizó en tripomastigotes, la vida-media para el grupo L fue menor, t < 0.5 hrs
1/2
(Figura 11). Para el grupo S no se pudo calcular una vida-media en este estadío ya que
su expresión no es detectada por “Northern blot” (Figura 11A). Estos resultados confirman
que la familia TcSMUG se regula a nivel post-transcripcional, por mecanismos que
controlan los niveles de ARNm durante el ciclo de vida del parásito.
Efecto de inhibidores de la traducción en la estabilidad de los ARNms TcSMUG.
Una explicación posible para las diferencias observadas en los niveles de estabilidad
de los ARNms de la familia TcSMUG entre los estadíos epimastigote y tripomastigote,
50
Resultados
puede involucrar la presencia de
factores proteicos que afecten su
A
Tiempo (hrs)
Tiempo (hrs)
0 .5
1
2
3
4
6
recambio, ya sea en forma positiva
como negativa. Para analizar esta
L
Tiempo (hrs)
0 .5
1
2
3
4
4
6
Tiempo (hrs)
6
0 .5
1
2
3
4
6
L
S
L
S
ARNr
CHX+ActD*
B
C
ARNm remanente (%)
CHX
ARNm remanente (%)
la vida-media de TcSMUG a t = 2 hrs
1/2
para el grupo L y t = 2.5 hrs para el
3
ActD
cicloheximida (CHX) (Figura 10 y 11).
Los parásitos se pre-trataron con CHX
doble tratamiento en el estadío
epimastigote produjo una reducción de
2
ARNr
Control
en presencia de un inhibidor de la
elongación de la síntesis proteica, como
una completa inhibición de la
traducción (Maranon et al., 1998). Este
1
L
S
S
posibilidad, se determinó la vida-media
de los ARNms L y S en ambos estadíos,
durante 4 hrs y luego se agregó ActD,
sin lavar los parásitos, para asegurar
0 .5
120
100
80
60
40
20
0
0
1
2
3
4
tiempo (hrs)
5
6
120
100
80
60
40
20
0
0
1
2
3
4
5
6
tiempo (hrs)
1/2
grupo S (Figura 10). Por lo tanto, una
disminución de al menos 3 veces se
observá en la vida-media de TcSMUG
en comparación con parásitos que no
fueron tratados con CHX. Por lo
contrario, en el estadío tripomastigote
no se observan cambios considerables
en la vida-media en parásitos pretratados con CHX (Figura 11). Es
importante mencionar que el
tratamiento con el inhibidor de la
traducción CHX sólo, sin agregado de
Figura 10 - Estabilidad de los ARNms TcSMUG en el
estadío epimastigote. A, Ensayo de “Northern blot”
realizado a partir de ARN total extraído de epimastigotes
tratados o no con Actinomicina D (ActD) y/o
Cicloheximida (CHX), para los tiempos indicados sobre
cada panel (0, 0.5, 1, 2, 3, 4 y 6 hrs). Las hibridizaciones
fueron secuencialmente realizadas con las sondas
TcSMUG-N y ARNr como se indica en cada caso. B,
Cuantificación de los niveles de ARNm remanente (%)
para el grupo L a partir de la densitometria de las bandas
de los ensayos de Northern blot realizados en A. El gráfico
muestra la normalización de los datos en comparación
con los niveles del control ARNr en cada calle. C, idem al
panel B pero para el grupo S. Círculos cerrados, control
sin tratamiento; cruces, ActD; círculos abiertos, CHX y
cuadrados cerrados, CHX más ActD.
ActD luego de 4 hrs, no produce
ningún efecto considerable en la vida-media de TcSMUG en ambos estadíos, ya que los
niveles de ARNms permanecen constantes (Figura 10A y 11A). De esta manera, la
disminución en los niveles de ARNms no es debido a que la CHX, puede estar reduciendo
la tasa transcripcional de los genes TcSMUG en forma indirecta, pero sí a que los ARNms
son degradados en forma más rápida. Dos posibilidades que permiten explicar estos
resultados se detallan en la Discusión.
51
Resultados
A
Tiempo (hrs)
0 .5 1
2
4
Tiempo (hrs)
6
0 .5 1
L
2
4
Figura 11 - Estabilidad de los ARNms
TcSMUG en el estadío tripomastigote.
A, Ensayo de “Northern blot” realizado a
partir de ARN total extraído de
tripomastigotes tratados o no con
actinomicina D (ActD) y/o cicloheximida
(CHX) para los tiempos indicados sobre
cada panel (0, 0.5, 1, 2, 4 y 6 hrs). Las
hibridizaciones se realizaron en forma
secuencial con las sondas TcSMUG-N y
ARNr como se indica en cada caso. B,
Cuantificación de los niveles de ARNm
remanente (%) para el grupo L a partir de
la densitometría de las bandas de los
ensayos de “Northern blot” realizados en
el panel A. El gráfico muestra la
normalización de los datos en comparación
con los niveles del control ARNr en cada
calle. C, Idem al panel B pero para el grupo
S. Círculos cerrados, control sin
tratamiento; cruces, ActD; círculos
abiertos, CHX y cuadrados cerrados, CHX
más ActD.
6
L
S
S
ARNr
Control
ActD
Tiempo (hrs)
Tiempo (hrs)
0 .5 1 2 4 6 8
0 .5 1
L
L
S
S
2
4
6
ARNr
CHX
CHX+ActD*
C
120
100
80
60
40
20
0
0
1
2
3
4
tiempo (hrs)
5
6
ARNm remanente (%)
ARNm remanente (%)
B
140
120
100
80
60
40
20
0
0
1
2
3
4
5
tiempo (hrs)
52
6
Resultados
PARTE 2 - Identificación de secuencias de ARN en cis capaces de regular la
expresión de TcSMUG.
Construcción de mutantes de deleción del 3’-NC del ARNm del grupo TcSMUG-L
para analizar la presencia de elementos que regulen su estabilidad.
Se ha descripto previamente que TcSMUG se regula a nivel post-transcripcional
durante el ciclo de vida del parásito y que la regulación de la estabilidad de los ARNms es
un componente importante (Figura 10 y 11). De esta manera, el objetivo siguiente fue
identificar elementos que actuen en cis- y regulen los niveles de ARNms después de la
transcripción. Se sabe que las regiones no codificantes de los ARNms generalmente están
involucradas en procesos regulatorios en otros tipos celulares (Chen and Shyu, 1995;
Mignone et al., 2002) y también en tripanosomas, donde controlan los niveles del ARNm
(Vanhamme and Pays, 1995). Por lo tanto, se construyó en el vector pTEX (Kelly et al.,
1992), un “cassette” para ser utilizado en la transfección de parásitos. En este vector se
incluyó el marco abierto del gen reportero cat, el cual se unió a la región 5’-intergénica
del grupo L de TcSMUG o a la región 3’-intergénica entera o mutada (ver Figura 12). Se
utilizaron las regiones intergénicas enteras, ya que son éstas las que presentan las señales
para un correcto procesamiento “in vivo” (Vanhamme and Pays, 1995). Entre ellas se
encuentra la región que contiene el sitio 5’ aceptor de trans-“splicing” (ag) y la región 3’intergénica entera, la cual presenta el tracto de polipirimidina (pPy) requerido para la
poliadenilación, y sitios aceptores 3’ de trans-“splicing” para un eficiente procesamiento
del gen neomicina localizado 3’ de cat. De esta manera, nos aseguramos que “in vivo”
ocurriera un procesamiento adecuado no sólo del gen reportero en cuestión, sino del gen
de selección neomicina, localizado después de cat en el vector pTEX (Kelly et al., 1992).
5'RI
B
TcSMUG-L
pPy
CAT
S
5'NC
ag
3'RI
ARE
GRE
SIRE
3'ss
X
pPyag
H
TcSMUG-LΔGRE
TcSMUG-LΔ1
E
TcSMUG-LΔ2
E
TcSMUG-LΔ3
E
TcSMUG-LΔARE
E
TcSMUG-LΔSIRE
E
Figura 12 - Construcciones realizadas con el gen reportero cat flanqueado de la región 3’-NC de
TcSMUG-L entera o con deleciones parciales. Se muestra una representación esquemática del clon
TcSMUG-L completo y mutantes de deleción de su región intergénica 3’ (RI). Todas las construcciones se
realizaron por PCR como se indica en Materiales y Métodos, utilizando cebadores con sitios de restricción
en sus extremos (B, BamHI; S, SmaI; H, HindIII; E, EcoRI; X, XhoI). Las regiones intergénicas 5’ y 3’
contienen los sitios originales para el trans-“splicing” (AG) y un tracto de polipirimidina (pPy) para el
correcto procesamiento del pre-ARNm. 3’ss, sitio 3’-aceptor del “splicing”.
53
Resultados
Además de la construcción con las regiones 5’- y 3’-intergénicas completas (denominada
TcSMUG-L), se construyeron 6 mutantes adicionales (Figura 12). Cada mutante se
delecionó en uno de los bloques en los cuales la región 3’-NC de TcSMUG se organiza,
como se mencionó anteriormente (Figura 8C). Las diferentes mutantes se denominaron:
TcSMUG-LΔGRE, sin el elemento ubicado después del codón de terminación de la
traducción y compuesto por 30 pbs ricas en Guanosina; TcSMUG-LΔ1, el cual carece del
segundo elemento compuesto por ~40 pbs; TcSMUG-LΔ2, el cual carece del tercer elemento
de ~90 pbs; TcSMUG-LΔ3, el cual está compuesto por ~100 pbs; TcSMUG-LΔARE, sin la
región rica en Adenosina-Uridina (ARE), compuesta por ~44 pbs; y por último, TcSMUGLΔSIRE, la cual carece del retrotransposón SIRE de ~450 pbs (Figura 12).
Análisis de los sitios aceptores de trans-“splicing” y poliadenilación por RT-PCR
en los transcriptos provenientes de las construcciones TcSMUG-L.
El primer paso antes del análisis de la estabilidad de los ARNms provenientes de
todas las construcciones, fue evaluar los sitios utilizados para el trans-“splicing” y la
poliadenilación. Como se indica en Materiales y Métodos, se llevaron a cabo reacciones
de RT-PCR con dos juegos diferentes de cebadores para clonar los extremos 5’- y 3’terminales de los ARNms. Luego del clonado de bandas correspondientes a cada una de
las construcciones, se secuenciaron los sitios aceptores de 6 clones de cada construcción
y se comparó con los sitios utilizados en la construcción control TcSMUG-L. Los resultados
de las secuencias permitieron concluir lo siguiente: (1) de los sitios putativos aceptores
para trans-“splicing” que se encuentran en la región 5’-intergénica de TcSMUG-L (ver
Figura 8E), los clones analizados utilizan preferencialmente el segundo ag, aunque los
sitios 1 y 3 también se utilizan para el “splicing”; (2) el sitio de poliadenilación utilizado
en los ARNms TcSMUG endógenos (Figura 8E), es el utilizado para el procesamiento del
extremo 3’ de los pre-ARNms que derivan de las construcciones TcSMUG-L. De esta
manera, las poblaciones de parásitos transfectados evaluadas sirven para realizar los
ensayos de determinación de la vida-media de los ARNms generados a partir de las
construcciones TcSMUG-L.
Determinación de la vida-media de los ARNms provenientes de las mutantes del 3’NC del grupo TcSMUG-L.
Las construcciones se transfectaron en epimastigotes de T. cruzi, y se seleccionaron
en presencia del antibiótico geneticina. Una vez que las poblaciones transformantes se
seleccionaron, se realizaron determinaciones de vida-media de los transcriptos
provenientes de las construcciones TcSMUG-L y de las mutantes de deleción de la región
3’-NC (Figura 13). Para ello nos basamos en la presencia de un promotor sensible a ActD
en el vector pTEX utilizado (Kelly et al., 1992). Los resultados demuestran que el ARNm
proveniente de la construcción completa TcSMUG-L posee una vida media t = 70 min.
1/2
A diferencia, la construcción TcSMUG-LΔGRE, presenta una vida-media inferior (t =
1/2
30 min), lo cual representa una reducción del 58% (Figura 13A y B). Esta secuencia GRE
(“G-rich Element”), rica en Guanosina, está compuesta por 27 nt río abajo del codón de
terminación de la traducción y presenta dos pentámeros contiguos CGGGG (ver más
adelante). Los transcriptos provenientes de otras dos construcciones, TcSMUG-LΔ2 y
54
Resultados
TcSMUG-LΔ3, presentan vidas-medias muy similares a TcSMUG-L (t = 75 min. y t =
1/2
1/2
65 min., respectivamente). Finalmente, las construcciones TcSMUG-LΔ1 y TcSMUGLΔSIRE, generan ARNms con mayores vidas-medias (t = 140 min.). Debido a que el
1/2
retrotransposón SIRE es un elemento grande (Vázquez et al., 1994), es necesario realizar
deleciones parciales del mismo para definir la región específica que causa tal efecto en la
estabilidad del ARNm TcSMUG. En cuanto a la construcción TcSMUG-LΔARE, no se
observó ningún efecto significativo en la modificación de la vida-media (t = 68 min.)
1/2
(ver más adelante). Debido a que en la determinación de la vida-media de TcSMUGLΔGRE, menos del 50% de los niveles de ARNm permanecen estables en el primer punto
experimental (60 min.) (Figura 13A), el ensayo se repitió tomando muestras entre 0 y 60
min. (Figura 13C y D). Así, se calculó con mayor exactitud la vida-media de TcSMUGLΔGRE (t = 30 min.) y mostró ser idéntica a la determinada en la Figura 13A.
1/2
TcSMUG-L
ActD (min) 0
TcSMUG-LΔGRE
60 120 180 0
TcSMUG-LΔ1
60 120 180
0
B
60 120 180
ARNm remanente (%)
A
CAT
NEO
ARNr
*
100
*
50
* TcSMUG-LΔ1
10
TcSMUG-LΔ3
0
ActD (min) 0
60 120 180
TcSMUG-LΔ3
0
60
TcSMUG-LΔSIRE
60 120 180
0
TcSMUG-L
TcSMUG-LΔ2
**
1
TcSMUG-LΔ2
TcSMUG-LΔSIRE
**
* TcSMUG-LΔGRE
120
180
Minutos en ActD
60 120 180
Clon
t 1/2 (min)
TcSMUG-L
TcSMUG-LΔGRE
TcSMUG-LΔ1
TcSMUG-LΔ2
TcSMUG-LΔ3
TcSMUG-LΔSIRE
CAT
NEO
70
30
140
75
65
140
C
TcSMUG-L
ActD (min)
0
15
30 45
D
TcSMUG-LΔGRE
60
0
15
30 45
60
CAT
ARNr
ARNm remanente (%)
ARNr
100
*
50
TcSMUG-L
**
**TcSMUG-LΔGRE
10
0
15
30
45
60
Minutos en ActD
Figura 13 - Determinación de la vida-media de los ARNms provenientes de las deleciones del
3’-NC de TcSMUG-L. A, Parásitos del estadío epimastigote se transfectaron con los ADN
recombinantes indicados en la Figura 12, y se trataron con ActD 10 μg/ml. Se cosecharon parásitos
a diferentes tiempos, y se extrajo ARN total para realizar ensayos de “Northern blot”. El mismo
filtro se hibridizó en forma secuencial con las sondas de cat, neo y ARNr. La hibridización realizada
con la sonda neo sirve como un control interno del experimento ya que éste gen se expresa del
mismo vector pTEX que cat (Kelly et al., 1992). B, Cuantificación de las bandas de los ensayos de
“Northern blot” del panel A. La vida-media de cada transcripto se indica debajo del gráfico. C,
Epimastigotes transfectados con las construcciones TcSMUG-L y TcSMUG-LΔGRE se trataron
igual que en el panel A con ActD y se extrajo ARN total en tiempos más cortos, para determinar su
vida-media en forma más precisa. D, Cuantificación de las bandas del “Northern blot” del panel
C. En los paneles B y D los valores se expresan como la cantidad relativa media de ARNm, +/- el
error estándar de la media (n=3) para cada tiempo, luego de la normalización con los valores de
ARNr para cada punto. Las diferencias entre TcSMUG-L y las mutantes de deleción fueron
significativas cuando se compararon las medias por un test t de Student (*, p < 0.05; **, p < 0.01).
55
Resultados
Estos resultados sugieren que el 3’-NC de TcSMUG-L se divide en diferentes regiones
funcionales: (1) un elemento positivo llamado GRE, rico en Guanosina y ubicado en los
primeros 27 nt; (2) un elemento negativo, llamado E1 por elemento 1, ubicado entre los
nucleótidos 28-62 después del codón de terminación; y (3) un elemento rico en AdenosinaUridina (ARE) ubicado entre los nucleótidos 272-318, que es similar en secuencia a los
elementos AREs de mamíferos. Las regiones 3’-NC de los ARNms fueron modeladas
utilizando el programa Genequest (Lasargene Package, DNAstar Inc.), para predecir si
las deleciones del 3’-NC, tendrían algún efecto en la estructura tridimensional predicha
del ARN. Estos transcriptos demostraron presentar una estructura modelada semejante,
incluyendo todos los “loops” de la región 3’-NC (resultados no mostrados). En resúmen,
la composición de la secuencia de los elementos GRE, ARE y E1, son las que confieren el
efecto observado sobre la estabilidad del ARNm.
El elemento GRE confiere un efecto estadío específico positivo en la estabilidad
del ARNm TcSMUG-L, y es funcionalmente diferente al ARE.
No se observó ningún efecto en la estabilidad del ARNm TcSMUG-L en el estadío
epimastigote al delecionarse el elemento ARE (ver más adelante). Por el contrario, el
elemento GRE, sí modula en forma positiva la estabilidad del ARNm en este estadío
(Figura 13). Ya que estas dos construcciones son las más interesantes desde el punto de
vista funcional, se analizó el efecto de estas deleciones en la estabilidad del ARNm en dos
diferentes estadíos: epimastigote y tripomastigote metacíclico. Los resultados se obtuvieron
a partir de las construcciones TcSMUG-L (3’-NC completo), TcSMUG-LΔARE (ARE
delecionado del 3’-NC) y TcSMUG-LΔGRE (Figura 14A). Los parásitos del estadío
epimastigote se diferenciaron a la forma infectiva, tripomastigote metacíclicos, y se
incubaron con la droga ActD, para determinar la vida-media de los transcriptos derivados
de esas construcciones (Figura 14). Luego del tratamiento con la droga, se colectaron
parásitos a diferentes tiempos: 0, 45, 60, 90 y 120 min. para el estadío epimastigote; y 0,
10, 20, 30 min. para el estadío tripomastigote metacíclico. Los tiempos colectados en los
dos estadíos fueron diferentes ya que, como se demostró, el ARNm de TcSMUG-L es de
vida-media corta (t < 30 min) en el estadío infectivo tripomastigote metacíclico (ver
1/2
Figura 11). Utilizando como sonda de ADN la región codificante del gen reportero cat, se
realizó un ensayo de “Northern blot”. En el estadío epimastigote los transcriptos TcSMUGL y TcSMUG-LΔARE, ambos con un el elemento GRE en su región 3’-NC, presentaron
vidas-medias similares (t = 70 y 68 min., respectivamente) (Figura 14B y C). En contraste,
1/2
el transcripto TcSMUG-LΔGRE fue menos estable (t = 30 min.), como se mencionó
1/2
anteriormente (Figura 13). Hasta el momento se puede concluir que: (1) el elemento GRE
en el estadío epimastigote está involucrado en un proceso de estabilización del ARNm
TcSMUG, y (2) el elemento ARE no está involucrado en la estabilización del ARNm
TcSMUG-L en epimastigotes, ya que los transcriptos TcSMUG-L y TcSMUG-LΔARE
presentan la misma vida-media (ver Figura 14).
El análisis de las vidas-medias en el estadío tripomastigote metacíclico, derivados
por diferenciación de los epimastigotes transformados, también reveló diferencias en los
niveles de ARNm (Figura 14D y E). Los transcriptos TcSMUG-L y TcSMUG-LΔGRE son
de vida-media muy corta (t < 10 min.), en comparación con el ARNm TcSMUG-LΔARE,
1/2
56
Resultados
el cual presenta una vida-media mayor (t > 30 min.) (Figura 14D y E). De esta manera,
1/2
se puede concluir que la inestabilidad de TcSMUG-L y TcSMUG-LΔGRE en el estadío
tripomastigote metacíclico se debe, en parte, a la presencia del elemento ARE en su
región 3’-NC. Como control del ensayo de “Northern blot”, el mismo filtro se hibridizó en
forma secuencial con una sonda de ADN correspondiente al gen de selección neomicina.
Debido a que el gen neomicina está flanqueado por las regiones intergénicas de la
gliceraldehído-3-fosfato deshidrogenasa, en el plásmido pTEX (Kelly et al., 1992), éste
sirve como control interno para la determinación de la vida-media de diferentes ARNms.
Como se muestra, el ARNm neo presenta la misma tasa de recambio en todas las
poblaciones de parásitos evaluadas, en forma independiente de la construcción en estudio
(Figura 14).
A
AAUUUUAAAAUUUAUUUAAUGUUGUUUUGAUUUAUUUAUUUUAA
S
B
TcSMUG-L
3'ss
H
pPy ag
GRE
X
pPy ag
ARE
TGAGGACGGGGCGGGGCGCGUGCGCC
B
TcSMUG-LΔGRE
3'ss
S
X
pPy ag
pPy ag
H
B
3'ss
S
TcSMUG-LΔARE
B
TcSMUG-L
ActD (min) 0
TcSMUG-LΔGRE
45 60 90 120
0
TcSMUG-LΔARE
45 60 90 120
0
pPy ag
E
H
C
ARNm remanente (%)
pPy ag
X
45 60 90 120
CAT
NEO
100
50
*
**
TcSMUG-L
TcSMUG-LΔARE
**
10
0
ARNr
D
45
* TcSMUG-LΔGRE
60
90
120
Minutos en ActD
ActD (min) 0
10
20
TcSMUG-LΔGRE
30
0
10
20
TcSMUG-LΔARE
30
0
10
20 30
CAT
NEO
ARNm remanente (%)
E
TcSMUG-L
100
**
**
**
10
ARNr
0
F
ARN
Estadio
Epimastigote
Tripomastigote
TcSMUG-L
TcSMUG-LΔARE
50
10
20
30
Minutos en ActD
TcSMUG-L
TcSMUG-LΔGRE
TcSMUG-LΔGRE TcSMUG-LΔARE
t 1/2 (min)
t 1/2 (min)
70
30
t 1/2 (min)
68
(Estable)
(Inestable)
(Estable)
<10
<10
>30
(Inestable)
(Inestable)
(Estable)
Figura 14 - Dos elementos regulatorios funcionalmente diferentes y localizados en el 3’-NC
del ARN TcSMUG-L. A, Representación esquemática de TcSMUG-L (construcción completa), y las mutantes
de deleción utilizadas para transfectar parásitos de la forma epimastigote. La secuencia que fue delecionada
en los clones TcSMUG-LΔGRE y TcSMUG-LΔARE se indica en el esquema de TcSMUG-L. B, Ensayo de
“Northern blot” realizado sobre ARN total extraído de las diferentes poblaciones tratadas con ActD a los
tiempos indicados. El mismo filtro se hibridizó en forma secuencial con las sondas cat, neo y ARNr. C,
Cuantificación de los niveles de ARNm cat a partir del “Northern blot” del panel B. Los datos se expresaron
como la cantidad de ARNm relativa a la media +/- el error estándar de la media (n=3) en cada punto luego de
la normalización con los niveles de ARNr. Las diferencias entre TcSMUG-LΔGRE y TcSMUG-L y entre TcSMUGLΔGRE y TcSMUG-LΔARE fueron significativas (*, p < 0.05; **, p < 0.01 cuando se comparó las medias a
partir de un test t de Student). D, Tripomastigotes-metacíclicos derivados de los epimastigotes transfectados,
se trataron como se indica en B. E, Cuantificación de los niveles de ARNm de cat del panel D. Los datos se
expresaron como para el panel C. Las diferencias entre TcSMUG-LΔARE y TcSMUG-L y entre TcSMUGLΔARE y TcSMUG-LΔGRE fueron significativas (**, p < 0.01, cuando se compararon las medias por un test t
de Student). En los paneles C y E, la vida-media de cada transcripto se indica al costado del gráfico. F, Tabla
que resume los resultados obtenidos en la Figura.
57
Resultados
Los elementos de la región 3’-NC también modulan la eficiencia traduccional.
Se sabe que en las regiones 3’-NC de un tipo particular de ARNms de tripanosomas
existen secuencias que pueden modular la traducción (Furger et al., 1997). De la misma
forma, en células de mamíferos la presencia del ARE, por ejemplo en el ARNm del tnf-α,
también exhibe un efecto en la tasa traduccional (Kontoyiannis et al., 1999). Con el
objetivo de determinar si los elementos de la región 3’-NC de TcSMUG-L controlan la
traducción, se midió la actividad enzimática CAT en las diferentes poblaciones
transformadas. Los valores de actividad se normalizaron a los niveles de ARNm cat en el
estado-estacionario para cada construcción. La medida de actividad enzimática relativa
se expresó como el porcentaje de la actividad obtenida con la construcción completa
TcSMUG-L normalizada a la cantidad de ARNm cat detectado (Figura 15).
vida-media ARNm
5'RI
B
TcSMUG-L
pPy
CAT
S
5'NC
ag
3'RI
ARE
GRE
SIRE
3'ss
Eficiencia
traduccional
minutos
(%)
(%) de TcSMUG-L
70
(100)
100
30
(42)
117
140
(200)
185
75
(107)
88
65
(93)
112
68
(97)
21
140
(200)
15
X
pPy ag
H
TcSMUG-LΔGRE
TcSMUG-LΔ1
E
TcSMUG-LΔ2
E
TcSMUG-LΔ3
E
TcSMUG-LΔARE
E
TcSMUG-LΔSIRE
E
Figura 15 – Identificación de elementos negativos y positivos en el 3’-NC de TcSMUG-L
involucrados en el control de la estabilidad del ARNm y traducción. Se indica la vida media (en
minutos) de cada construcción y el (%) entre paréntesis en comparación con la construcción TcSMUGL. Además, la eficiencia traduccional de cada población, como (%) de la construcción TcSMUG-L.
En la población transfectada con TcSMUG-LΔGRE los valores obtenidos de actividad
CAT fueron similares a los de la construcción TcSMUG-L (117%). Esto sugiere que si
bien este elemento regula los niveles de ARNm, es incapaz de modular la traducción
(Figura 15). En cambio, TcSMUG-LΔ1, cuyo transcripto presenta una vida-media mayor
que el control TcSMUG-L, presentó niveles mayores de traducción (185%). Este resultado
sugiere que el elemento E1 regula ambos procesos en forma negativa en el estadío
epimastigote. Las construcciones TcSMUG-LΔ2 y TcSMUG-LΔ3 no producen un efecto
considerable en la actividad traduccional (88% y 112% de TcSMUG-L, respectivamente)
(Figura 15). El retrotransposón SIRE, sin embargo, produce un efecto positivo, ya que su
deleción ocasiona una disminución de la actividad enzimática CAT (15% de TcSMUG-L).
Este resultado es interesante, ya que en el laboratorio del Dr. Levin, se sugirió previamente
que el elemento SIRE exhibe otras funciones diferentes en el procesamiento y la
maduración de los pre-ARNms (Vázquez et al., 1994). El hecho de que SIRE esté presente
en distinas posiciones en las regiones intergénicas y/o NC de varios ARNms, sugiere una
función determinada en el procesamiento y/o control de la expresión dependiente de su
localización.
58
Resultados
El elemento ARE está representado en el genoma de T. cruzi.
A partir de la funcionalidad del ARE “in vivo” en el control de la estabilidad y la
traducción, se analizó la presencia de esta secuencia en otros transcriptos de T. cruzi.
Para ello se realizó una búsqueda en la base de datos del NCBI (con un “expect” igual a
1) utilizando el ARE del grupo TcSMUG-L. Esta búsqueda mostró docenas de secuencias
similares. En muchos de ellos se encontraron motivos ARE de clase I y II en las regiones
3’-NC.
ARNm
Secuencia de la región rica en Uridina
Grupo
plc-1 (AF093565)
20pb-AUAUAUAUAUAUAUAUAUAUAUAUUUAUUUAUUU
Proteina unión Ca
(L01584.8)
660pb-AUUUUAUUAUUAUUUAUUAUUAUUUAU AUAUAAAU 100pbAUAUUUAUUUAUUUAUAUAUAAA
IIA
Calmodulina (x52096)
140pb-UU AUUUAAU-25pb-UUUAUUUAUUUUAU
IID
Transportador de
Hexosa (U05588)
413pb-AAAUUAAUUUAUUUAUUUAUUU
gdh (AF051892)
350pb-AUUUAUUUAUUUAUUUUUAAA
ATPAsa (U40265)
1pb-UUUAUUUUAUUUAUUUUU-40pb-AUAUUUAUU-30pb-UUAUUUAUU
I
I
I
IIC
Cruzipaina (X54414)
40pb-AUUUUA-90pb-UAUUUAUUUU
I
Tcce5 (AB003068)
110pb-AUAAUAAUAUAUAUUUAUUUAUU
I
R27-2 (L04603)
100pb-UUUUUAUUUAUUUUUUUUUU-100bpU UAUUUAUUUAUUUAUUUUAUUAUUAUU
gp82 (L14824)
100pb-UUUAUUUUAUGUAUUUUUAUUUUU-160pb-UAUUUAAU
I
Tssa (AF036421)
85pb-AUUUA-10pb-UUUUUUAUUUAUUUUUAUUUUAU
I
gp72 (M65021)
350pb-UAUAUAUUUAAUAUUAUAU
I
Amastina (U04337)
130pb-UUUUAUUUAUUUUAUUUUUUU
I
IIB
Tabla 2 - Los elementos ARE están presentes en las regiones 3’-NC de varios transcriptos
de T. cruzi. Las secuencias de T. cruzi presentes en la base de datos del “GenBank” se rastrearon
utilizando la secuencia ARE del grupo TcSMUG-L. En esta Tabla se indican algunos ejemplos
seleccionados de genes ya caracterizados. El número de acceso al “GenBank” se muestra al lado
del nombre de cada ejemplo. El número de pb en las secuencias de los ARE indica la distancia
entre el codon de terminación de la traducción y entre el elemento ARE presente en cada ejemplo.
Los pentámeros AUUUA están subrayados y también se indica el grupo de cada elemento al cual
son similares según su descripción (Xu et al., 1997).
En la Tabla 2 se muestran ejemplos de moléculas ya caracterizadas en T. cruzi
que contienen AREs; entre ellos una fosfolipasa-c (plc-1), la proteína de unión a calcio,
gp-82 (un antígeno de superficie) y amastina entre otros. Lo interesante es que se
identificaron motivos ARE que presentan pentámeros AUUUA aislados, además del
nonámero UUAUUUAUU o la presencia de pentámeros AUUUAUUUA solapados (Tabla
2). Cuando se rastreó la base de datos de “EST” de T. cruzi , se obtuvieron cientos de
secuencias, pero las mismas correspondieron a moléculas no caracterizadas hasta el
momento.
Comparación de las secuencias ARE de T. cruzi y las presentes en otros tipos
celulares.
En células de mamífero la degradación de ARNms mediada por elementos ARE,
está relacionado con procesos de transformación celular, crecimiento, diferenciación,
adhesión celular y también en la regulación de la respuesta inmune (Chen and Shyu,
1995). En la región 3’-NC del grupo L de TcSMUG, el motivo UUAUUUAU(U/A) está
59
Resultados
repetido dos veces, como en los ARNms de la interleuquina-3 (Stoecklin et al., 1994) y en
el ARNm del interferón-γ (Peppel et al., 1991), donde se asociaron estos motivos con la
degradación de ARNms. Además, se reportó que una copia del nonámero UUAUUUAUU
produce una leve desestabilización, mientras que dos copias (como es el caso del grupo
L) provee una desestabilización de ARNms mayor (Lagnado et al., 1994; Zubiaga et al.,
1995). El pentámero AUUUA está repetido 4 veces en el ARE del grupo L y otros grupos
de trabajo reportaron que es ésta secuencia, en vez del nonámero, el mínimo elemento
funcional del ARE (Xu et al., 1997). El ARNm del grupo S no presenta pentámeros pero
si tiene dos motivos AUUUUA, por lo cual es levemente diferente a los ARE descriptos.
Sin embargo, existen secuencias ARE que no contienen el motivo AUUUA, que también
pueden mediar el decaimiento del ARNm (Chen and Shyu, 1995).
60
Resultados
PARTE 3 - Identificación de proteínas que reconocen los elementos ARE y
GRE.
El elemento GRE es reconocido por proteínas de unión a ARN las cuales forman
complejos nucleares y citoplasmáticos.
La identificación de elementos involucrados en procesos de estabilización de
ARNms, sugirió pensar en la presencia de factores que actúen en trans- y los reconozcan
específicamente. Primero se buscaron proteínas que reconozcan al elemento GRE, por
su importante papel en la regulación de la estabilidad de TcSMUG-L (Figura 14). La
secuencia GRE de 27 nt se sintetizó por transcripción “in vitro” en presencia de [α32P]UTP. Esta ribosonda fue utilizada para ensayos de unión en presencia de extractos
proteicos de los diferentes estadíos del parásito. Los complejos formados fueron analizados
en geles nativos de poliacrilamida (técnica de retardo en gel). Este ensayo reveló que el
GRE es reconocido por 3 complejos proteicos presentes en todos los estadíos del desarrollo
de T. cruzi. Como control del experimento, se realizaron las incubaciones en presencia
del “buffer” de reacción no evidenciándose bandas de complejos con proteínas (Figura
16A, calle ARN).
ARN
A
Estadio
B
E Mt A T
Figura 16 - El elemento GRE es reconocido
por proteínas del parásito que presentan
diferentes masas moleculares. A, La secuencia
GRE se transcribió “in vitro” y se incubó con
extractos proteicos totales provenientes de los
cuatro estadíos del parásito: (E) epimastigotes,
(T) tripomastigotes derivados de células, (Mt)
tripomastigotes metacíclicos y (A) amastigotes
intracelulares. Para el análisis de las
interacciones ARN-proteína, la reacción de unión
“in vitro” se resolvió en un gel nativo. Los
complejos GRE identificados (1, 2 y 3) se indican a la izquierda del panel. B, El ARN GRE se
incubó con un extracto proteico de epimastigotes
y se realizó un gel de retardo preparativo. Los
complejos ARN-proteína localizados fueron
entrecruzados covalentemente por la irradiación
con luz UV y eluídos de la matriz. Luego se corrió
un gel desnaturalizante SDS-PAGE 10% y se
expuso a placas radiográficas para determinar
las masas moleculares aparentes según
comparación com marcadores de peso molecular conocidos.
GRE
kDa
1
2
3
110
97
GRE-1
66
45
GRE-2
29
GRE-3
ARN libre
SMUG-L-GRE
UGAGGACGGGGCGGGGCGCGUGCGCCG
61
Resultados
Para determinar las masas moleculares aparentes de las proteínas que forman
parte de los complejos identificados, llamados GRE-1, GRE-2 y GRE-3 (Figura 16A), un
extracto proteico total del estadío epimastigote se incubó en presencia de la ribosonda
GRE. Las reacciones de unión “in vitro” se corrieron en geles nativos de poliacrilamida
en condiciones preparativas; es decir, se sembraron ~20 veces más de muestra que en el
gel analítico de la Figura 16A. La posición de los complejos ribonucleoproteicos se identificó
por exposición del gel a una placa autorradiográfica durante 2 horas a 4ºC, y luego los
complejos se entrecruzaron en forma covalente por irradiación con luz UV y se cortaron
para su posterior análisis en geles SDS-PAGE (Figura 16B). Este ensayo demostró que el
complejo GRE-1 está compuesto por un sólo polipéptido de ~80kDa, mientras que los
complejos GRE-2 y GRE-3 están compuestos por varios polipéptidos de masas moleculares
aparentes de ~35, 40 y 66kDa (Figura 16B). Las proteínas que forman parte del complejo
GRE-2 presentan diferentes niveles de abundancia en un lisado total del estadío
epimastigote. Es así como una banda poco abundante de ~66kDa se detecta junto con
dos bandas de ~35 y 55kDa de mayor abundancia (Figura 16B).
Ensayos de competición para determinar la especificidad y localización subcelular
de los complejos GRE.
La especificidad de los complejos que se forman con el GRE se caracterizaron
mediante experimentos de competición (Figura 17). En primer lugar, se prepararon
reacciones de unión ARN-proteína en ausencia o en presencia de cantidades crecientes
de homoribopolímeros sin marcar (poli(A), poli(C), poli(G) y poli(U)) y la ribosonda GRE.
Poli(G) es el único ARN que bloquea en forma selectiva la formación de los complejos
GRE-1 y GRE-2 (Figura 17A). Este resultado está de acuerdo con la naturaleza del elemento
GRE utilizado para los ensayos de retardo en gel, ya que GRE tiene un alto contenido en
Guanosina. El complejo GRE-1 se desplaza en forma efectiva con un exceso molar de
polímero de 10X, mientras que el complejo GRE-2 se compite parcialmente en presencia
de un exceso 1000X de poli(G) (Figura 17A). Esto puede deberse a diferencias en la
concentración de las proteínas que forman parte de los complejos en el extracto, lo cual
también se sugiere a partir del ensayo de entrecruzamiento de los complejos por UV
(Figura 16B). A diferencia de lo que sucede con los complejos GRE-1 y GRE-2, la formación
de GRE-3 no se compite en forma eficiente por los polímeros de ARN utilizados (Figura
17A), indicando que su formación es inespecífica.
Con el objetivo de determinar cuál es la mínima secuencia reconocida por los
complejos en GRE, esta secuencia se dividió en dos partes: a) SMUG-L-GRE-1: 5’GGACGGGGCGGGGC-3’; y b) SMUG-L-GRE-2, este último con un contenido rico en CG
y la secuencia 5’-GCGCGUGCGCCG-3’ (ver Figura 17B). Con las dos secuencias marcadas
de la misma manera que GRE, se realizaron geles de retardo con fracciones proteicas
nucleares y citoplasmáticas, y también con un lisado total como control (Figura 17C).
Este ensayo permite concluir que la mínima secuencia requerida para el reconocimiento
y la formación de los complejos GRE-1 y GRE-2 es la secuencia SMUG-L-GRE-1, la cual
está compuesta por dos pentámeros contiguos CGGGG. Mientras que el complejo GRE1 se localiza en el citoplasma, GRE-2 está distribuído en ambos compartimentos, núcleo
y citoplasma (Figura 17C); lo cual indica que estos polipéptidos pueden estar involucrados
62
Resultados
en el transporte del ARNm TcSMUG (ver Discusión).
poli (A)
ARN
A
-
poli (C)
poli (G)
poli (U)
C
SMUG-L
GRE GRE-1 GRE-2
10 100 1000 10 100 1000 10 100 1000 10 100 1000
T N C T N C T N C
GRE-1
GRE-1
GRE-2
*
GRE-2
GRE-3
GRE-3
B
ARN
Secuencia
SMUG-L-GRE
UGAGGACGGGGCGGGGCGCGUGCGCCG
SMUG-L-GRE-1
SMUG-L-GRE-2
GGACGGGGCGGGGC
ARN libre
GCGCGUGCGCCG
Figura 17 - Determinación de la especificidad y localización subcelular de las proteínas
que reconocen al GRE. A, Se realizaron reacciones de unión “in vitro” con la sonda GRE sóla
(ARN), y extracto de proteínas del estadío epimastigote sin competidor (-) o en presencia de
cantidades crecientes (10, 100, 1000X) de polímeros de ARN (poliA, poliC, poliG y poliU), con el
objetivo de determinar la especificidad de la interacción ARN-proteína. Las reacciones se
resolvieron en un gel nativo 7% como se indica. B, Se muestra la secuencia de los
oligoribonucleótidos sintetizados y utilizados en los geles nativos del panel C: SMUG-L-GRE,
elemento GRE completo; SMUG-L-GRE-1, primera mitad del elemento GRE; SMUG-L-GRE-2,
segunda mitad del elemento GRE. C, Parásitos del estadío epimastigote se lisaron con NP-40
para obtener fracciones nucleares (N) y citoplasmáticas (C). Estas fracciones se utilizaron en
reacciones de unión “in vitro” y los complejos se resolvieron por geles nativos. La posición de los
complejos GRE-1, GRE-2 y GRE-3 se indica a la izquierda de la Figura. La flecha con el asterisco
indica la posición de una banda artefacto debido a la sonda de ARN SMUG-L-GRE-1.
63
Resultados
El elemento ARE interacciona con proteínas de unión a ARN expresadas en forma
diferencial durante el desarrollo del parásito.
Como se demostró anteriormente, la secuencia rica en Adenosina-Uridina (ARE)
de 44 nt es importante en la regulación del ARNm TcSMUG-L, ya que confiere inestabilidad
en forma estadío específica (Figura 14). Con el objetivo de determinar si existen proteínas
o complejos que reconocen al ARE en los distintos estadíos del parásito, este ARN se
marcó por transcripción “in vitro” y se incubó de la misma manera que el GRE con
extractos totales de las distintas formas de T. cruzi (Figura 18A). Se identificaron complejos
formados entre proteínas del extracto y el elemento ARE (Figura 18A). En el estadío
epimastigote se identificó un complejo llamado eAREBP, por epimastigote “ARE-binding
protein”, el cual migra más lento que los complejos denominados AREBPs, presentes
sólo en los otros tres estadíos del ciclo de vida. Luego se procedió a determinar la
composición y las masas moleculares aparentes de los componentes de los complejos
que reconocen al ARE a partir de ensayos de entrecruzamiento con luz UV y geles SDSPAGE (Figura 18B). La proteína eAREBP del estadío epimastigote presenta una masa
aparente ~100kDa, mientras que las proteínas AREBPs tienen un peso molecular aparente
de entre 45-50kDa y están compuestas por al menos dos polipéptidos (Figura 18B).
ARN
A
Estadio
B
E Mt A T
Estadio
kDa
110
97
eAREBP
E
Mt
A
T
eAREBP
66
AREBPs
45
AREBPs
29
ARN libre
SMUG-L-ARE
AAUUUUAAAAUUUAUUUAAUGUUGUUUUGAUUUAUUUAUUUUAA
64
Figura 18 – La expresión de las
proteínas de unión al ARE está
regulada durante el desarrollo
del parásito. A, El elemento
SMUG-L-ARE se generó por
transcripción “in vitro” y se incubó
con extractos proteícos totales
provenientes de los cuatro estadíos
del parásito. Para el análisis de las
interacciones ARN-proteína, las
reacciones de unión “in vitro” se
resolvieron en un gel nativo 7%.
Las flechas indican la posición de
los
diferentes
complejos
ribonucleoproteicos identificados,
eAREBP y AREBPs. La posición del
ARN incubado en ausencia de
proteínas se indica como ARN. B,
El ARN se incubó al igual que en
el panel A en forma preparativa.
Los complejos localizados en el gel
nativo,
se
entrecruzaron
covalentemente por irradiación con
luz UV y electroforesis en un gel
SDS-PAGE 10% para determinar
sus masas moleculares aparentes
en comparación con marcadores
de peso molecular conocidos.
Resultados
Las proteínas que reconocen al ARE presentan un patrón de regulación durante el
desarrollo (Figura 18). Según los resultados obtenidos hasta el momento, habría un
proceso de regulación estadío específico durante el ciclo de vida del parásito. Estos factores
podrían actuar en forma coordinada y competitiva en trans para influir sobre la estabilidad
de los transcriptos TcSMUG, y afectar la expresión final de los productos durante el
desarrollo (ver más adelante).
Ensayos de competición para determinar la especificidad de las proteínas de unión
al ARE.
Se realizaron experimentos de competición con homoribopolímeros para confirmar
la especificidad de las proteínas que reconocen al ARE (Figura 19). En primer lugar, los
experimentos de desplazamiento muestran que eAREBP es selectivamente desplazada
en presencia de cantidades crecientes de ARN poli(U), pero no por otros polímeros (Figura
19A). También se realizaron experimentos de competición con las secuencias ARE-sentido
y ARE-antisentido transcriptas “in vitro”. El agregado de cantidades crecientes del ARN
ARE-sentido en la mezcla de reacción, produce una reducción en la formación del complejo
conteniendo eAREBP, el cual es dependiente de la concentración de competidor utilizada
(Figura 19B). Por otro lado, el agregado de cantidades crecientes del ARE-antisentido no
tiene efecto significativo en la interacción del ARE con eAREBP. En segundo lugar, las
proteínas del estadío tripomastigote (tAREBPs) también se compiten en forma selectiva y
eficiente con ARN poli(U), pero no con otros polímeros (Figura 19C). Este desplazamiento
también se detecta con el
poli (A)
ARN
A
-
poli (C)
poli (G)
ARN ARE-sentido, pero no
con el ARE-antisentido
poli (U)
10 100 1000 10 100 1000 10 100 1000 10 100 1000
(Figura
19D).
Estos
resultados confirman que las
eAREBP
B
SMUG-L-ARE
antisentido
ARN
poli (U)
-
10
50 100 200 10
proteínas tAREBPs, al igual
que eAREBP, reconocen en
SMUG-L-ARE
sentido
50 100 200 10
50 100 200
forma específica al ARE y
que su alto contenido en
D
SMUG-L-ARE SMUG-L-ARE
sentido
antisentido
ARN
poli (U)
poli (G)
-
poli (C)
ARN
C
poli (A)
eAREBP
-
50
100 200
50
100
Uridina es importante para
la interacción.
200
tAREBPs
Figura 19 – Ensayos de competición de las proteínas de unión al ARE con distintos ARNs. A,
Se realizó un gel nativo para resolver las reacciones de unión “in vitro” entre un extracto total de
epimastigotes incubado con el elmento ARE sólo (-) o competido con cantidades crecientes de
polímeros de ARN sin marcar. ARN, denota la presencia del ARN sin incubar con el extracto. La
posición de eAREBP se indica en la izquierda del panel. B, Gel nativo para resolver las interacciones
entre eAREBP y cantidades crecientes de los ARN poli(U), ARE-sentido y ARE-antisentido. C, Gel
de retardo nativo para resolver las interacciones entre tAREBPs y el ARE en ausencia (-) o presencia
de polímeros de ARN sin marcar como competidores. D, Gel de retardo nativo para resolver las
interacciones entre tAREBPs y el ARE en ausencia (-) o presencia de cantidades crecientes de los
ARNs ARE-sentido o ARE-antisentido.
65
Resultados
Las proteínas que reconocen al ARE presentan una localización subcelular
diferencial.
La localización de eAREBP y tAREBPs se
analizó por geles de retardo al igual que para los
complejos de unión al GRE. Este experimento
mostró que eAREBP es totalmente citoplasmática
A
o que estaría accesible para reconocer al ARE en
el citoplasma y no en el núcleo (Figura 20A),
B
T
C
N
P
PS
eAREBP
Polisomas
-
ARNAsa A
mientras que las proteínas tAREBPs se
encuentran en cantidades similares en ambos
+
eAREBP
compartimientos (Figura 20C). Algunas de las
proteínas que reconocen al ARE en otros tipos
celulares presentan localización polisomal, y esta
particular ubicación estaría relacionada con su
capacidad para modular la traducción (Nagy and
Rigby, 1995; Winstall et al., 1995; Zhang et al.,
1993). Como se describió anteriormente (Figura
15), el elemento ARE regula en forma positiva la
ARN libre
C
T
C
N
tAREBPs
traducción en el estadío epimastigote. De esta
manera, se intentó analizar si eAREBP, una
proteína citoplasmática (Figura 20A), se encuentra
asociada con polisomas. Para ello se prepararon
polisomas del estadío epimastigote como se
describió previamente (Gonzalez and Cazzulo,
1989). Después de la preparación y centrifugación
a través de un colchón de sacarosa, el
sobrenadante se guardó como fracción
postribosomal (PS) y el “pellet” como polisomas
(P). Todas las fracciones preparadas, incluyendo
citoplasma (C) y núcleo (N), se analizaron en geles
de retardo. Como se observa en la Figura 20A, la
preparación polisomal tiene algo de actividad de
unión, pero es de alrededor del 5% de la actividad
de la fracción citoplasmática. De esta manera,
para determinar si la falta de una banda de
retardo intensa en la fracción polisomal, se debe
a la presencia de ARN ricos en Uridina, los cuales
pueden actuar como competidores secuestrando
parte de eAREBP, el extracto fue pre-tratado con
ribonucleasa A (ARNasa A) como se describió
previamente (Akhtar et al., 2000). Luego del
tratamiento con la nucleasa, esta fue inactivada
antes de la reacción de unión “in vitro” al ARE
(Figura 20B). Los resultados observados
66
Figura 20 - eAREBP reconoce el
elemento ARE en el citoplasma,
mientras que las proteínas tAREBPs
están localizadas en núcleo y
citoplasma. A, Localización subcelular
de la proteína eAREBP según se
determinó por incubación de extractos
proteicos con el ARN marcado ARE y
resuelto en un gel de retardo nativo.
Parásitos del estadío epimastigote fueron
lisados y separados en fracciones: total
(T), conteniendo núcleos (N), citoplasma
(C), polisomas (P) y sobrenadante
postribosomal (PS). Se utilizaron las
fracciones del extracto proveniente del
mismo número de parásitos (10x106),
para los ensayos de interacción ARNproteína. B, El extracto polisomal (P) del
estadío epimastigote se pre-trató (+) o no
(-) con ARNasa A durante 15 min. a
temperatura ambiente e inactivado por
el agregado de RNAsin antes de la
incubación con el ARN. Los complejos
formados fueron resueltos en un gel
nativo 7%. C, Localización subcelular de
las proteínas tAREBPs determinada a
partir de una reacción de unión “in vitro”
entre fracciones total (T), nuclear (N) y
citoplasmática (C) de un extracto del
estadío tripomastigotes derivado de
células y el ARN ARE.
Resultados
demuestran que luego del tratamiento, la unión de eAREBP al ARE en la fracción polisomal
incrementa alrededor de 4 veces, en comparación con el control sin tratamiento con
nucleasa (Figura 20B). Esto sugiere la existencia de algún ARN competidor en la fracción
polisomal, el cual podría estar reclutando eAREBP. Como se observa también en la figura,
la sonda de ARN permanece intacta luego de la reacción con el extracto, descartándose
así la presencia de alguna nucleasa asociada a polisomas que degrade al ARE. En resúmen,
eAREBP es principalmente citoplasmática y está parcialmente asociada a polisomas,
mientras que las proteínas tAREBPs están localizadas tanto en núcleo como en citoplasma.
Especificidad de unión a ARN de la proteína eAREBP.
Para deter minar la
mínima porción reconocida por
A
eAREBP en el ARN SMUG-LARE, se sintetizaron cuatro
ARN
Secuencia
SMUG-L-ARE
AAUUUUAAAAUUUAUUUAAUGUUGUUUUGAUUUAUUUAUUUUAA
AUUUUAUUUUUAUUUUUA
P1
GUUUUGUUUUUGUUUUUG
P2
AUGUUGUUGUUGUUGUUG
fueron utilizadas en reacciones
de unión “in vitro” y análisis por
P3
AUGGUGUUGGUGUUGGUG
P4
AUAUUAUUAUUAUUAUUA
retardo en gel. La interacción
de eAREBP con SMUG-L-ARE,
se reduce cuando dos motivos
AUUUUUA de sus extremos se
remueven, como es el caso del
oligo SMUG-L-ARE-1 (Figura
21B),
demostrando
importancia
en
su
el
reconocimiento por eAREBP.
Además, la unión al nonámero
B
PLC-ARE
muestran las secuencias de
ARNs correspondientes que
SMUG-S-ARE
AUAUAUAUAUAUAUAUAUAUAUAUUUAUUU
SMUG-S-ARE
SMUG-L-ARE-2
AUUUAUUUAUUUA
PLC-ARE
HEX-T-ARE
UUUUAUUUAUUUU
HEX-T-ARE
SMUG-L-ARE
UUAUUUAUU
SMUG-L-ARE-3
ARNs diferentes derivados de
éste. En la Figura 21A se
SMUG-L-ARE-1
AUUUAUUUAAUGUUGUUUUGAUUUAUUUAUU
SMUG-L-ARE-3
SMUG-L-ARE-1
SMUG-L-ARE-2
S
P1 P2
P3 P4
eAREBP
Figura 21 – Especificidad de unión a ARN de eAREBP. A, Se
muestra una lista de los ARNs utilizados en los geles de retardo
del panel B. B, Ensayos de retardo en gel entre sustratos de ARN
y extractos totales del estadío epimastigote. La posición de la
proteína eAREBP se indica con una flecha a la izquierda del panel.
La incubación del ARN con el buffer de reacción en ausencia del
extracto proteíco, no mostró banda de retardo alguna (resultado
no mostrado).
UUAUUUUAUU (SMUG-LARE-2) sólo se detecta cuando
la película se sobre-expone (resultado no mostrado). La interacción con el sustrato
ribonucleico incrementa levemente cuando se adicionan dos Uridinas más en cada uno
de sus extremos (SMUG-L-ARE-3). Entonces, el nonámero no es la secuencia mínima
requerida para la unión, como sucede con proteínas de unión a elementos ARE de otros
tipos celulares. Aunque esta interacción es poco eficiente, puede incrementarse si el
mismo está localizado en un contexto rico en Uridina (Figura 21B). Otras secuencias del
tipo ARE se encuentran en las regiones 3’-NC del parásito, como el grupo S de la familia
TcSMUG (SMUG-S-ARE), el transportador de hexosa (HEX-T-ARE) y la fosfolipasa-c (PLCARE) (ver Tabla 2). Por lo tanto, también se evaluó la capacidad de eAREBP de interaccionar
con estos diferentes motivos ARE. Luego de realizar ensayos de retardo en gel, concluímos
que de las tres secuencias ARE, eAREBP sólo reconoce el ARN SMUG-S-ARE, presente
en la region 3’-NC del grupo de mucinas TcSMUG-S (Figura 21B).
67
Resultados
Estos resultados demuestran que eAREBP se une en forma selectiva a alguna de
las regiones ARE evaluadas y claramente reconoce secuencias ricas en Adenosina y
Uridina de los transcriptos de mucina TcSMUG-L y -S, los cuales contienen motivos
AUUUA, AUUUUA y AUUUUUA (Figura 21A). A partir de la secuencia del ARN SMUG-SARE, se sintetizaron 4 ARNs derivados y denominados P1, P2, P3 y P4 (ver Figura 21A)
con el objetivo de evaluar más en detalle la afinidad y especificidad de la interacción
ARN-proteína. Por un lado, eAREBP reconoce fuertemente P1, así como el ARN SMUG-SARE. Por otro lado, los ARNs P2 y P4 también son reconocidos aunque más levemente,
mientras que P3 no es sustrato de eAREBP (Figura 21B).
Purificación parcial de la proteína eAREBP.
El objetivo siguiente fue caracterizar e identificar la secuencia de la proteína
eAREBP. Para ello, se realizaron una serie de pruebas bioquímicas para determinar cual
es la mejor combinación de pasos que nos permitieran obtener la banda de ~100kDa
relativamente pura para un análisis de secuencia o espectrometría de masa. Sólo nos
remitimos a la caracterización de ésta proteína, ya que se pueden obtener grandes
cantidades de parásitos sólo del estadío epimastigote en cultivo. A diferencia, la
purificación de las proteínas tAREBPs requiere parásitos de los estadíos tripomastigote
y/o amastigote intracelulares, difíciles de obtener en grandes cantidades.
Varios pasos cromatográficos se ensayaron en colaboración con el Dr. Marcelo
Guerin (IIB-UNSAM), quien fue de gran ayuda para la elaboración de un criterio adecuado
de purificación. Las columnas evaluadas fueron: A) Cromatografías de Intercambio Iónico:
DEAE, Mono Q y Mono S; B) Cromatografía de Filtración en gel: BioSil SEC-250; C)
Cromatografía de Hidrofobicidad, Fenil-Sefarosa; D) Cromatografía de afinidad: poli(U)
Sefarosa y Heparina. El protocolo preparativo final para la purificación se indica en la
Figura 22 y fue el siguiente:
1-Cromatografía de intercambio catiónico, DEAE.
Luego de varias pruebas analíticas y preparativas con distintas cantidades de
parásitos, se decidió comenzar la purificación a partir de 100gr. peso húmedo de
epimastigotes de T. cruzi (Figura 22A). El extracto se preparó de acuerdo a las indicaciones
descriptas en Materiales y Métodos. En resumen, los parásitos se resuspendieron en
500 ml de “buffer” de lisis y el extracto resultante se clarificó por ultracentrifugación a
100.000g. El sobrenadante se sembró en una columna DEAE equilibrada con “buffer”
Tris-HCl 20 mM pH 7.6. Para la elución de las proteínas retenidas en la matriz, se realizó
la elución con un gradiente salino de 0-1 M NaCl en “buffer” Tris-HCl 20 mM pH 7.6.
Luego de la elución, se tomaron 10 μl de cada fracción y se midió la capacidad de cada
una de reconocer la ribosonda ARE en un ensayo de retardo en gel (Figura 22B). La
actividad de eAREBP se detectó entre las fracciones 35 y 47 (Figura 22B), correspondiente
a una concentración de NaCl ~250mM. Estas fracciones se juntaron (“pool” ~50 ml), y el
mismo se diluyó 1/10 en “buffer” MES 50 mM pH 6.2, de manera tal de alcanzar el pH
adecuado y una concentración salina de ~30 mM acorde a los requerimientos del paso
siguiente de purificación.
68
Resultados
A
Extracto epimastigotes (~500 ml)
B
NaCl
Fracciones de elucion
Pool
Ex P 1517 19 2123 25 27 29 31 33 35 37 3941 4345 47 49
DEAE Sefarosa
Elucion: 0-1 M NaCl
Heparina HYPER D
C
NaCl
Elucion: 0-1 M NaCl
Mono S
Ex
Fracciones de elucion
Pool
P 2 4 6 8 10 12 14 1618 20 22 24 26 28 30 32 34
Elucion: 0-0.5 M NaCl
Fenil Sefarosa
NaCl
D
Elucion: 1-0 M (NH4) SO
2
Fracciones de elucion
4
Pool
Ex P 1 2 3 4 5 6 7 8 9 10 11 12 13 14 151617 1819
SDS-PAGE
Tincion Coomasie
Blue
UV cross-linking
E
(NH4)2 SO4
Fracciones de elucion
Pool
Ex 20 21 22 23 24 25 26 27 28 29 30 3132 3334 35 36 37
Figura 22 - Esquema de los pasos bioquímicos utilizados en la purificación de eAREBP. A,
Se utilizó un extracto total de proteínas proveniente de 100 gr de parásitos del estadío
epimastigote, el cual fue resuspendido en buffer hipotónico conteniendo Chaps 0.5%. Los pasos
utilizados para la purificación fueron: B, DEAE Sefarosa, C, Heparina, D, Mono S y E, Fenil
Sefarosa. Cada una de las fracciones provenientes de percolado y la elución de las matrices
fueron utilizadas para medir la actividad de unión de eAREBP al ARN ARE marcado con [α32P]UTP. Para ello, 10 μl de cada fracción se incubaron con el ARN y las reacciones se resolvieron
utilizando geles de retardo nativos de poliacrilamida. Las fracciones que forman parte del “pool”
obtenido luego de la elución en cada paso se muestra encima de los paneles.
2-Cromatografía de afinidad, Heparina.
Como segundo paso de purificación, se utilizó una columna de Heparina, ya que
es un polianión y generalmente su estructura es útil para purificar proteínas de unión a
ácidos nucleicos y/o proteínas con una alta carga positiva. El “pool” de elución de la
columna DEAE Sefarosa, se sembró en la columna de afinidad Heparina HyperD
(BioSepra), previamente equilibrada en “buffer” A (MES 50 mM pH 6.2), en forma manual
utilizando una bomba peristáltica y un flujo de 3 ml/min. Luego de lavar y eluir con el
“buffer” B (MES 50 mM pH 6.2, 1 M NaCl) haciendo un gradiente salino entre 0-1 M
NaCl, se midió la actividad en geles de retardo. Como se observa, eAREBP eluyó entre las
fracciones 8-14 (Figura 22C).
69
Resultados
3-Cromatografía de intercambio aniónico, Mono S.
El “pool” de la columna Heparina (~10ml) se diluyó nuevamente 1/10 en el mismo
“buffer” MES hasta alcanzar una concentración salina baja de alrededor 25 mM NaCl.
Este “pool” se cargó en una columna Mono S y otra vez el gradiente se realizó con el
“buffer” indicado variando la concentración salina entre 0-0.5 M NaCl. La actividad se
identificó a partir de retardo en gel nativo en las fracciones 7-11 (Figura 22D).
4-Cromatografía de hidrofobicidad, Fenil Sefarosa.
El cuarto y último paso de purificación fue una columna de hidrofobicidad. Para
tal paso, el “pool” de la Mono S (~7ml), se diluyó en “buffer” Tris-HCl 20 mM pH 7.6 y en
presencia de Sulfato de Amonio 1 M. La elución se realizó en un gradiente descendiente
de concentración de Sulfato de 1 a 0 M, utilizando un “buffer” Tris-HCl 20 mM pH 7.6 5% Sacarosa. La actividad de unión al ARE disminuye un poco en comparación con el
paso anterior, porque el Sulfato de Amonio interfiere con la reacción de medición. De
todas maneras, el pico de actividad se detectó entre las fracciones 25-30 del gradiente,
aproximadamente 0.25 M de sal, pero con mayor actividad en la calle 27 (Figura 22E).
5-Identificación de eAREBP en geles de SDS-PAGE como una banda de ~100kDa.
A partir de las fracciones con actividad de la columna de hidrofobicidad se realizó
un gel SDS-PAGE 7.5%, el cual se tiñó con “Coomasie-Blue” para identificar bandas
proteicas (Figura 23A). En este gel se observó una banda prominente de ~100kDa entre
las fracciones 25-30 y especialmente en la calle 27 (Figura 23A). En el gel de retardo de
la Figura 22E se observa que la actividad de unión al ARE también aparece en tales
fracciones, especialmente en la número 27.
Espectrometría de masa MALDI-TOF e identificación de un homólogo putativo en
células eucariotas superiores.
Luego de la identificación de la banda de ~100kDa correspondiente a eAREBP
(Figura 23A), las fracciones con actividad se mezclaron y se las dividió en dos partes.
Ambas partes se resolvieron por electroforesis en gel de poliacrilamida desnaturalizante
SDS-PAGE 7.5%, en presencia del “buffer” Caps pH 10 (ver Materiales y Métodos). Una
parte (50%) se transfirió a una membrana de PVDF. La banda identificada, fue cortada y
enviada al Dr. Ulf Hellman (Uppsala University) para el análisis del N-terminal por la
reacción de Edman. A partir de éste análisis no se pudo obtener secuencia de aminoácidos,
ya que la región N-terminal de la proteína estaba bloqueada. La segunda parte de la
muestra (50%) se cortó del gel SDS-PAGE para su digestión con tripsina. Los productos
provenientes de la digestión tríptica fueron analizados por espectrometría de masa por
MALDI-TOF y la masa de los péptidos protonados obtenidos (Figura 23B) se utilizó para
buscar en la base de datos no redundante PROFound. Dentro de la lista de “hits”, el
primero correspondió a una proteína de unión a ARN de Mus musculus, denominada
DEF3. La única particularidad de esta proteína es que está ausente en un tipo de cáncer
de pulmón (Drabkin et al., 1999). Aunque se describió que reconoce poli(G) “in vitro”, no
existen evidencias que indiquen su función “in vivo”. En la Tabla 3 se listan los péptidos
70
Resultados
compartidos entre las proteínas DEF3 y eAREBP, y sus respectivas masas medias y
diferencias en masas moleculares computadas.
A
kDa
114
Pool
24 25 26 27 28 29 30 31 32
eAREBP
97
66
Figura 23 - Identificación de eAREBP
como una proteína de ~100kDa y
análisis por espectrometría de masa
MALDI-TOF. A, Gel SDS-PAGE teñido con
Coomasie Blue e identificación de
eAREBP como una proteína de 100kDa
en la fracción 27. El asterisco indica la
posición de bandas proteicas que copurifican con eAREBP. B, Espectro de
masas de la proteína eAREBP digerida con
tripsina. Se indican las masas (Daltons)
correspondientes a los péptidos utilizados
en la búsqueda en la base de datos
PROFound (ver en Tabla 3 la lista de los
péptidos).
*
45
B
cuentas
16000
14000
12000
10000
8000
6000
4000
2000
800
1000
1200
1400
1600
1800
m/z
Masa Media
790.373
1002.470
1054.362
1103.422
1149.464
1188.480
1214.434
1288.541
1333.564
1364.499
1493.534
1633.625
Masa
Computada
790.419
1002.553
1054.446
1103.531
1149.589
1188.588
1214.542
1288.531
1333.583
1364.656
1493.638
1633.758
Residuos
desde
a
949
955
729
738
273
281
603
611
588
597
167
176
282
291
97
108
149
158
986
996
435
446
936
948
Error (Da)
-0.046
-0.083
-0.084
-0.110
-0.124
-0.108
-0.107
0.009
-0.018
-0.157
-0.103
-0.133
Secuencia
LACLLCR
MVAVNLATGK
EVGPCMEFK (1)[email protected]
KRDEGQESR
QPNQPRPADK
SRDVPPTDFR
DREMPPMDPK
GGDFSSSDFQSR
ETPHMNYRDR (1)[email protected]
QSEQELAYLER
DAQQDLQDQDYR
KENEDDKLTDWNK
Tabla 3 - Identificación de péptidos en eAREBP idénticos a la proteína de unión a ARN de
mamíferos DEF-3. Se muestra la secuencia de los péptidos compartidos entre eAREBP y la
proteína DEF3 de Mus musculus, así como también las masas moleculares de los péptidos de
DEF3 (Daltons) y las diferencias (<1 Dalton) con los péptidos de eAREBP. Péptidos medidos: 43;
Péptidos iguales: 12; Cobertura mínima de secuencia (12%).
Clonado de earebp con el uso de oligos degenerados sintetizados a partir de los
péptidos identificados por espectrometría de masa.
Con el objetivo de clonar earebp, se sintetizaron varios juegos de oligos degenerados
(ver sección Anexo II) a partir de la secuencia de los péptidos compartidos entre eAREBP
y el putativo homólogo DEF3 (ver Figura 24).
A partir de la posición de los oligonucleótidos en la secuencia de DEF3 (Figura
24), se procedió a combinarlos para realizar ensayos de PCR. De esta manera, se clonaron
71
Resultados
varias bandas de amplificación, las cuales presentaban tamaños lógicos según la posición
y distancia de los oligonucleótidos en DEF3 (ver Figura 24). Sin embargo, ninguna de las
bandas que se secuenció presentó identidad con ésta proteína. Alternativamente, se
buscó en diferentes bases de datos con información sobre el proyecto de secuenciación
del genoma de diversas especies de tripanosomas, pero tampoco se encontró algún clon
con identidad apreciable con la proteína murina DEF3.
1
MWGDSRSANRTGPFRGSQEEGFAPGWNRDYPPPPLKSHARERHSGNFPGRDSLPFDFQGHSGPPFANVEEHSFSYGGR
81
PHGDYQGGEGPGHDFRGGDFSSSDFQSRDSAQLDFRNRDIHSGDFRDREGPPMDYRGGDGTHMDYRGRETPHMNYRD
160
SHTVDFRSRDVPPTDFRGRGTYDLDFRGREGSHSDFRGRDLSDLDFRSRDQSRSDFRNRDVSDLDFRDKDGTQVDSRG
241
ATTDLDFRNRDTPHSDFRGRHRTRTYQDFRGREVGPCMEFKDREMPPMDPKVLDYIQPSPQEREHSGMNMNKREESI
320
MERPAFGVQKGEFEHSETREGETQSGTFEHESQSDFQNSQSPVQEQDKPKLSGGEQQSSDAGLFKEEGDLDFLGQQD
400
RSIEYCDVDHRLPGNQIFGYGQSKSFSQGKMSRDAQQDLQDQDYRTGPSEEKPNRLIRLSGVPENATKEEILNAFRTSDG
477
KDLQLKEYNTGYDYGYVCVEFSLLEDAIGCMEANQGTLMIHDKEVTLEYVPSPDFWYCKRCKASTGGHQSSCSFCKGPK
555
KQELVSYPQPQKTSIPVPSEKQPNQPRPADKEHELRKRDEGQESRLGHQKRDTDRYFPHSRREGLTFRRDREKEPWSG
632
GESKTIMLKRIYRSTPPEVIVEVLEPCVHLTTANVRIIKNRTGPMGHTYGFIDLDSHAEALRVVKILQNLDPPFSIDGKMVAVN
705
GKRRNDSGDHSDHMHYYQGKKYFRDRRGGNRNSDWSSDTNRQGQQSSSDCYIYDSTTGYYYDPLAGTYYDPNTQQEVY
786
PQDPESPDEEEIKEKKSTSQGKSNSKKETSKRDGKEKKDRGMTKFQESTSEGKPPLEDVFKKPLPPTVKKEESPPPPKVV
864
LIGLLGEYGGDSDYEEEEEEEQAPPVQPQPQPREEMTKKENEDDKLTDWNKLACLLCRRQFPNKEVLTKHQQLSDLHK
942 IHRKIKQSEQELAYLERREREGRFKEKGNDRREKLQSFDSPERKRIKYSRETDSDRNPVDKEDTDTSSKGGCAQQATGWR
1020 AGLGYSHPGLGSSEEIEGRMRGPGGGPPGRTSKRQSNETYRDAVRRVMFARYKEL
Peptidos con masa molecular identica a DEF3 segun analisis por MALDI-TOF.
Cebadores utilizados en reacciones de PCR para clonar earebp.
Figura 24 - Secuencia de la proteína DEF3 y los oligonucleótidos utilizados para
clonar earebp. Esquema en donde se muestra la secuencia de DEF 3 de Mus musculus
y la posición de los oligonucleótidos de ADN utilizados para clonar earebp. Ver Tabla en
la Sección Anexo para la secuencia de cada oligonucleótido sintético.
72
Resultados
PARTE 4 - Estructura y función de proteínas de unión a ARN (TcUBPs).
Con el objetivo de encontrar otros factores que actúen en trans- sobre el ARE del
ARNm de TcSMUG-L, se realizó un enfoque alternativo al de la purificación de proteínas.
Se buscaron secuencias putativas que codifiquen proteínas de unión a ARN en las bases
de datos de EST y GSS del proyecto de secuenciación del genoma de T. cruzi. El rastreo
se realizó en la base de datos del NCBI utilizando como entrada la secuencia en
aminoácidos de la proteína de unión a ARE de eucariotas superiores HuR (Fan and
Steitz, 1998). Este factor funciona en el camino de estabilización de ARNms conteniendo
AREs en sus regiones 3’-NC (Fan and Steitz, 1998). Durante la búsqueda de nuevos
genes, se identificó una secuencia que presentaba homología con HuR (EST TENG0035).
Para clonar en forma completa su ADNc, se realizó una reacción de RT-PCR con ARN
total del estadío epimastigote y un cebador que se une a una región conservada en las
proteínas de unión a ARN del tipo RRM, llamado RNP-1 (ver más adelante). Para la
primer reacción de PCR se utilizó el cebador RNP-2 antisentido, el cual se une río arriba
del RNP-1 y la secuencia del SL del extremo 5’-terminal. Para esta reacción se tomó
ventaja del hecho de que todos los ARNms de T. cruzi presentan el SL en su región 5’,
agregado por una reacción de trans-“splicing” (ver Introducción). A partir de este ensayo
se identificaron en geles de agarosa teñidos con bromuro de etidio un conjunto de bandas
de entre 200-300 pbs, el tamaño esperado en esa región para el ADN del EST TENG0035.
Estos fragmentos se clonaron en el vector pGEM-T Easy. El análisis de la secuencia de 6
clones demostró que 4 eran 100% homólogos a TENG0035, sin embargo otros 2 clones
presentaban una región N-terminal levemente diferente y más pequeña.
En segundo lugar, se realizó otra reacción de RT-PCR para clonar los extremos 3’de ambas secuencias. Para ello se utilizó ARN total del estadío epimastigote y el cebador
oligo(dT) -ancla. Luego, para la reacción de PCR se utilizó el cebador ancla y cebadores
18
que se unen a las regiones N-terminal de los clones identificados (ver Materiales y Métodos).
Finalmente, dos bandas de tamaños de ~1000 y ~800 pbs fueron identificadas (resultado
no mostrado) y se llamaron Tcubp-1 y Tcubp-2 respectivamente, por T. cruzi “Uridinerich binding protein”, debido a su identidad con proteínas que unen elementos ricos en
Uridina de otros tipos celulares. En la Figura 25 se muestra una comparación de los
esquemas de ARNms deducido a partir de la secuencia de los ADNc de Tcubp.
Comparación entre Tcubp-1 y Tcubp-2.
El análisis de las secuencias provenientes de los clones completos Tcubp-1 y Tcubp-
2, demostró lo siguiente: el ADNc de Tcubp-1 está compuesto por 1017 pbs, mientras
que Tcubp-2 presenta sólo 854 pbs. El ARNm de Tcubp-1 es más largo que Tcubp-2,
tanto en la región codificante como en las regiones no codificantes (Figura 25A). El marco
abierto de lectura es la única porción de los ARNms que presenta una gran identidad
entre ambos clones (~70%), y de esta región, las porciones con menor identidad son las
que codifican los extremos N- y C-terminales. En cuanto a las regiones no codificantes,
se observa que son muy diferentes. Sólo 37% de identidad se detecta en la región 3’-NC,
mientras que no existe identidad alguna en la región 5’-NC (Figura 25A).
73
Resultados
Estructura de los productos deducidos de Tcubp-1 y Tcubp-2.
TcUBP-1, está compuesto por 225 aminoácidos y presenta una región N-terminal
de 34 aminoácidos la cual es rica en Glutamina (Figura 25). Esta región es seguida por
el dominio de unión a ARN o RRM, compuesto por ~92 aminoácidos, el cual presenta los
motivos característicos llamados
RNP1 y RNP2. RNP2 es un
A
5'NC
marco abierto lectura
3'NC
SL
poli-(A)
Tcubp-1
hexapéptido presente en la hoja-β1
y RNP1 es un octapéptido localizado
-----------
67 nt
(0%)
SL
(70%)
ter minal del motivo RRM, que
generalmente presenta funciones
regulatorias en términos de afinidad
y estabilización de la unión con el
ARN (Avis et al., 1996; DeMaria et
al., 1997), está compuesta por 14
aminoácidos ubicados a 8 residuos
después de la hoja-β4 (ver Figura 25).
RNP-2
Tc UBP-1
Tc UBP-2
1
1
RNP-1
en Glicina, por lo cual se la denominó
región rica en Glicina. Como
característica particular, también se
destaca la presencia de residuos de
T irosina distribuídos en for ma
periódica entre las Glicinas (Figura
β2
β3
α2
Tc UBP-1 51 PTTVDEVQLRQLFERYGPIESVKIV C DRET RQSRGYGFVKFQSGSSAQQA
Tc UBP-2 37 PTTVDEVQLRQLFERYGPIESVKIV C DRET RQSRGYGFVKFQSGSSAQQA
α2
β4
Gli
RV
Tc UBP-1 101 IAGLNGFNILNKRLKVALAASGHQR --P G IAGAV G DGN GY L G A YGGYGAY
Tc UBP-2 87 IAGLNGFNILNKRLKVALAASGHQR NRN G VSTGF G AYG GY - G G YGGYGAY
Gln
Tc UBP-1 146 AYPS A ANPYAQQ QMM A M YQQ YMM QAPQQTPHQGQQQQMPLPSHPQQQSP P
Tc UBP-2 132 AYPS A ANPYAQQ QMM T M QHP YMM T------------------------- -
Tc UBP-1 196 QQQ Q QS PS S P Q Q QPQSQQQSQAARPVRR
Tc UBP-2 158 --- Q SV PS V P R Q ---------------Dominio Auxiliar
C
RRM
TcUBP-2
de ellos está compuesto por 16
aminoácidos con un alto contenido
MSQIPLVSQYDPYGQTA Q L Q QLQQQ QQ QHIP P T QMNPEPD V LRNLMVNYI
--------------MSQ Q M Q YYAPR QQ LQQA P A QMNPEPD L LRNLMVNYI
α1
identidad alguna con la misma
porción en TcUBP-2 (ver más
adelante). Hacia el C-terminal, se
TcUBP-1, este dominio se puede
dividir en dos módulos, el primero
-----------
210 nt
β1
TcUBP-1
generalmente sirve para la
interacción con otras proteínas. En
poli-(A)
-----------
501 nt
B
Esta región se llamó RV, por Región
Variable, ya que no presenta
observa el dominio auxiliar de las
proteínas de unión a ARN, que
(37%)
Tcubp-2
143 nt
en la hoja-β3, en todas las proteínas
con motivos RRM. La región C-
345 nt
638 nt
35
0
0
20
RV
RNP2
RNP1
RNP2
RNP1
Gli
126 140
112 121
Gln
157
225
144 167
Figura 25 - Tcubp-1 y Tcubp-2, codifican polipéptidos
con identidad a proteínas de unión a ARN. A,
Representación esquemática de los ARNms Tcubp,
deducida de la secuencia de los ADNc. SL, “spliced leader”.
El largo de cada región (marco abierto de lectura y regiones
no codificantes 5’ y 3’) se indica en nts debajo de cada
esquema. El porcentaje de identidad entre cada una de
las regiones para los dos esquemas comparados se muestra
entre paréntesis. B, Comparación de las proteínas TcUBPs
derivada de la secuencia del ADNc. El alineamiento se
realizó utilizando el programa Clustal W (Thompson et
al., 1994). Se indican los diferentes dominios: RV, región
variable; Gli, región rica en Glicina; Gln, región rica en
Glutamina y los octapéptidos RNP-2 y el hexapéptido RNP1 dentro del dominio RRM. La predicción de la estructura
secundaria, mostrando las hélices α y hojas β, se determinó
utilizando el Software Protein Prediction según: (http://
www.embl-heidelberg.de/). C, Esquema de las proteínas
TcUBPs mostrando los diferentes módulos identificados:
RRM, dominio de unión a ARN; RV, región variable; Gli y
Gln.
25B). El segundo módulo, está compuesto por ~68 aminoácidos y se caracteriza por su
alto contenido en Glutamina (~45%). A partir de programas que determinan la estructura
secundaria, se predice que es una región sin estructura o “random-coil” (ver más adelante).
TcUBP-2 está compuesto por 167 aminoácidos y al igual que TcUBP-1 presenta
una región N-terminal corta compuesta por 20 aminoácidos, y rica en Glutamina (45%
de los residuos). El dominio RRM (~92 aminoácidos) presenta los motivos conservados
RNP1 y RNP2, y es 98% idéntico al de TcUBP-1, con un cambio en una sola posición y
74
Resultados
localizado antes de la hoja-β1 (Figura 25B). Nuevamente, el C-terminal del RRM o región
RV está compuesta por sólo 8 aminoácidos en comparación con la de TcUBP-1 que
presenta 14 aminoácidos. Como se mencionó anteriormente, existe una muy baja
identidad en esta región entre ambas proteínas. Finalmente, el extremo C-terminal está
también compuesto por una región rica en Glicina, más larga que la de TcUBP-1 y con
motivos YGG solapados. Este dominio auxiliar del C-terminal carece de la región rica en
Glutamina observada en TcUBP-1 (Figura 25).
Tcubp-1 y Tcubp-2 son genes de copia única por genoma haploide y pertenecen a
una familia de genes que codifica para proteínas con motivos RRM.
Con el objetivo de determinar el número de copias de Tcubp-1 y Tcubp-2 presentes
en el genoma de T. cruzi se llevaron a cabo ensayos de “Southern blot” (Figura 26). Se
realizaron hibridizaciones en condiciones de alta rigurosidad (65ºC y 20 mM NaH PO ),
2
4
utilizando ADN genómico del clon CL-Brener digerido con varias enzimas de restricción
y sondas de ADN correspondientes a las secuencias presentes en la región N-terminal de
TcUBP-2 y dominio de unión a ARN (RRM) de
A
y la hibridización con la sonda común (RRM)
muestra el doble de bandas en algunas calles. Estos
resultados sugieren que ambos clones están
presentes en una copia por genoma haploide (Figura
26B). A partir de un ensayo de “Southern blot”
utilizando la sonda RRM en condiciones de baja
rigurosidad (55ºC y 200 mM NaH PO ), se
2
4
detectaron varias bandas (resultado no mostrado).
Estos resultados indican que si bien Tcubp-1 y
Tcubp-2 son genes de copia única, pueden formar
parte de una familia de genes cuyos miembros
presentan mayor identidad en la porción que
codifica para el dominio RRM. La diversidad de esta
familia es objeto de estudio del estudiante Javier
De Gaudenzi, quien actualmente se encuentra
realizando el Doctorado en el laboratorio del Dr.
Frasch. El análisis preliminar de la familia que
codifica proteínas de unión a ARN del tipo-RRM
indica que está compuesta por varios miembros.
Hasta el momento, se identificaron y clonaron 6
genes que codifican para proteínas del tipo-RRM
en el parásito.
75
Hc
1
Ha
NH2
diferente entre ambos clones, mientras que la sonda
RRM es capaz de reconocer ambos clones. Como
Ha
501
Hc: HincII
Ha: HaeIII
NH2-RRM
Kpb
23.1
9.4
6.6
4.3
9.4
6.6
4.3
2.3
2.0
2.3
2.0
1.4
1.4
NH2
HincII
EcoRI
PstI
Kpb
23.1
DdeI
HaeIII
B
EcoRI
PstI
DdeI
se observa, la hibridización con la región N-terminal
de Tcubp-2 demuestra un bajo número de bandas,
RRM
NH2
TcUBP-2
HaeIII
HincII
TcUBP-2 (Figura 26A). La primer sonda permite ver
sólo a TcUBP-2, porque la región N-terminal es
NH2-RRM
Figura 26 - Tcubp-1 y Tcubp-2 son
genes de copia única. A, Esquema del
ARNm de Tcubp-2 y sus distintos
dominios: NH 2 y RRM. Se indica la
posición en la que cortan las enzimas
de restricción HincII (Hc) y HaeIII (Ha),
así como también la posición de cada
una de las sondas de ADN sintetizadas
(NH2 y NH2-RRM). B, Ensayo de “Southern blot” realizado sobre ADN genómico
del clon CL-Brener de T. cruzi digerido
con las enzimas de restricción que se
indican e hibridizados con las sondas:
NH2 y NH2-RRM de TcUBP-2.
Resultados
Tcubp-1 y Tcubp-2 se expresan en un mismo ARN de tamaño mayor que el esperado
para el ARNm maduro.
Al realizar un ensayo de “Northern blot” con sondas que reconocen específicamente
Tcubp-1 y Tcubp-2 se observaron resultados no esperados. En primer lugar, ambas
sondas dan señal a una altura mucho mayor (~5.5 kb) que la del tamaño esperado para
los ARNms Tcubps (~1 kb). En segundo lugar, ambas sondas colocalizan a la misma
altura (Figura 27A). A pesar de que los ARNms maduros para ambos genes existen, ya
que se clonaron bandas de RT-PCR realizadas con oligo-(dt) y SL (ver Materiales y Metodos),
es posible sugerir que existe un transcripto dicistrónico que contiene Tcubp-1 y Tcubp2. Además, en ensayos de inhibición de la transcripción con ActD se observa que el
transcripto es estable (Figura 27B). A partir del rastreo de una biblioteca de cósmidos, el
Lic. J. De Gaudenzi identificó (Figura 27C) y secuenció dos cósmidos que presentan
ambos genes separados por una región intergénica de ∼3 kpb (ver mapa en Figura 27D).
A
B
NH2
Sonda TcUBP-1
C
ActD
2
6
NH2
TcUBP-2
RRM
dicistron
TcUBP-2/-1
Kb
Tiempo (hrs)
0
8
0
CHX / ActD
2
6
8
dicistron
5.5 TcUBP-2/-1
TcUBP-1
TcUBP-2
2.4
2.0
1.5
RRM
Tcubp-2
pA
ag
pA
0.55 Kbp
Hc
TcUBP-2
NH2
TcUBP-1
Nh2
TcUBP-1
Cooh
Sonda
ag
TcUBP-1
NH2
TcUBP-2
D
2.8 Kbp
Hinc II
8 23
Kb
TcUBP-1
TcUBP-2
pA
Hinc II
8 23
5.5
24S α
24S β
18S
2.4
2.0
1.5
24S α
24S β
18S
Hinc II
Cosmido 8 23
0.65 Kbp
2.5 Kbp
Hc
E
Hc
Tcubp-1
2. Kbp
Referencias
pPy
Hi S Hc
tractos
GAAAA
Figura 27 - Un dicistrón estable contiene Tcubp-1 y Tcubp-2. A, Ensayos de “Northern blot” hibridizados
con la sondas RRM, N-terminal de TcUBP-1 y N-terminal de TcUBP-2 sobre filtros de ARN proveniente de
parásitos del estadío epimastigote. B, Ensayo de “Northern blot” realizado con la sonda RRM sobre filtros
de ARN del estadío epimastigote tratatos con ActD o CHX por 2 hrs y ActD. En el panel A y B se marca la
posición de los ARNr de T. cruzi. C, Ensayos de “Southern blot” realizados sobre los cósmidos aislados de
una biblioteca ordenada (8 y 23), conteniendo Tcubps, con sondas que reconocen específicamente las
porciones RRM, el N-terminal de TcUBP-1 y el N-terminal de TcUBP-2. D, Esquema donde se muestra la
posición de Tcubp-1 y Tcubp-2 en el genoma, según la secuencia de un cósmido de ADN de T. cruzi.
Identificación de ortólogos de las proteínas TcUBP en otros parásitos kinetoplástidos.
Para identificar ortólogos de las proteínas TcUBP en otros parásitos, las bases de
datos de EST y GSS de T. cruzi, T. brucei y Leishmania se rastrearon con la secuencia del
dominio RRM de TcUBP-1. Se identficaron cuatro secuencias nuevas con los números
de acceso al GenBank: AZ050633, AQ638822, AQ637856 y AQ654405. Estos clones
presentan una identidad de entre 35-50% en el dominio RRM, siendo los motivos RNP1
y RNP2 las regiones más conservadas entre todos los clones. Si la búsqueda se realiza a
partir de la página “web” del Centro Sanger de Secuenciación (http://www.sanger.ac.uk/
Projects) se detectan dos clones con alta identidad a TcUBP-1, (Números de Acceso al
76
Resultados
GenBank: AQ846565 de T. brucei y 0.15543 de Leishmania). La comparación de estas
dos secuencias con TcUBP-1 muestra una identidad ~70%, y nuevamente el dominio
RRM es la porción mas conservada entre las tres proteínas (resultado no mostrado).
Estos resultados sugieren que secuencias altamente idénticas a TcUBP-1 están
conservadas en diferentes especies de parásitos protozoarios.
Comparación entre las proteínas TcUBPs y sus homólogos en otros tipos celulares.
Con el objetivo de identificar secuencias idénticas a las proteínas TcUBPs en otros
organismos, se realizó una búsqueda en la base de datos del NCBI. A partir de éste
enfoque se detectan proteínas de unión ARN del tipo RRM de diversos organismos,
incluyendo Drosophila melanogaster, Triticum aestivum, Oryza sativa, Megaselia scalaria,
Gallus gallus, Homo sapiens y Arabidopsis thaliana , entre otros. Como se indicó
anteriormente, la región de mayor identidad es el dominio RRM. En células de eucariotas
superiores, el RRM se asemeja principalmente al descripto para las proteínas de la família
Hu de mamífero, U1A y Sxl de Drosophila (Figura 28).
RNP-2
RNP-1
TcUBP-1 35 - MNPEPDVLRNLM VN YIP TTVDEVQL R----QLFE R YGPIESVKIVCD RET RQ SRG YGFVKFQSGSSAQQAIA GLN GF NI L NKRLKV ALAASGHQRP
Sxl
117 - MNDPRASNTNLI VN YLP QDMTDREL Y----A LFR AIGPINTCRIMRD YKT GYSFG YAFVDFTSEMDSQRAIK VLN GITV R NKRLKV SYARPGGESI
HuD
32 --AATD DSKTNLI VN YLP QNMTQEEF R----SLFG SIGEIESCKLVRD KIT GQ SLG YGFVNYIDPKDAEKAIN TLN GLRL Q TKTIKV SYARPSSASI
U1A
1 M A VPET R PNHTIYIN NL NEKIKKDEL KKSLYA IFS Q FGQILDILVSRS LKM R - - -G QAFVIFKEVSSATNALRSMQ GF PF Y DKP M R I QYAKTDSDII
Figura 28 - El dominio RRM de la proteína TcUBP-1 se asemeja al de las proteínas de unión a ARN de
otros tipos celulares. Alineamiento de secuencia de aminoácidos del dominio RRM de TcUBP-1, RRM1 de
HuD (mamífero), RRM1 de Sxl (D. melanogaster) y U1A117 (mamífero). Los residuos idénticos entre las 4
proteínas están indicados en negro, y entre 2 o 3 proteínas en gris. Los espacios estan introducidos para un
mejor alineamiento. Se indica la posición de los motivos RNP2 y RNP1.
Aunque las zonas de mayor identidad son los motivos RNP1 y RNP2, ciertos
residuos, especialmente hidrofóbicos, también están conservados entre las proteínas, y
en particular son los que componen las hojas-β (Figura 28). Sin embargo, no existe
identidad clara en las regiones fuera del dominio RRM entre las proteínas TcUBP-1,
HuD, Sxl y U1A. A pesar de esto, algunas porciones de los dominios auxiliares
especialmente en la región rica en Glicina de TcUBP-2, como las repeticiones YGG, y
también la composición de residuos del C-terminal en TcUBP-1, como por ejemplo el alto
contenido en Glutamina, se detectan en proteínas de unión a ARN de otros tipos celulares
como hnRNP A1 y hnRNP D (ver Discusión). La porción de las proteínas TcUBPs que más
llama la atención es la región rica en Glicina. En TcUBP-1 se observa la secuencia
GAYGGYGAY, mientras que en TcUBP-2 esta porción es más extensa y presenta la
secuencia GAYGGYGGYGGYGAY. Esto demuestra que en TcUBP-2 el motivo YGG está
repetido tres veces mientras que en TcUBP-1 sólo una vez (ver Figura 25). Estos motivos
se encuentran en un gran número de proteínas de origen diferente, tal es el caso de la
isoforma p42 de la proteína murina hnRNP D (Número de acceso NCBI: BAB03466), la
proteína de la pared celular de Chlamydomonas reinhardtii (Número de acceso NCBI:
AAA02923) y la región variable de la cadena pesada de la inmunoglobulina de Bos taurus
(Número de acceso NCBI: AAA98662), entre otros ejemplos.
77
Resultados
TcUBP-1 y TcUBP-2 son proteínas de unión a ARN funcionales y reconocen motivos
ricos en Uridina.
En esta tesis se demostró que la región
ARE, de ~44 nt, localizada en el 3’-NC de
A
GST
L S
P1 P2 P3 P4 L
GST-TcUBP-1
GST-TcUBP-2
S
S P1 P2 P3 P4
P1 P2 P3 P4 L
SMUG-L-ARE, se realizó una reacción de
unión “in vitro” (Figura 29A). A partir de una
reacción de transcripción “in vitro” se sintetizó
el ARN SMUG-L-ARE y se lo incubó con las
proteínas recombinantes GST y GST-TcUBP1. Las reacciones se resolvieron en un gel
nativo, como se observa en la Figura, GSTTcUBP-1 es capaz de reconocer al ARN SMUGL-ARE. Esta unión no se ve afectada por el
agregado de heparina (resultado no
mostrado), un polianión que sirve como
competidor inespecífico. Como era de esperar
el experimento control con proteína GST dió
negativo (Figura 29A).
Luego se intentó demostrar, tanto para
TcUBP-1 como para TcUBP-2, cual era el sitio
mínimo de reconocimiento en el ARN SMUGL-ARE. Para ello se construyeron otros tres
B
poli (A)
-
1
10 50 500 1
poli (C)
poli (G)
poli (U)
10 50 500 1
10 50 500 1
10 50 500
TcUBP-1
ARN
estadío específica (Figura 14). Con el objetivo
de determinar si TcUBP-1 reconoce el ARN
ARN
TcSMUG-L tiene una función importante en
la regulación de la estabilidad en forma
-
1
poli (A)
poli (C)
poli (G)
10 50 500 1
10 50 500 1
10 50 500 1
poli (U)
10 50 500
TcUBP-2
Figura 29- TcUBP-1
y
TcUBP-2
interaccionan con ARN poli(U). A, Se realizó
un gel de retardo para determinar la posible
interacción entre TcUBP-1 o TcUBP-2 y el
elemento desestabilizante SMUG-L-ARE (L) y
distintas secuencias ricas en Adenosina y
Uridina: SMUG-S-ARE (S), P1, P2, P3 y P4.
El gel de retardo muestra las interacciones
entre los diferentes sustratos y GST, GSTTcUBP-1 o GST-TcUBP-2. B, Ensayo de gel
de retardo realizado para resolver las
reacciones de unión “in vitro” entre el ARN
SMUG-L-ARE sólo (ARN), en presencia de
TcUBP-1 o TcUBP-2 y cantidades crecientes
de polímeros de ARN (A, C, G, U) como
competidores de la reacción de unión a ARN.
ARNs conteniendo secuencias parciales de
SMUG-L-ARE y se los llamó 1, 2 y 3. La unión de ambas proteínas al ARN de 31 nt
SMUG-L-ARE-1, fue un 90% menor comparando con el ARN SMUG-L-ARE, para la misma
cantidad de proteína utilizada, ~1μgr (resultado no mostrado). Esto demuestra que los
dos motivos AUUUUA de los extremos de SMUG-L-ARE son importantes para el
reconocimiento por TcUBP-1 y TcUBP-2. La unión al nonámero UUAUUUAUU
característico de los ARE (SMUG-L-ARE-2), es insignificante y se detecta sólo al sobreexponer la película (resultado no mostrado). La interacción se incrementó levemente al
utilizarse el nonámero más dos residuos de Uridina en cada uno de sus extremos (SMUGL-ARE-3) (resultado no mostrado). Pero nuevamente se observó una reducción en la
interacción de alrededor del 90% como con el ARN SMUG-L-ARE-1. De este modo, se
puede concluir que el ARN SMUG-L-ARE de 44 nt, es el mínimo elemento necesario para
una eficiente interacción con las proteínas TcUBP, ya que la deleción de las corridas de
Uridina afecta su reconocimiento (ver más adelante). Además, se llevaron a cabo
experimentos de competición para caracterizar la especificidad de la interacción entre
las proteínas TcUBP y el ARN SMUG-L-ARE (Figura 29B). Se prepararon reacciones de
unión ARN-proteína en ausencia o presencia de polímeros de ARN poli(A), poli(C), poli(G)
y poli(U) sin marcar y la ribosonda indicada. Como se observa, el complejo formado entre
78
Resultados
TcUBP-1 o TcUBP-2 y SMUG-L-ARE, se compite en forma eficiente y dependiente de la
concentración del ARN poli(U), pero no con poli(A) y poli(C). El ARN poli(G) disminuye la
interacción de TcUBP-1 y TcUBP-2 pero sólo cuando se utilizan altas concentraciones
(500X) (Figura 29B).
Como se describió anteriormente un gran número de transcriptos de tripanosomas
presentan regiones ricas en Adenosina-Uridina en sus regiones 3’-NC (ver Tabla 2). Por
lo tanto, se evaluó la capacidad de TcUBP-1 y TcUBP-2 de interaccionar con tales ARNs,
y se comparó estas interacciones con el reconocimiento de SMUG-L-ARE. Entre los ARNs
evaluados están el de la fospolipasa-1 (PLC-ARE), transportador de hexosas (HEX-TARE) y el del grupo TcSMUG-S (SMUG-S-ARE). TcUBP-1 claramente reconoce las regiones
ARE de los ARNms TcSMUG-L y TcSMUG-S, los cuales tienen varios motivos del tipo
AUUUA, AUUUUA y AUUUUUA (Figura 29A). Por otro lado, TcUBP-1 no es capaz de
reconocer, con la cantidad de proteína utilizada en este ensayo (~1μM) las regiones HEXT-ARE y PLC-ARE compuesta por un poli-(AU) más dos pentámeros AUUUA en su
11
extremo 3’-terminal. De esta manera, se concluye que aunque varias secuencias del tipo
ARE están presentes en diferentes transcriptos, TcUBP-1 y TcUBP-2 reconocen algunos
y no todos esos motivos (resultado no mostrado).
TcUBP-1 y TcUBP-2 presentan especificidad y afinidad similares para los ARNs
ricos en Uridina testeados.
La interacción con el ARN SMUG-L-ARE permite calcular una constante de
disociación del complejo ARN-proteína. La constante para la mezcla ARN-proteína, se
calculó determinando la concentración de proteína necesaria para unir el 50% del ARN
(Smith, 1998). Para ello se realizó un gel de retardo utilizando diferentes concentraciones
de la proteína TcUBP-1 desde 0.5 μM hasta 10 μM a una concentración fija de ARN
SMUG-L-ARE o SMUG-S-ARE. TcUBP-1 reconoce a SMUG-L-ARE con una K ~ 5 μM
d
(ver Tabla 4), lo cual representa una interacción de afinidad media. El ARN SMUG-SARE, perteneciente al transcripto TcSMUG-S, es reconocido con más afinidad K ~ 0.5
d
μM (Figura 30A y B). De manera tal de analizar en forma más estricta y detallada la
interacción entre TcUBP-1 o TcUBP-2 y las secuencias ricas en Uridina, se sintetizaron
ARNs modificados basándonos en la secuencia de 18 nt SMUG-S-ARE. Así se construyeron
5 oligoribonucleótidos nuevos (P1, P2, P3, P4 y P1-GGG) (ver Tabla 4). En el ARN P1, los
residuos de Adenosina entre las corridas de Uridina, se cambiaron por residuos de
Guanosina, generando el oligonucleótido 5’-guuuuguuuuuguuuuug-3’, que también es
una secuencia común presente en la región 3’-NC de algunos transcriptos del parásito
como EF1α y triparedoxina (Billaut-Mulot et al., 1996; Tetaud et al., 2001). Los ARNs P2
y P3 presentan 1 o 2 Guanosinas adicionales en vez de la segunda o segunda y tercera
Uridina(s), respectivamente, en los motivos guuuuug del ARN P1. En el ARN P4, el residuo
de Uridina del medio del motivo auuuuua se reemplazó por Adenosina, generando la
secuencia (AUU) A presente también en los ARNms de Hsp70 (Dragon et al., 1987). Por
5
último, el ARN P1-GGG presenta tres Guanosinas que reemplazan a Uridinas del último
motivo guuuuug, generando la secuencia 5’-guuuuguuuuugugggug-3’ (Tabla 4).
La interacción entre TcUBP-1 o TcUBP-2 y los ARNs sintetizados se estudió
realizando ensayos de retardo en gel y de esta manera, se calcularon constantes de
79
Resultados
disociación aparentes (K ) de los complejos ribonucleoproteicos formados (Figura 30 B y
d
C). TcUBP-1 reconoce el oligo S con una K ~ 500 nM y el derivado P1 con una mejor
d
afinidad, K ~ 150nM (Figura 30B). A diferencia, los ARNs P2 y P3 son reconocidos con
d
afinidades menores (K ~ 750 y 1000 nM, respectivamente). En forma similar al ARN P1,
d
A
L
(μM)
-
0.5
1
la afinidad por el ARN P1-GGG, es levemente
menor (K ~ 250 nM) en comparación con la
S
2.5
5
10
- 0.05 0.1 0.25 0.5
d
1
secuencia P1 (Figura 30B).
ARN
B
TcUBP-1
S
(nM)
P1
P2
P3
P1-GGG
- 10 50 250 5001000 10 50 250 500 100010 50 250 500100010 50 250 500100010 50 250 5001000
D
M
D
M
ARN
C
TcUBP-2
S
(nM)
P1
P2
P3
P1-GGG
- 10 50 250 5001000 - 10 50 250 5001000 - 10 50 250 5001000 - 10 50 250 5001000 - 10 50 250 5001000
D
M
D
M
Figura 30 - TcUBP-1 y
TcUBP-2 reconocen ARNs
ricos en Uridina con similar
especificidad
y
afinidad. Ensayo de retardo
en gel para determinar las
constantes de disociación
entre TcUBP-1 (panel A y B)
o TcUBP-2 (panel C) y los
ARNs
indicados.
Se
incubaron
cantidades
crecientes de las proteínas
con los ARNs y luego se
resolvieron en geles nativos.
La posición del ARN libre,
monómeros (M) y dímeros
(D) se indica con flechas.
ARN
En cuanto a la proteína TcUBP-2, ésta tiene un comportamiento muy similar a
TcUBP-1 en términos de actividad de unión a los sustratos ribonucleicos evaluados
(Tabla 4). Para los ARNs S y P1 las constantes obtenidas son de alta afinidad y muy
similares a las detectadas con TcUBP-1 (K ~ 250 y 100 nM, respectivamente). La
d
interrupción del último tracto de Uridinas con residuos de Guanosina (ARN P1-GGG),
produce un efecto muy leve en la afinidad (K ~ 200 nM). De la misma manera que
d
sucede con TcUBP-1, los ARNs P2 y P3 son reconocidos con afinidades menores (K ~
d
750 y 850 nM, respectivamente). El ARN P4 presenta constantes de disociación K > 5
d
μM para ambas proteínas (resultado no mostrado), debido a la interrupción de los tractos
de Uridina con otros nucleótidos. Todos estos resultados se resúmen en la Tabla 4.
El elemento rico en GU- es un mejor sustrato para la unión que el elemento AU-.
La comparación de las constantes aparentes de afinidad permite concluir que
aunque estos diferentes ARNs son reconocidos por TcUBP-1 y TcUBP-2, es claro que no
comparten una similitud estructural importante. La única similitud interesante es que
algunos de ellos (SMUG-S-ARE, P1 y P1-GGG) contienen más de una repetición del
motivo UUUU(U) con residuos de Adenosina o Guanosina intercalados en sus extremos
(ver Tabla 4). La sustitución de una de éstas 4 o 5 Uridinas en las repeticiones produce
un gran incremento en las constantes aparentes de disociación, así como sucede con los
80
Resultados
oligos P2, P3 y P4. De la comparación de las constantes también se puede deducir que
probablemente los residuos de Guanosina contacten mejor que las Adenosinas en los
complejos ribonucleoproteicos; sin embargo, ambos nucleótidos son purinas. En resumen,
ambas proteínas TcUBP-1 y TcUBP-2 presentan afinidades y especificidades muy similares
para las secuencias de ARN evaluadas, y se demuestra que los tractos de Uridina son de
gran importancia para el reconocimiento (ver Tabla 4). Los valores de las constantes
obtenidas, por lo menos para los oligos P1 y P1-GGG, son de gran afinidad en comparación
con las afinidades de proteínas de unión a ARN de otros tipos celulares (ver Discusión).
A partir de lo observado en este experimento se puede sugerir que tanto TcUBP-1 como
TcUBP-2 tienen el potencial de dimerizar en presencia de ARN, cuando en los ensayos de
retardo en gel se utilizan concentraciones superiores a ~500 nM de proteína (Figura 30).
ARN
L
Secuencia
UAAUUUUAAAAUUUAUUUAAUGUUGUU
UUGAUUUAUUUAUUUUU
TcUBP-1 (nM)
TcUBP-2 (nM)
5000
5000
S
AUUUUAUUUUUAUUUUUA
500 ± 25
250 ±10
P1
GUUUUGUUUUUGUUUUUG
150 ± 5
100 ±5
P2
AUGUUGUUGUUGUUGUUG
750 ± 50
750 ± 65
P3
GUGGUGUUGGUGUUGGUG
> 1000
850 ± 55
P4
AUAUUAUUAUUAUUAUUA
> 5000
> 5000
P1-GGG
GUUUUGUUUUUGUGGGUG
250 ± 15
200 ± 15
Tabla 4 - Comparación de las constantes de discociación aparentes obtenidas para TcUBP1 y TcUBP-2 y los diferentes ARNs testeados.
Identificación de los productos codificados por Tcubp-1 y Tcubp-2 en extractos de
parásitos.
Con el objetivo de identificar y caracterizar los productos codificados por los genes
Tcubp-1 y Tcubp-2, se prepararon anticuerpos contra diferentes porciones de las proteínas
codificadas. En primer lugar, se expresó el dominio RRM junto con el N-terminal de
TcUBP-1 como fusión con GST y se inyectaron conejos con esta proteína recombinante.
Este anticuerpo policlonal se llamó anti-RRM. Para analizar la expresión de las proteínas,
se realizó un ensayo de “Western blot” utilizando un extracto proteico total del estadío
epimastigote (Figura 31A). Este anticuerpo reconoce tres bandas de tamaños 18, 27 y
45kDa. La proteína de 18kDa corresponde al tamaño esperado a partir de la región
codificante de Tcubp-2 (165 aa, ~18.4kDa) y la proteína de 27kDa presenta el tamaño
que se espera para el producto codificado por Tcubp-1 (225 aa, ~27.5kDa). La banda de
45kDa no corresponde al tamaño esperado para ninguna de las proteínas (Figura 31A).
Además, se generaron dos anticuerpos adicionales en ratones, contra péptidos de las
porciones específicas de TcUBP-1 y TcUBP-2. Para TcUBP-1 se utilizó un péptido de la
región N-terminal, que contiene los residuos V7-A17, y para TcUBP-2 un péptido de la
región RV, que contiene los residuos G111-Y122 de la proteína. A los péptidos se les
agregó en el extremo C-terminal una Cisteína para permitir la unión covalente de los
mismos al “carrier” utilizado (KLH). Los anticuerpos policlonales obtenidos se denominaron
anti-TcUBP-1 y anti-TcUBP-2, respectivamente. Con el objetivo de confirmar la
81
Resultados
especificidad de los anticuerpos generados se realizaron ensayos de “Western blot”
utilizando proteínas recombinantes GST-TcUBP-1 y GST-TcUBP-2, y extracto total del
estadío epimastigote. En la Figura 31B se observa que el anticuerpo anti-TcUBP-1 reconoce
las bandas de 27 y 45kDa en un extracto total, y que sólo la banda de GST-TcUBP-1
reacciona con el anticuerpo. Además, la preadsorción del suero con GST-TcUBP-1
solamente, impide la interacción con las bandas de 27 y 45kDa en un extracto total de
epimastigotes (Figura 31B). De la misma manera, se demostró la especificidad del
anticuerpo anti-TcUBP-2 (Figura 31C). Este anticuerpo reconoce solamente a GST-TcUBP2 y también reacciona en un extracto total con la banda de 18kDa. Más aún, la
preadsorción del suero con GST-TcUBP-2 impide la detección de la banda de 18kDa en
un extracto total (Figura 31C). De esta manera, se concluye que la banda de 18kDa está
codificada por Tcubp-2 y que las dos bandas de 27 y 45kDa que reaccionan con los
anticuerpos anti-RRM y anti-TcUBP-1, están codificadas por Tcubp-1. Se sabe que los
dos genes Tcubp-1 y Tcubp-2 están presentes como genes de copia única en el genoma de
66
45
TcUBP-1m
29
TcUBP-1
18
TcUBP-2
kDa
66
45
TcUBP-1m
29
TcUBP-1
18
1
3
4
linea
D
kDa
66
45
E T
A
TcUBP-1m
45
29
29
TcUBP-1
18
TcUBP-2
TcUBP-2
18
linea
2
anti-TcUBP-1
Antisuero
depletado
GST-TcUBP-1
GST-TcUBP-2
kDa
66
Extracto
anti-RRM
C
Antisuero
depletado
Extracto
GST-TcUBP-2
B
kDa
GST-TcUBP-1
A
Extracto
T. cruzi y que una sonda dirigida contra el dominio RRM sólo detecta dos bandas en un
ensayo de “Southern blot” (Figura 26). Por lo tanto, se puede sugerir que la banda de
45kDa es la proteína TcUBP-1 modificada “in vivo” en forma post-traduccional. De esta
manera y para simplificar la nomenclatura, se llamará TcUBP-1 a la banda de 27kDa y
TcUBP-1m (m por modificada) a la banda de 45kDa (Figura 31). El patrón de expresión
de las proteínas TcUBPs se estudió a partir de ensayos de “Western blot” utilizando
lisados proteicos totales de los diferentes estadíos. TcUBP-2 se expresa preferencialmete
en epimastigotes; mientras que TcUBP-1 está en todos los estadíos y TcUBP-1m también,
aunque su abundancia es mayor en los estadíos asociados con el huésped mamífero,
amastigote y tripomastigote (Figura 31D).
1
2
3
4
anti-TcUBP-2
anti-RRM
82
Figura 31 - Identificación de los
productos codificados por Tcubp-1 y
Tcubp-2 en el parásito. A, “Western blot”
realizado sobre un extracto de proteínas
total de epimastigotes de T.cruzi con el
anticuerpo policlonal anti-RRM. La
posición de las tres bandas se indica con
flechas (18, 27 y 45kDa). B, “Western blot”
realizado con el anticuerpo policlonal antiTcUBP-1. Las líneas sembradas son: (1)
Extracto total de epimastigotes, (2) GSTTcUBP-1, (3) GST-TcUBP-2 y (4) extracto
proteico del estadío epimastigote,
reaccionado con el suero anti-TcUBP-1
depletado con GST -TcUBP-1. C, “Western
blot” realizado con el anticuerpo policlonal
anti-TcUBP-2. Las líneas sembradas son:
(1) Extracto total de epimastigotes, (2)
GST -TcUBP-2, (3) GST -TcUBP-1 y (4)
extracto proteico del estadío epimastigote,
reaccionado con el suero anti-TcUBP-2
depletado con GST-TcUBP-2. D, “Western
blot” realizado sobre extractos proteicos
totales de los diferentes estadíos del
desarrollo del parásito: (E) epimastigotes,
(T) tripomastigotes derivados de células y
(A) amastigotes intracelulares, y
reaccionado con el anticuerpo anti-RRM.
Resultados
Las proteínas nativas TcUBP-1 y TcUBP-2 reconocen ARN poli(U) .
Para verificar si las proteínas nativas presentan actividad de unión a ARN, se
desarrolló un ensayo de unión “in vitro” a partir de extractos totales de parásito seguido
por ensayos de “Western blot” (Figura 32A). Polímeros de ARN (A, C, G y U) se unieron
covalentemente a bolitas de agarosa activadas con dihidrazida. Luego de equilibrarlas
en el “buffer” apropiado, se las incubó con un extracto proteico total del estadío
epimastigote durante 1 hr para posibilitar la unión. Las proteínas retenidas fueron eluídas
en “buffer” Laemmli 2X y se corrieron en un gel SDS-PAGE 12.5% seguido de un ensayo
de “Western blot” con el anticuerpo anti-RRM. Como se observa, todas las proteínas
nativas TcUBP-1m, TcUBP-1 y TcUBP-2 son capaces de reconocer en forma específica el
ARN poli(U), pero no otros polímeros de ARN (Figura 32A).
Para verificar la localización subcelular de las proteínas nativas, se realizó un
fraccionamiento bioquímico (Figura 32B). Se cargó en un gel SDS-PAGE, la misma
cantidad de proteína correspondiente a cada fracción y luego se realizó un ensayo de
“Western blot” con el anticuerpo anti-RRM. TcUBP-2 es la única proteína que localiza en
el P1000g, el cual se sabe que contiene proteínas nucleares y proteínas asociadas a la
membrana del retículo endoplásmico (Frey et al., 2001) y además, en microsomas
(P100.000g). A diferencia, TcUBP-1 y TcUBP-1m no se detectan en el P1000g, aunque sí
se localizan en microsomas (P100.000g). TcUBP-1, también está presente en forma
soluble en el citoplasma (S100.000g). TcUBP-1m es detectada preferencialmente en las
B
poli-(ARN)
A
C
G
kDa
U
Extracto
kDa
Matriz
A
Extracto
fracciones P10.000g y P100.000g (Figura 32B).
1.000g 10.000g 100.000g
P
S
P
S
P
S
97
66
45
TcUBP-1m
29
TcUBP-1
*
66
45
TcUBP-1m
29
18
TcUBP-1
TcUBP-2
18
TcUBP-2
anti-RRM
anti-RRM
Figura 32 - Las proteínas TcUBP nativas reconocen ARN poli(U) y localizan en
diferentes fracciones subcelulares. A, Se preparó un extracto de proteínas del
estadío epimastigote y se lo incubó con la matriz agarosa-dihidrazida sóla (Matriz) o
conteniendo polímeros de ARN. Luego de los lavados, las proteínas se eluyeron con
buffer Laemmli 2X y se realizó un “Western blot” con el anticuerpo policlonal antiRRM. B, Fraccionamiento subcelular seguido de un ensayo de “Western blot” con el
anticuerpo anti-RRM de cada fracción. Se muestra la siembra del 10% del extracto
preparado (Extracto). P, pellet; S, sobrenadante. Las fracciones utilizadas fueron S y
P de 1000g, 10.000 y 100.000g . El asterisco indica la posición de una banda
inespecífica debido a la agregación proteíca en el P100.000g.
83
Resultados
TcUBP-1 y TcUBP-2 forman parte de un complejo ribonucleoproteico.
Se llevaron a cabo experimentos de filtración en gel con el objetivo de determinar
si las proteínas TcUBP forman parte de complejos ribonucleoproteicos “in vivo”. Para ello
se prepararon extractos libres de células del estadío epimastigote y se pre-trataron con
dos “buffers” diferentes (A: 150 mM NaCl y B: 150 mM NaCl y 0.1 μgr/μl ARNasa A).
Luego del pre-tratamiento de los extractos por 30 min, se separaron en condiciones
nativas en una columna Bio-Sil SEC 250 y las proteínas eluídas se analizaron en geles
SDS-PAGE 12.5% seguido por un “Western blot” con el anticuerpo anti-RRM (Figura 33).
En el tratamiento del extracto con “buffer” A, las isoformas TcUBP-1 y TcUBP-2 se detectan
en un complejo de alto peso molecular de ~450kDa (Figura 33A, línea 9). Por un lado,
TcUBP-1 también se detecta en la fracción 17 correspondiente a una masa molecular
aparente de ~27kDa y esta banda puede corresponder a la forma monomérica de TcUBP1. Por otro lado, TcUBP-2 se detecta entre las fracciones correspondientes a 17-45kDa
(Figura 33A, líneas 16-19), las cuales pueden corresponder a las formas monomérica y
dimérica.
En presencia del “buffer” B,
A
670 kDa
kDa
66
Ext 8
180 kDa
45 kDa
todas
las
bandas
proteícas
correspondientes al complejo de
17 kDa
9 10 11 12 13 14 15 16 17 18 19 20
45
TcUBP-1m
29
TcUBP-1
18
TcUBP-2
B
670 kDa
kDa
Ext 8
180 kDa
45 kDa
17 kDa
TcUBP-1 y TcUBP-2 entre las
fracciones 16-19 no cambia
significativamente. Como el “buffer” B
contiene ARNasa A, se sugiere que un
componente
ribonucleico
es
9 10 11 12 13 14 15 16 17 18 19 20
66
45
TcUBP-1m
29
TcUBP-1
18
~450kDa desaparecen (Figura 33B,
línea 9), mientras que la posición de
TcUBP-2
Figura 33 - TcUBP-1 y TcUBP-2 están presentes en
un complejo ribonucleoproteico de ~450kDa. Se
preparó un extracto proteico total de epimastigotes y
se lo pre-trató por 30 min. como se indica: panel A,
150 mM NaCl; panel B, 150 mM NaCl + 0.1 μg/μl de
ARNasa A; en un buffer conteniendo 20 mM Tris-HCl
pH 6.8. Los diferentes extractos se sembraron en la
matriz de cromatografía en gel BioSil SEC 250 y se
recolectaron fracciones de 0.5 ml cada una. Las
muestras se resolvieron en geles desnaturalizantes
SDS-PAGE 12.5%, seguido de un ensayo de “Western
blot” con el anticuerpo anti-RRM. La posición de las
proteínas TcUBP-1, TcUBP-1m y TcUBP-2, se indica
con flechas en la parte derecha del panel. Ext, 10%
del extracto total utilizado para el fraccionamiento.
En las fracciones 1-7 no se detectó cross-reacción con
el suero (no mostrado). Los marcadores de peso molecular utilizados son: 670kDa, T iroglobulina;
180kDa, α2-Macroglobulina; 45kDa, Ovalbumina y
17kDa, Mioglobina.
84
importante para la formación del
complejo y la interacción proteínaproteína. El mismo experimento se
repitió utilizando un extracto total del
estadío tripomastigote derivado de
células. Sin embargo, debido a la poca
cantidad de material inicial utilizado
en dos experimentos independientes,
no
se
detectaron
bandas
correspondientes a las proteínas
TcUBP en ensayos de “Western blot”
(resultado no mostrado).
Resultados
El complejo ribonucleoproteico contiene el heterodímero TcUBP-1-TcUBP-2 y la
proteína TcPABP1.
De acuerdo a lo observado en el perfil de elución de la cromatografía en gel (Figura
33) y para determinar si las proteínas TcUBP-1 y TcUBP-2 interaccionan “in vivo” en el
parásito se realizaron experimentos de inmunoprecipitación. Para esto, se realizaron
inmunoprecipitaciones con anticuerpos pre-inmune y anti-TcUBP-1 en extractos sin (-)
o con (+) ARNasa A y se analizaron por medio de un ensayo de “Western blot” con el
anticuerpo anti-RRM (Figura 34A). Las proteínas TcUBP-1 y TcUBP-2 se detectaron
cuando se inmunoprecipitó con anti-TcUBP-1, lo cual sugiere que están asociadas “in
vivo” en la forma epimastigote del parásito aún en ausencia de ARN, mientras que la
forma TcUBP-1m no co-precipita (Figura 34A).
kDa
anti-TcPABP1
ARNAsa A
anti-TcUBP-2
+
anti-TcUBP-1
-
PreInmune
B
anti-TcUBP-1 :IP
Extracto
kDa
Extracto
A
PreInmune
Se sabe que en las células
eucariotas
superiores,
PABP1 es parte de un
complejo multiproteico el
cual se forma en la región 3’-
:IP
66
IgG cp
45
TcPABP1
66
29
TcUBP-1
18
TcUBP-2
IgG cp
en Wilusz et al ., 2001).
Debido a que TcUBP-1 se
45
anti-TcPABP1
D
anti-TcUBP-1
E
:IP
T A
kDa
66
TcPABP1
Extracto
kDa
Extracto
anti-RRM
C
anti-TcUBP-1
E
une a las secuencias ARE “in
vitro” (Figura 30), se decidió
:IP
T
- + - +
66
ARNAsa A
TcPABP1
45
45
NC de ARNms que contienen
elementos ARE (ver revisión
anti-TcPABP1
29
anti-TcPABP1
Figura 34 - TcUBP-1 y TcUBP-2 interaccionan y están
acomplejadas con la proteína de unión a poli(A). A, Se incubó un
extracto proteico total del estadío epimastigote pretratado (+) o no () con ARNasa A, con suero pre-inmune, y anti-TcUBP-1. Los
inmunocomplejos se precipitaron con proteína-A-sefarosa y se
resolvieron por electroforesis en geles desnaturalizantes SDS-PAGE
12.5%, seguido de un ensayo de “Western blot” con el anticuerpo
anti-RRM. IgGcp, indica la posición de la cadena pesada de las
inmunoglobulinas. IP, indica el anticuerpo utilizado en el ensayo de
inmunoprecipitación. B, Un extracto total de proteínas del estadío
epimastigote se incubó con suero pre-inmune, anti-TcUBP-1, antiTcUBP-2 o anti-TcPABP1. Los inmunocomplejos se precipitaron con
proteína-A-sefarosa y se resolvieron en geles SDS-PAGE, seguido de
un “Western blot” con el anticuerpo anti-TcPABP1. La presencia de
TcPABP1 (banda de 66kDa) y la IgGcp, se indican con flechas. C,
Extractos totales de epimastigotes (E), tripomastigotes derivados de
células (T) y amastigotes (A) se incubaron con anti-TcUBP-1. Los
inmunocomplejos precipitados se ensayaron en un “Western blot”
con anti-TcPABP1. D, Un extracto proteico total del estadío
epimastigote (E) o tripomastigote (T) se pre-trató (+) o no (-) con
ARNasa A durante 30 min. y luego se realizó una inmunoprecipitación
con el anticuerpo anti-TcUBP-1. Los co-precipitados se resolvieron y
ensayaron en un “Western blot” con el suero anti-TcPABP1.
85
evaluar si TcPABP1 está
asociada a TcUBP-1 o
TcUBP-2 for mando un
complejo en el 3’-NC del
ARNm de TcSMUG. Para
responder esta pregunta, se
realizaron reacciones de
inmunoprecipitación con los
anticuerpos anti-TcUBP-1,
anti-TcUBP-2
y
antiTcPABP1, seguido de un
ensayo de “Western blot” con
anti-TcPABP1. Como se
muestra en la Figura 34B, en
el complejo ARN-proteína
que contiene el heterodímero
TcUBP-1/TcUBP-2, también
se detecta TcPABP1. Dos
bandas de 55 y 66kDa se
observan en un extracto total
de epimastigotes de T. cruzi
con el anticuerpo generado
Resultados
contra el dominio C-terminal de TcPABP1 (ver Materiales y Métodos) (Figura 34B). Sin
embargo, se describió que sólo la banda de 66kDa corresponde a la proteína TcPABP1
(Batista et al., 1994). Además, es la única de las dos bandas que co-precipita.
La interacción entre TcUBP-1 y TcPABP1 se detecta durante el desarrollo del parásito.
Se analizó la interacción entre TcUBP-1 y TcPABP1 durante el desarrollo del
parásito (Figura 34C). Para ello se prepararon extractos proteicos totales de las diferentes
formas del parásito y se realizaron inmunoprecipitaciones con el anticuerpo anti-TcUBP1 seguido de un ensayo de “Western blot” con anti-TcPABP1. Este experimento demuestra
que la interacción entre estas dos proteínas se detecta solamente en los estadíos
epimastigote y tripomastigote, pero no en amastigote (Figura 34C). De lo contrario, TcUBP2 que se expresa preferencialmente en el estadío epimastigote (Figura 31D), co-precipita
con TcPABP1 en este estadío (Figura 34B) y la interacción no se detecta en las otras
formas del parásito.
Como se demostró anteriormente, el complejo ARN-proteína de ~450kDa el cual
contiene las proteínas TcUBPs se desarma en presencia de ARNasa A (Figura 33). Por lo
tanto, se evaluó si la interacción entre TcUBP-1 y TcPABP1 en el estadió epimastigote es
dependiente de ARN (Figura 34D). Para tal objetivo, se realizó un ensayo de
inmunoprecipitación con extractos de epimastigotes libre de células pre-tratados o no
con ARNasa A, demostrando que la interacción entre estos dos factores no se detecta en
presencia de la nucleasa. Sin embargo, en el estadío tripomastigote la interacción es
independiente del ARN (Figura 34D).
TcUBP-1 y TcUBP-2 interaccionan en un ensayo de doble híbrido en levaduras.
Se realizó un ensayo de doble híbrido en levaduras para corroborar la interacción
entre las proteínas TcUBP-1 y TcUBP-2 en un sistema heterólogo (Figura 35). Para tal
efecto, el marco abierto de lectura de TcUBP-1 se clonó en el vector pBTM-116 generando
una fusión con el dominio de unión a ADN
(DBD) del factor de transcripción LexA
(LexA-TcUBP-1) (Fields and Song, 1989).
Este vector se transformó en la cepa de
levaduras L40 (ver Materiales y Métodos) y
se estudió si “per se” tiene la capacidad de
activar el sistema transcripcional; es decir,
sin interaccionar con el dominio de
activación (AD) clonado en el vector pVP16. Este ensayo dio negativo, y aunque un
leve crecimiento basal se observó en placas
His- no se detectaron niveles de actividad
de GAL4 (Figura 35). Por lo tanto, los ADNc
de TcUBP-1 y TcUBP-2 se clonaron en el
vector presa pVP-16, el cual presenta el AD
del factor VP16. En la Figura 35A se lista la
combinación de proteínas utilizadas para el
86
Figura 35 - TcUBP-1 y TcUBP-2 interaccionan
en un sistema heterólogo. A, Se lista la
combinación de proteínas híbridas utilizadas para
los ensayos de doble-híbrido. El plásmido
pBTM116 se usó para clonar en fusión con el
dominio de unión a ADN (DBD) de la proteína LexA.
El plásmido pVP16 se usó para clonar las “presas”
en fase con el dominio de activación (AD) del factor de transcripción VP16. B, Determinación
relativa de las interacciones según se muestra en
el panel C (-, sin interacción; ++, interacción fuerte,
a partir de su comparación con controles
estándares de interacción). C, Ensayo de actividad
β-galactosidasa de las levaduras L40 conteniendo
ambos plásmidos.
Resultados
ensayo de doble híbrido y los correspondientes resultados se muestran en la Figura 35B
y C. La co-transformación de la cepa L40 con LexA-TcUBP-1 y VP16-TcUBP-1 o VP16TcUBP-2 permiten el crecimiento de las levaduras transformantes, como era de esperar,
en medio His- y también mostraron actividad β-galactosidasa positiva (Figura 35C). Se
obtuvieron resultados negativos con levaduras transformadas con LexA-TcUBP-1 y VP16
sólo, lo cual indica que la interacción entre TcUBP-1/TcUBP-1 y TcUBP-1/TcUBP-2 es
específica. Esto permite concluir que no sólo las proteínas tienen la capacidad de
heterodimerizar, sino también pueden homodimerizar, al menos en el caso de TcUBP-1
(Figura 35C).
Mapeo de la región mínima requerida en TcUBPs para la unión de ARN y la formación
de dímeros.
Se demostró que TcUBP-1 y TcUBP-2 son capaces de reconocer ARN-ricos en
Uridina con constantes de disociación aparentes casi idénticas (ver Tabla 4). Este resultado
sugiere que las diferencias primarias entre ambas proteínas, localizadas en la regiones
N- y C-terminales, no contribuyen en el reconocimiento del ARN y/o en procesos de
modulación de la actividad de unión al ARN. Además, TcUBP-1 y TcUBP-2 dimerizan; y
por lo tanto, se hipotetizó que los dominios auxiliares pueden ser cruciales para la
interacción proteína-proteína. Para verificar esta hipótesis, varias mutantes de deleción
se construyeron por PCR (ver sección Anexo III). Las diferentes proteínas generadas se
llamaron TcUBP-1ΔN, la cual carece de la región N-terminal; TcUBP-1ΔQ, la cual carece
de la región rica en Glutamina del C-terminal; TcUBP-1ΔNQ, que carece tanto de las
regiones N-terminal y rica en Glutamina; y dos otras construcciones más llamadas TcUBP1ΔQG1 y TcUBP-1ΔQG2 (Figura 36A). La diferencia entre estas dos construcciones reside
en la región RV. TcUBP-1ΔQG1 presenta la región RV, compuesta por 14 aminoácidos
(PGIAGAVGDGNGYL), después de la hoja-β4 (Figura 36A). Sin embargo, ambas proteínas
carecen del motivo GAYGGYGAY presente en la región rica en Glicina. Asimismo, las
proteínas de deleción construídas a partir de TcUBP-2 fueron: TcUBP-2ΔN, la cual carece
de la región N-terminal; TcUBP-2ΔC, que carece del extremo C-terminal después de la
región rica en Glicina y dos construcciones más llamadas TcUBP-2ΔCG1 y TcUBP-2ΔCG2
(Figura 36C). Nuevamente, la diferencia entre estas dos proteínas es que sólo la primera
presenta la región RV en su región C-terminal compuesta por 9 aminoácidos
(NRNGVSTGF).
La predicción de la estructura y los espectros NOE-heteronucleares registrados
de las proteínas TcUBP-1 y TcUBP-2 (ver más adelante), sugieren que los dominios
auxiliares se comportan como “random-coil”. Por lo tanto, ninguna de las deleciones
realizadas tendría un efecto final deletereo en el plegamiento de las proteínas. Las
constantes de disociación de la formación de los complejos entre las proteínas construídas
y el ARN P1 se determinaron por geles de retardo, repetidos al menos dos veces. La
mayoría de las proteínas presentaron constantes similares K ~100-200 nM (Tabla 5).
ds
Sin embargo, la proteína TcUBP-1ΔQG2 mostró una K > 1000 nM. Esto demuestra que
d
la afinidad de esta proteína por el ARN disminuyó ~5 veces. A diferencia de ello, TcUBP1ΔQG1 que contiene la región RV en el extremo C-terminal del dominio RRM, muestra la
misma K que la proteína completa TcUBP-1 (Tabla 5). De manera similar a lo obtenido
d
87
Resultados
con las construcciones TcUBP-1, todas las mutantes de TcUBP-2 excepto TcUBP-2ΔCG2,
interaccionan con el ARN con la misma afinidad que la proteína entera TcUBP-2 (Tabla
5). Estos experimentos demuestran claramente que el dominio RRM (~92 aminoácidos)
es la mínima región requerida para la unión del ARN en las proteínas TcUBPs. La función
del C-terminal del dominio RRM (dominio RV) no está clara hasta el momento y requiere,
por lo tanto, más investigación. Sin embargo, se especula que puede funcionar en los
procesos de interacción con el ARN y/o en la estabilización del complejo ribonucleoproteico
(ver Discusión).
Figura 36 - Mapeo de los dominios requeridos para la unión a ARN en las proteínas TcUBPs. A,
Se muestra los esquemas de TcUBP-1 y las proteínas mutantes utilizadas en el gel de retardo del
panel B. Se indica la posición y la extensión del RRM en número de residuos; RV, región variable;
Gli, región rica en Glicina y Gln, región rica en Glutamina. B, Gel de retardo para determinar las
constantes de disociación (Kd) entre TcUBP-1 o las mutantes de deleción y el ARN P1. Se calculó una
constante aparente a partir de las diferentes curvas de ARN unido/ ARN libre vs la concentración de
proteína (nM) (ver Tabla 5). C, Esquema de TcUBP-2 y las mutantes de deleción utilizadas en el gel
de retardo del panel D. La posición y extensión en residuos de los módulos (RRM, RV, Gli y Cterminal), se indica sobre el esquema de TcUBP-2. D, Las constantes de disociación aparentes se
calcularon de la misma manera que en el panel B.
Proteína
TcUBP-1
TcUBP-1ΔN
TcUBP-1ΔQ
TcUBP-1ΔNQ
TcUBP-1ΔQG1
TcUBP-1ΔQG2
TcUBP-2
TcUBP-2ΔC
TcUBP-2ΔCG1
TcUBP-2ΔCG2
Kd (nM)
200
180
150
170
200
>1000
100
100
75
>500
Tabla 5 - Comparación de los valores absolutos de las constantes de disociación
aparentes entre las mutantes de deleción de TcUBP-1 y TcUBP-2 y el ARN P1.
88
Resultados
La región rica en Glicina del dominio auxiliar es crítica para la dimerización de las
proteínas TcUBPs.
En los geles de retardo realizados, se observó una disminución en la movilidad de
los complejos ribonucleoproteicos en presencia de concentraciones superiores a 500 nM
en todas las proteínas mutantes de TcUBP-1, excepto TcUBP-1ΔQG1 y TcUBP-1ΔQG2
(Figura 36). Ambas proteínas carecen de la región rica en Glicina; por lo tanto, podría
estar involucrada en procesos de dimerización. Con el objetivo de estudiar la formación
de dímeros “in vitro”, se realizaron ensayos de “cross-linking” en presencia de
glutaraldehído a una concentración final de 0.01% (Figura 37). Este es un reactivo que
permite la formación de una unión covalente entre proteínas que están en contacto
directo (Wan et al., 2001). Para este análisis, se utilizaron diferentes proteínas mutantes
las cuales se listan en la Figura 37A. En primer lugar, la formación de dímeros se estudió
con diferentes cantidades (250, 500 y 1000 nM) de las proteínas TcUBP-1ΔQ y TcUBP1ΔQG2 (Figura 37B). Como se observa, los dímeros se detectaron con concentraciones
superiores a 500 nM sólo en la proteína TcUBP-1ΔQ (Figura 37B) y el porcentaje de
“cross-linking” detectado es de alrededor del 10-15%, de acuerdo a lo determinado por
densitometría de las bandas. Se obtuvieron valores similares de “cross-linking” al
observado con proteínas de otros tipos celulares (Wan et al., 2001).
Luego de detectar la concentración de proteína requerida para utilizar en las
reacciones de “cross-linking” (~500 nM), se estudió la dimerización con todas las proteínas
que se listan en la Figura. La proteína TcUBP-1ΔQ, que presenta las regiones RV y rica
en Glicina como extensión terminal del dominio RRM, tiene la capacidad de dimerizar
(Figura 37C, línea 6); mientras que, la proteína mutante TcUBP-1ΔQG1, que presenta
sólo la región RV pero no la región rica en Glicina, forma dímeros de una manera muy
ineficiente en comparación con TcUBP-1ΔQ (Figura 37C, línea 8). Por su parte, la proteína
TcUBP-1ΔQG2, que carece de ambas regiones, no tiene la capacidad de reaccionar con el
glutaraldehído (Figura 37C, línea 10). En cuanto a la proteína TcUBP-1, la formación de
dímeros fue casi indetectable con la cantidad de proteína utilizada en este ensayo (Figura
37C, línea 4). En base a estos resultados, es posible que la presencia de la región rica en
Glutamina en el extremo C-terminal de TcUBP-1, regule en forma negativa los contactos
proteína-proteína debido a su naturaleza “random-coil” o que el ARN o algún factor se
requiera “in vivo” para facilitar el proceso de dimerización (ver Discusión). Con respecto
a la proteína TcUBP-2, se obtuvieron resultados similares en reacciones de “cross-linking”
(resultado no mostrado), en donde también se observa que la región rica en Glicina es el
principal determinante para la formación de dímeros.
Además, se realizó el análisis por cromatografía de filtración en gel para confirmar
los resultados de dimerización obtenidos por “cross-linking”. Para ello las proteínas TcUBP1ΔQ, TcUBP-1ΔQG2, TcUBP-2ΔC y TcUBP-2ΔCG2 se sembraron en una columna
Superdex 75 con las condiciones detalladas en Materiales y Métodos. En resúmen, ~1
μM de cada proteína se sembró en la columna y el perfil de elución se comparó con
marcadores de peso molecular conocidos. Se observó un perfil de elución similar para
las proteínas TcUBP-1ΔQ y TcUBP-2ΔC, las cuales eluyen en dos picos correspondientes
al dímero y monómero (resultado no mostrado), en donde el área de cada pico fue
aproximadamente el mismo. Sin embargo, las proteínas TcUBP-1ΔQG2 y TcUBP-2ΔCG2
89
Resultados
sólo eluyen como un pico el cual corresponde a la posición del monómero. Estos datos
corroboran los resultados obtenidos a partir de los geles de retardo (Figura 30 y 36) y los
experimentos de “cross-linking” (Figura 37).
Figura 37 - La región rica en Glicina es crítica para la dimerización de las proteínas TcUBPs.
A, Esquema de TcUBP-1 y las mutantes de deleción usadas para los ensayos de “cross-linking”.
En las proteínas TcUBP-1(Y-A) y TcUBP-1(Y-A)ΔQ, todas los residuos Tir de las posiciones 142,
145 y 148 de la región rica en Glicina se reemplazaron por Ala. La posición de la secuencia
original GAYGGYGAY y la mutada GAAGGAGAA, se indica sobre ambos esquemas. B, Las
proteínas TcUBP-1ΔQ y TcUBP-1ΔQG2 fueron tratadas (+) o no (-) con una concentración final
de 0.01% glutaraldehído. Las diferentes concentraciones de proteína utilizadas (250, 500, 1000
nM) se indican debajo del gráfico. Las muestras se trataron por 30 min. y se resolvieron por
electroforesis en gel desnaturalizante SDS-PAGE 12.5% y revelado por tinción con Coomasie
Blue. La posición de los monómeros y dímeros se indica con flechas. C, Todas las proteínas
indicadas en el panel A (concentración de ~ 1 μM) se incubaron (+) en presencia de glutaraldehído
0.01%, y los productos se resolvieron en un gel SDS-PAGE 12.5%.
Los residuos de Tirosina de la región rica en Glicina son importantes para la
dimerización.
Un rasgo interesante que caracteriza la región rica en Glicina es la presencia de
residuos aromáticos (preferencialmente Tirosina), distribuídos en forma más o menos
espaciada (ver Figura 25B). Este fenómeno se describió para otras proteínas de unión a
ARN en células de eucariotas superiores, tales como hnRNP A0 (Myer and Steitz, 1995)
y hnRNP A1 (Cartegni et al., 1996). Por lo tanto, para estudiar si los residuos de Tirosina
de la región rica en Glicina de TcUBP-1 son importantes en el proceso de dimerización,
todos las Tirosinas de las posiciones 142, 145 y 148 de la proteína, se mutaron por
residuos de Alanina. Esta proteína mutante se denominó TcUBP-1(Y-A) (ver Figura 37A).
A partir de esta construcción, se amplificó todo el marco abierto de lectura excepto la
región “random-coil” rica en Glutamina, generando la proteína TcUBP-1(Y-A)ΔQ. Se
preparó esta construcción para comparar con el patrón de dimerización de TcUBP-1ΔQ,
ya que la proteína entera TcUBP-1 no dimeriza eficientemente (Figura 37C). Los resultados
90
Resultados
demuestran claramente que mientras TcUBP-1ΔQ dimeriza “in vitro” (Figura 37C, línea
6), TcUBP-1(Y-A)ΔQ es incapaz de hacerlo (Figura 37C, línea 12). Por lo tanto, el cambio
de los residuos de Tirosina por Alanina en la región rica en Glicina, impide la formación
de dímeros.
También se analizó si la dimerización de las proteínas puede ocurrir a partir de la
formación de di-Tirosinas por oxidación de los residuos de Tirosina, en presencia de la
enzima “Horse Radish Peroxidase” y H O (Aeschbach et al., 1976). Esta reacción genera
2 2
la producción de un acoplamiento de los anillos fenólicos de residuos de Tirosina
intermoleculares próximos, generando el “cross-linking” covalente de las proteínas en
cuestión. De esta manera, las proteínas mutantes TcUBP-1ΔQ, TcUBP-1(Y-A)ΔQ y TcUBP1ΔQG2 se trataron como se indica. Sólo la proteína TcUBP-1ΔQ es capaz de formar
dímeros y oligómeros, y aún más interesante, la formación de dímeros se desplaza por
cantidades crecientes de L-Tirosina (resultados no mostrados). Estos resultados permiten
concluir que los residuos de Tirosina de la región rica en Glicina son importantes para
producir contactos proteína-proteína en el dímero.
Los residuos de Tirosina de la región rica en Glicina se fosforilan in vitro.
A partir de los resultados obtenidos, y con la idea
de que la dimerización debería ser un proceso regulado “in
vivo”, se analizó si los residuos de Tirosina podrían
modificarse en forma post-traduccional por fosforilación
“in vitro” (Figura 38). Se comparó la capacidad de las
proteínas GST como control, GST -TcUBP-1ΔQ y GST TcUBP-1ΔQG1, de fosforilarse “in vitro” en presencia de
[γ32P]-ATP y la Quinasa de Tirosina c-Src (ver Materiales y
Métodos). Mientras que GST no se fosforila, las proteínas
GST-TcUBP-1ΔQ y GST-TcUBP-1ΔQG1 son sustrato de la
Quinasa. Sin embargo, GST-TcUBP-1ΔQ se fosforila 4 veces
más que GST-TcUBP-1ΔQG1, para la misma cantidad de
proteína utilizada en este ensayo (Figura 38). Esto
demuestra, aunque en forma indirecta, que las 3 Tirosinas
presentes en la región rica en Glicina (GAYGGYGAY) de
GST -TcUBP-1ΔQ son sustrato de la Quinasa c-Src “in
vitro”. De manera tal de corroborar si TcUBP-1/TcUBP-2
están fosforiladas “in vivo”, se llevaron a cabo reacciones
de inmunoprecipitación con el anticuerpo anti-RRM
seguido de “Western blot” con un anticuerpo comercial antifosfo-Tirosina. Sin embargo, este ensayo dio negativo debido
a la baja reactividad que presentaba el anticuerpo evaluado
(resultado no mostrado).
91
Figura 38 - Los residuos
Tirosina de la región rica en
Glicina de TcUBP-1 se
fosforilan in vitro. Se
realizaron reacciones de
fosforilación “in vitro” utilizando
la kinasa c-Src y las proteínas:
GST, GST-TcUBP-1ΔQ y GSTTcUBP-1ΔQG1. Los productos
de fosforilación se corrieron en
geles SDS-PAGE, el cual se
expuso a una placa radiográfica
(panel A), despúes de realizarse
una tinción con Coomasie-Blue
(panel B).
Resultados
La formación de homodímeros de TcUBP-1, pero no TcUBP-2, es bloqueada por la
interacción con TcPABP1.
Se demostró anteriormente que TcPABP1 co-inmunoprecipita con TcUBPs “in vivo”
(Figura 34). Por lo tanto, se trató de estudiar la interacción TcUBPs-TcPABP1 “in vitro”.
Para tal objetivo, se clonó el gen Tcpabp1 a partir de ADN genómico de Cl-Brener, en
base a la secuencia reportada previamente (Batista et al., 1994). El clon se expresó como
fusión con GST, generando la proteína GST-TcPABP1. En primer lugar, se determinó su
capacidad de unir ARN “in vitro”, ya que en aquella publicación no se reportó su actividad.
Para realizar este ensayo, se incubó TcPABP1 con los distintos homopolímeros de ARN,
y como se observa en la Figura 39A, TcPABP1 es capaz de reconocer sólo poli(A). En
segundo lugar y para determinar si TcUBP-1 y TcUBP-2, sin el “tag” GST, interaccionan
“in vitro” con GST-TcPABP1, se realizó un ensayo de GST-“pull down”. Utilizando las
mismas condiciones experimentales, GST-TcPABP1 interacciona con TcUBP-1 pero es
incapaz de hacerlo con TcUBP-2 (Figura 39B). Esto sugiere que la unión de TcUBP-1 a
TcPABP1 es mediada por contactos proteína-proteína, aunque el ARN pueda ser necesario
para reclutar y acercar espacialmente
ambas moléculas.
Por otro lado, se analizó por gel de
retardo el efecto del agregado de
cantidades crecientes de TcPABP1 en la
interacción ARN-TcUBP-1 y ARN-TcUBP2. Para asegurar que las proteínas
reconozcan el ARN en forma dimérica, se
utilizó ~2 μM de cada una de las proteínas.
Este ensayo demostró que el agregado de
TcPABP1 no tiene efecto en la interacción
ARN-TcUBP-2, mientras que la interacción
ARN-TcUBP-1 se modificó con el agregado
de cantidades crecientes de TcPABP1
(Figura 39C). Este resultado demuestra
que TcPABP1 no desplaza a TcUBP-1 del
ARN, porque no se detecta sonda de ARN
libre; sino que, TcPABP1 debe romper la
formación de homodímeros de TcUBP-1,
generando un patrón de reconocimiento
monomérico en solución (Figura 39C). Es
probable que la interacción entre estas dos
proteínas involucre los extremos N- o Cterminales de TcUBP-1, ya que estas
regiones son las más diferentes entre
TcUBP-1 y su homólogo TcUBP-2.
Figura 39 - Interacción proteína-proteína entre
TcUBP-1 y TcPABP1. A, Determinación de la actividad
de unión a ARN de la proteína TcPABP1 usando
homopolímeros. B, Ensayo de “pull-down” con GST
entre GST o GST-TcPABP1 y las proteínas TcUBP-1 o
TcUBP-2, sin tag GST. Control, siembra del 10% de la
proteína TcUBP-1 o TcUBP-2 antes de hacer el ensayo
de interacción proteína-proteína. La integridad de las
proteínas no unidas se monitoreó por gel
desnaturalizante SDS-PAGE luego que la reacción
finalizó (no mostrado). C, Gel de retardo entre TcUBP1 o TcUBP-2 (~ 2 μM) y el ARN P1 en ausencia o en
presencia de cantidades crecientes de TcPABP1, sin
tag GST. La posición de las formas monómero (M) y
dímero (D) se indican con flechas.
92
Resultados
La sobre-expresión de TcUBP-1 en epimastigotes afecta en forma selectiva la
estabilidad de ARNms TcSMUG.
Se analizó la sobre-expresión de TcUBP-1 y TcUBP-2 en la forma epimastigote de
T. cruzi, con el objetivo de determinar el efecto de estas proteínas en los niveles de ARNms
de TcSMUG y otros ARNms del parásito. Luego de la transfección de las construcciones
pRIBOTEX (pR, vector sin inserto) y pRIBOTEX-TcUBP-1 (pR-TcUBP-1), se seleccionaron
poblaciones transformantes y se trataron con el inhibidor de la transcripción ActD durante
diferentes tiempos (0, 2, 4 y 6 hrs) (ver Figura 40). De esta manera, se analizó por “Northern
blot” la vida-media de dos ARNms que contienen regiones ricas en Uridina en sus regiones
3’-NC, como TcSMUG-L y S, y transcriptos que carecen de tales regiones como ductina y
Hsp70 (Figura 40A). Los datos de densitometría del “Northern blot” se graficaron luego
de la normalización con el control interno de hibridización proveniente de la sonda ARNr
(Figura 40B). Se realizaron dos experimentos usando líneas celulares independientes,
las cuales se transfectaron y procesaron en forma separada. Los gráficos de la Figura
40B, se realizaron utilizando la media del valor de todos los experimentos, los cuales
difieren menos del 5% en cada uno de los puntos indicados. El tiempo inicial que muestra
la mayor señal, se tomó como el 100%
en todas las curvas, para permitir la
comparación de las vidas medias de
los diferentes ARNs. En el control
Tc
negativo, la población transfectada con
el vector pR, muestra que las tasas
de vida-media para TcSMUG-L y -S,
son 5.5 y 5.75 hrs, respectivamente
(Figura 40B). Estos valores de vidamedia son muy similares a los
obtenidos anteriormente para los
ARNms endógenos, sin ninguna
transfección (ver Figura 10). Por lo
contrario, la tasa de decaimiento de
TcSMUG en las poblaciones que
expresan TcUBP-1 (pR-TcUBP-1), fue
mayor. Para TcSMUG-S la vida-media
es de 3 hrs, lo cual representa un 54%
de la vida-media en la población pR, y
para TcSMUG-L, la vida-media es de
3.75 hrs lo cual representa el 65% de
la tasa en la población pR. También
se analizó la vida-media de los
transcriptos para ductina y Hsp70, los
cuales no presentan ni elementos AUni GU- en sus regiones 3’-NC. Ninguno
de estos dos transcriptos se afectó por
la sobre-expresión de TcUBP-1 (Figura
Figura 40 - La sobre-expresión de TcUBP-1 en
epimastigotes desestabiliza en forma selectiva,
ARNms conteniendo elementos ARE. A, Ensayo de
“Northern blot” sobre ARN total proveniente de
poblaciones de epimastigotes transfectadas con vector
(pR) o sobre-expresando TcUBP-1 (pR-TcUBP-1), tratados
con ActD 10 μg/ml. El mismo filtro fue secuencialmente
hibridizado con las sondas correspondientes a TcSMUG,
ductina, Hsp70 y ARNr. B, Cuantificación de los niveles
de ARNm de los diferentes ensayos de Northern blot del
panel A, normalizados a los niveles de ARNr. Los datos
se expresaron como la cantidad de ARNm relativa a la
media, +/- el error estándar de la media (n=2), en cada
punto experimental luego de la corrección con la señal
proveniente del ARNr. Las diferencias entre pR y pRTcUBP-1 son significativas cuando se compara la media
a partir de un test t de Student (*, p < 0.05;**, p < 0.01).
93
Resultados
40B). La vida-media del ARNm para ductina es de 1.5 y 1.65 hrs en parásitos transfectados
con pR y pR-TcUBP-1, respectivamente; mientras que la vida-media del ARNm para
Hsp70 es de 5.2 y 4.8 hrs en las poblaciones pR y pR-TcUBP-1, respectivamente.
Las transfecciones con el vector pR-TcUBP-2 desgraciadamente fueron negativas,
en el sentido de que ninguna de las poblaciones se recuperó luego de la selección con el
antibiótico utilizado. Estas transfecciones se realizaron en paralelo con otras y además
en repetidas ocasiones, por lo que puede descartarse un error técnico. Es posible que la
sobre-expresión de TcUBP-2 en epimastigotes de T. cruzi, tenga un efecto deletereo en el
crecimiento de los parásitos.
Modelo de las interacciones proteína-proteína en el ARNm TcSMUG durante el
desarrollo del parásito.
Los resultados obtenidos durante esta tesis se pueden resumir en un modelo, que
en forma preliminar, puede ser la base para la caracterización de una vasta red de
interacciones proteína-proteína en el ARNm de TcSMUG, en los distintos compartimentos
subcelulares y durante el desarrollo del parásito (Figura 41). Como se describió
anteriormente, existen diferentes proteínas que reconocen a los elementos ARE y GRE, y
que regulan la estabilidad del ARNm TcSMUG. En primer lugar, la unión de eAREBP al
ARNm es mediada por el elemento ARE localizado en el 3’-NC. Esta unión puede prevenir
la asociación de factores desestabilizantes al ARNm, posiblemente a través de la
competencia por la unión a elementos en cis- similares. Además, eAREBP puede ser una
de las proteínas involucradas en la modulación de la traducción, probablemente a través
de su interacción con otros factores pertenecientes al aparato de síntesis de proteínas de
la célula. Los resultados obtenidos a partir del fraccionamiento subcelular de la forma
epimastigote indican que eAREBP está localizada en el citoplasma o sólo reconoce el
ARN en este compartimento celular, donde ocurren la degradación del ARN y/o su
traducción. Experimentos futuros de “Western blot”, permitirán determinar si eAREBP
está también presente en el núcleo; y de esta manera, es reclutada por algúna(s) proteína(s)
que formen parte de un complejo que impida la interacción con el ARE. Se sabe que
eAREBP está presente en forma soluble en el citoplasma, aunque quizás también pueda
formar parte de algún complejo ribonucleoproteico que no se detecte su actividad a
partir de los ensayos de retardo en gel. Además, la proteína eAREBP no se detecta en los
demás estadíos, aunque sí existen otras proteínas de unión al ARE (tAREBPs) en
tripomastigotes. Se describió que tAREBPs son al menos dos polipéptidos de entre 4550kDa y que a diferencia de eAREBP se detectan en núcleo y citoplasma.
El elemento ARE también interacciona “in vitro” e “in vivo” por dos miembros de
una familia de proteínas de unión a ARN (TcUBP-1 y TcUBP-2). Se realizaron varios
intentos para determinar si existe asociación entre estos dos factores y las proteínas
AREBPs; sin embargo, parecen formar parte de complejos proteícos independientes dentro
de la célula. Por su parte, Tcubp-1 se expresa como 2 posibles isoformas, TcUBP-1 de
27kDa y TcUBP-1m de 45kDa. Su sobre-expresión ocasiona la desestabilización de ARNms
con secuencias ARE en su región 3’-NC, como es el caso de TcSMUG-L y TcSMUG-S. Sin
embargo, no se sabe cuál de estas dos isoformas o si las dos están involucradas en el
proceso de desestabilización de ARNms. Se sabe que las proteínas están presentes en
94
Resultados
compartimentos similares, incluyendo el citoplasma y los polisomas más específicamente,
aunque no son proteínas nucleares. TcUBP-1, a diferencia de su isoforma modificada no
sólo está en polisomas sino que también localiza en forma soluble en el citosol. Por su
parte, TcUBP-2 localiza en el citoplasma, pero también en la fracción nuclear. TcUBP-1,
es capaz de formar complejos ribonucleoproteicos con TcPABP1 y también con TcUBP-2,
lo cual sugiere un papel en la regulación de la estabilidad de ARNms.
Figura 41 - Modelo de las interacciones ARN-proteína y proteína-proteína, reportadas en el
ARNm TcSMUG durante el desarrollo del parásito. Ver texto para detalles.
Dentro del complejo nativo identificado, TcUBP-1 dimeriza con TcUBP-2 en el
estadío epimastigote solamente, y esta asociación diferencial puede regular el destino de
los ARNms en forma estadío específico. Más aún, TcUBP-1 es capaz de interaccionar con
TcPABP1 en forma dependiente del ARN y en ausencia de TcUBP-2 puede producirse su
desplazamiento del ARN. Esto sugiere que TcUBP-2 presenta un rol regulador en la
estabilidad y formación del complejo. Las proteínas AREBPs se detectan fácilmente en
geles de retardo, mientras que las proteínas TcUBPs no, lo cual sugiere que estas proteínas
están interaccionando fuertemente con el ARN “in vivo”; por lo tanto, no se pueden
detectar “in vitro” con esta metodología. Además, no se sabe si existe coordinación en la
interacción con el ARN o si las mismas interaccionan directamente en el parásito. Es
evidente que es necesario clonar el gen que codifica eAREBP, lo cual permitirá obtener
anticuerpos necesarios para resolver alguna de estas cuestiones.
Las proteínas que reconocen al elemento GRE se expresan en forma constitutiva
durante el desarrollo del parásito. Como se determinó, estas proteínas están presentes
en ambos compartimentos subcelulares, núcleo y citoplasma. Por lo tanto, es probable
95
Resultados
que puedan proteger al ARNm durante su transporte al citoplasma. En el futuro se debe
investigar la posibilidad de que exista un complejo proteíco mediado por proteínas que
reconozcan al ARE y al GRE y también a la cola de poli(A), u otros factores celulares que
impidan el ataque del ARNm por componentes del exosoma, endo- o exo-nucleasas.
96
Resultados
PARTE 5 - Análisis Estructural de las Proteínas TcUBPs. Ensayos de Dinámica
Molecular.
Uno de los objetivos generados durante el desarrollo de esta tesis fue intentar
resolver la estructura en solución de las proteínas TcUBPs, realizar ensayos de dinámica
molecular y comparar la forma en que proteínas con dominios RRM simples y múltiples
interaccionan con el ARN. Para ello, se estableció una colaboración con el Dr. Kalle
Gehring (Dept. of Biochemistry, McGill University, Montreal, Canadá), y realicé una
pasantía de tres meses en su laboratorio durante el primer semestre del 2002.
Marcado isotópico y análisis de los espectros de correlación heteronuclear simple
H-15N HSQC.
1
Las proteínas utilizadas para los marcados isotópicos fueron TcUBP-1ΔQ, TcUBP1ΔQG1 y TcUBP-2ΔC, ya que las proteínas enteras TcUBP-1 y TcUBP-2 presentan regiones
sin plegamiento aparente en el C-terminal, lo cual significaría la producción de espectros
de baja resolución y complicados de analizar. Para tal fin, se crecieron bacterias en
presencia del medio mínimo M9 suplementado con 15N-NH Cl. Para las proteínas GST4
TcUBP-1ΔQ y GST-TcUBP-1ΔQG1 fue suficiente con preparar 1,5 litros, mientras que
para GST-TcUBP-2 se prepararon ~5 litros de medio de cultivo, debido a los bajos niveles
de rendimiento en la inducción obtenidos con esta proteína. El protocolo de inducción y
de preparación de las proteínas sin el “tag” GST se detalla en la sección Materiales y
Métodos.
En la Figura 42 se muestran los espectros 1H-15N HSQC tomados a 500 MHz
sobre las tres proteínas uniformemente marcadas con 15N. En la proteína TcUBP-1ΔQG1
se pueden identificar ~126 picos de los 130 esperados porque 9 aminoácidos son Prolina.
En TcUBP-1ΔQ se observan ~128 de los 145 residuos esperados, porque 11 son Prolina.
Por su parte, en TcUBP-2ΔC se observan ~120 de 131, porque 11 corresponden a residuos
de Prolina. Esto significa que algunos picos correspondientes a ciertos residuos, no
aparecen en las condiciones que se muestran en este experimento; ni tampoco en muchas
otras condiciones evaluadas en las cuales se varió el pH de la muestra, la temperatutra
en la que se tomaron los espectros, la fuerza iónica, entre otros (resultados no mostrados).
En resumen, en los tres espectros se observa un núcleo central correspondiente a los
residuos pertenecientes a porciones no plegadas de la proteína (ver más adelante), pero
también regiones plegadas a la izquierda y rodeando el núcleo central. En la parte superior
derecha de los espectros, se observan las cadenas laterales de las Glutaminas (~110
ppm 15N y ~7 ppm 1H), las cuales muestran dos picos a la misma altura correspondientes
a ambos protones de la amida. Estos presentan resonancias diferentes para el mismo
desplazamiento del N. Por último, se muestran las asignaciones de las resonancias de la
proteína TcUBP-1ΔQG1 (Figura 42A), según se determinó en los experimentos descriptos
más adelante (ver Figura 43).
Asignación de las resonancias de cadena principal en la proteína TcUBP-1ΔQG1.
La mayoría de las resonancias 1H-15N de las amidas de cadena principal de la
proteína TcUBP-1ΔQG1 se obtuvieron usando métodos de RMN bidimiensionales y
97
Resultados
tridimensionales. Estas resonancias se asignaron a la secuencia primaria de aminoácidos,
a partir de métodos que correlacionan las
resonancias de residuos adyacentes
usando acoplamientos J (“J couplings”)
a través de enlaces en la cadena
polipeptídica. Estas secuencias de pulsos
requieren que la muestra se marque
isotópicamente en forma doble (15N, 13C),
como así también la posibilidad de pulsar
tres canales de radiofrecuencia a la vez
(H, N y C). Para tal fin, la estrategia inicial
fue usar los experimentos descriptos:
CBCA(CO)NH y HNCACB (Constantine et
al., 1993; Grzesiek et al., 1992); ya que
la combinación de ambos experimentos
se sabe que funciona en forma muy
efectiva. Algunas de las correlaciones
disponibles a partir de estos experimentos
se indican en la Figura 43. Como se
observa, no se deter minaron las
correlaciones 1H-15N para los residuos
M1, Q124, R125, ni las Prolinas (ver
Figura 42A).
La posición de las resonancias en
el espectro 1H-15N HSQC de la proteína
TcUBP-1ΔQ, es idéntico al de TcUBP1ΔQG1, con la excepción de que 17
residuos adicionales se observan ya que
esta proteína es levemente más larga
(Figura 42B). Como se observa, el
espectro HSQC es complejo y hay
solapamiento de algunos picos debido al
gran número de residuos y al área que
ocupan los mismos. En la Figura 43A, se
muestra los acoplamientos a través de
enlaces obtenidos a partir de los
Figura 42 - Espectro 1H-15N HSQC de las proteínas
TcUBPs libres en solución. Se muestran los espectros
de correlación cuántica simple heteronuclear de las
proteínas isotópicamente enriquecidas con 15N. A,
TcUBP-1ΔQG1. B, TcUBP-1ΔQ. C, TcUBP-2ΔC. Se indica la posición de la mayoría de las resonancias
asignadas para las amidas de la proteína TcUBP1ΔQG1. En el panel A se muestra una ampliación de
la región central del espectro con las asignaciones
respectivas. Las resonancias de las amidas de las
proteínas TcUBP-1ΔQ y TcUBP-2ΔC no fueron
asignadas.
98
experimentos
de
correlación
tridimensional. En la Figura 43B se
muestra el grupo de tiras provenientes
del experimento HNCACB de las regiones
comprendidas entre los residuos Y13Q18 y G127-Y138. Se observa claramente
el alto contenido de Glicinas, con una
resonancia característica para el Cα de
Resultados
45 ppm y sin Cβ, lo cual facilitó la identificación de los residuos correspondientes. Otro
rasgo característico es la presencia de Alaninas, cuyo Cα tiene una resonancia
característica de ~18 ppm (Figura 43B). En la misma Figura se muestran las tiras
correspondientes al experimento CBCA(CO)NH de los mismos residuos del panel B, el
cual permite corroborar las asignaciones realizadas a partir del HNCACB (Figura 43).
Otros de los experimentos realizados para establecer asignaciones de las resonancias
fueron: HNCO, HNCA, HN(CO)CA, (H)CCH-COSY, TOCSY-HSQC, NOESY-HSQC, HTOCSY-CONH y C-TOCSY-CONH (ver Tabla 7). Todos estos experimentos emplean un
número mínimo de pasos de transferencia de la magnetización y permiten obtener
constantes de acoplamientos J altas, es decir de gran utilidad. Como era de esperar, el
experimento HNCO fue el de mayor sensibilidad, con ~90% de las correlaciones de los
grupos carbonilos observadas. Las correlaciones para 1H -1H se obtienen a partir del
N
α
experimento 15N-TOCSY HSQC, aunque la sensibilidad obtenida con el mismo no fue
muy buena debido a la constante de acoplamiento J baja.
Figura 43 - Experimentos de
correlación 3D HNCACB sobre
la muestra 15 N- 13 C TcUBP1ΔQG1. La proteína TcUBP1ΔQG1
se
enriqueció
isotópicamente con 15N y 13C en
medio mínimo M9. Las
resonancias de cadena principal se asignaron usando
métodos que correlacionan
resonancias a través de
residuos adyacentes usando “J
couplings”. A, Las correlaciones
disponibles de los experimentos
3D se muestran en for ma
esquemática. B, Juego de tiras
de los residuos Y13-Q18 y
G127-Y138 asignados a partir
de la comparación de las
resonancias
de
los
experimentos HNCACB y
CBCA(CO)NH. Se muestra la
posición característica del Cα
de las Glicinas con una
resonancia de ~45 ppm y la
ausencia de Cβ. Los residuos de
Alanina
presentan
desplazamientos característicos
para el Cα (~ 18 ppm).
Predicción de la estructura secundaria.
La estructura secundaria de TcUBP-1ΔQG1 se dedujo a partir del patrón de
99
Resultados
desplazamientos químicos correspondientes a los Cα y Cβ ya descriptos (Wishart and
Sykes, 1994). La posibilidad de identificar estructuras secundarias a partir de los patrones
de las diferencias entre los desplazamientos químicos observados y esperados para un
“random-coil”, se documentó previamente (Wishart et al., 1995a; Wishart et al., 1995b).
Las diferencias identificadas para 13Cα y 13Cβ se usaron para calcular un índice de
desplazamiento químico (CSI o “Chemical Shift Index”), el cual se muestra en la Figura
44A. Debido a que no se observaron todos los desplazamientos químicos para 13Cα , el
CSI calculado no es estrictamente el mismo que se presentó originalmente (Wishart and
Sykes, 1994). Las hélices-α y las hojas-β se indican a partir de un continuo de valores
consenso +1 y -1 para Cα, respectivamente. Lo contrario, es decir desviaciones positivas,
son atribuídas a hojas-β en el caso de desplazamientos químicos para Hα y Cβ (resultado
no mostrado). De esta manera, la topología observada para esta proteína, βαββαβ, es
característica de los dominios de unión a ARN del tipo RRM. Aparentemente, las regiones
N- y C-terminales del dominio RRM no tienen un plegamiento esperado a partir del CSI
(Figura 44A). A partir de ello, se decidió realizar un experimento NOE-heteronuclear
sobre la proteína 15N-TcUBP-1ΔQG1 con el objetivo de confirmar cuáles regiones están
plegadas (Figura 44B). En esa figura, claramente se observa que el plegamiento existe
entre los residuos ~40 (hoja-β1) hasta ~120 (final hoja-β4). Esto indica que las regiones
correspondientes a los extremos del dominio RRM incluyendo la región RV y porción Nterminal, no presentan plegamiento (Figura 44B).
Figura 44 - Indice de desplazamiento químico
(CSI) y ensayo NOE-Heteronuclear. A, Los
desplazamientos químicos para 13Cα y 13Cβ de
cada aminoácido, se compararon con los
desplazamientos químicos de cada aminoácido
en particular en un “random-coil”. Como se
define según Wishart et al., (1992), la diferencia
entre los valores para “random-coil” y de cada
aminoácido en la proteína puede indicar el
medio ambiente estructural para cada
aminoácido (hélice-α, hoja-β). El signo de la
diferencia observada, es función del elemento
estructural y la resonancia observada. Esto
permite hacer la mejor predicción de la
estructura secundaria a partir de los
desplazamientos químicos. B, El área de los
picos de cada residuo en un espectro 15N-13C
HSQC se calculó y comparó con el área
esperada, lo cual permite definir el NOEHeteronuclear para cada residuo de la proteína
TcUBP-1ΔQG1 a partir del cálculo (valor
obtenido/valor esperado). El signo, + o -,
representa que ese residuo está en un ambiente
plegado o “random-coil” respectivamente.
Detección de cambios en los desplazamientos químicos por la interacción con ARN.
Se realizaron experimentos 1H-15N HSQC para monitorear y determinar cambios
en los desplazamientos químicos en la proteína TcUBP-1ΔQG1 durante la interacción
con el ARN. Este método es muy sensible y permite detectar perturbaciones en el medio
ambiente de las amidas de cadena principal debido a la unión con el ARN. Los
desplazamientos químicos son generalmente sensibles a las perturbaciones de las cadenas
laterales conectadas, pero también son afectados por cambios conformacionales en la
100
Resultados
proteína, inducidos por la unión del ligando. Para tal objetivo se realizaron dos clases de
experimentos. En primer lugar, titulaciones con el ARN rico en Uridina P1, por el cual la
proteína TcUBP-1ΔQG1 tiene alta afinidad (ver Tabla 5) y en segundo lugar , titulaciones
con ARN poli(U) (Figura 45 y 46). Ambos resultados fueron comparados a partir de los
residuos que sufren perturbaciones por la unión del ARN. Para el experimento de titulación
con el ARN P1, se utilizaron diferentes relaciones molares proteína-ARN (1:0, 1:0.1, 1:0.2,
1:0.35 y 1:0.7). En la Figura 45, se observan los experimentos de 1H-15N HSQC de las
condiciones proteína-ARN 1:0 y 1:0.7, como casos extremos para ver los picos del espectro
que pueden moverse en presencia de ARN. Debemos mencionar que se pueden observar
cambios importantes en un residuo dado y eso puede ser interpretado de dos maneras
diferentes: (1) un cambio local en la conformación proteica que altera la magnetización
detectada en un núcleo en particular debido a nuevas modificaciones por los electrones
que lo rodean; y (2) que el residuo está involucrado en una interacción directa con el
ARN. Es interesante mencionar que varios residuos se desplazan en foma gradual a
partir de la titulación con el ARN P1, los cuales se indican en color rojo (Figura 45B).
Además, se muestra el gráfico de los valores absolutos de las diferencias de los
desplazamientos químicos de las formas libre o unida a ARN para las resonancias 1H y
15
N de las amidas de cada residuo (Figura 45C). Estas diferencias (indicadas como (Δ 15N-
Figura 45 - Espectro 1H-15N HSQC de la proteína TcUBP-1ΔQG1 libre o acomplejada con ARN. Los
espectros fueron tomados con la proteína libre en solución (A) o en presencia del ARN P1 (B). Sólo se
muestra en B el punto de mayor concentración de ARN (relación 1:0.7, proteína-ARN) como parte de un
proceso de titulación con el ligando (ver Texto). C, Gráfico en el cual se indican las perturbaciones de los
desplazamientos químicos para cada residuo (definido como el valor absoluto de las diferencias entre
proteína libre y proteína acomplejada). Las perturbaciones de los desplazamientos químicos para: 1H
(blanco) y 15N (negro) de las amidas de cadena principal se muestran en una misma barra para cada
residuo como (Δ 15N-1H δ (ppm)). La ubicación de los elementos de estructura secundaria se indica
encima del gráfico.
101
Resultados
H δ (ppm)) son consideradas como perturbaciones en los desplazamientos químicos
inducida por la interacción con el ARN. A partir del monitoreo de cada experimento de
1
titulación con ARN y la obtención de los espectros 1H-15N HSQC, los residuos de mayor
desplazamiento corresponden a los residuos siguientes: V41 y L45 en la hoja-β1; K73 y
V74 en la hoja-β2; R84, G87 y F88 de la hoja-β3; N111, R113 y K115 en la hoja-β4 y
A119 y A120 en el “loop” ubicado después de la hoja-β4 (Figura 45C). Sin embargo, de
todos estos residuos los de mayor desplazamiento corresponden a K73, V74, N111, K115
y A120.
El mismo experimento de titulación se realizó, utilizando ARN poli(U) como sustrato
ribonucleico (Figura 46). Las razones de proteína-ARN utilizadas fueron (1:0, 1:0.1, 1:0.2
y 1:0.5). De la misma manera que para la titulación con el ARN P1, aquí se muestran los
espectros con las relaciones molares 1:0 y 1:0.5 proteína-ARN, con los residuos que se
desplazan en color rojo en el segundo caso (Figura 46). Al igual que en la titulación con
el ARN P1, se determinaron los residuos de mayor desplazamiento a partir de las
perturbaciones en los desplazamientos químicos inducida por la interacción con poli(U).
Entre ellos se encontraron los siguientes residuos: D40, localizado antes de la hoja-β1;
V41, N44, L45, V47, N48 y Y49 en la hoja-β1; K73 y V74 en la hoja-β2; S83, R84, Y86 y
G87 de la hoja-β3; N111 y K115 en la hoja-β4; y L118, A119 y A120 en el “loop” ubicado
después de la hoja−β4 (Figura 46C). Sin embargo, de todos estos residuos los de mayor
desplazamiento corresponden a V41, L45, K73, V74 y N111.
Figura 46 - Espectro 1H-15N HSQC de la proteína TcUBP-1ΔQG1 libre o acomplejada con ARN poli(U).
Los espectros fueron tomados con la proteína libre en solución (A) o en presencia de ARN poli(U) (B). Sólo se
muestra en B el punto de mayor concentración de ARN (relación 1:0.5, proteína-ARN) como parte de un
proceso de titulación con el ligando. C, Gráfico en el cual se indican las perturbaciones de los desplazamientos
químicos para cada residuo (definido como el valor absoluto de las diferencias entre proteína libre y proteína
acomplejada). Las perturbaciones de los desplazamientos químicos para: 1H (blanco) y 15N (negro) de las
amidas de cadena principal se muestran en una misma barra para cada residuo como (Δ 15N-1H δ (ppm)). La
ubicación de los elementos de estructura secundaria se indica encima del gráfico.
102
Resultados
Este resultado demuestra claramente, que la mayoría de los aminoácidos que
muestran perturbaciones con el ARN P1, también lo hacen con ARN poli(U). La principal
diferencia observada, es que con este último sustrato algunos residuos de la hoja-β1 se
desplazan en mayor proporción que con el ARN P1 (Figura 46C). Además, con el ARN P1
los residuos de la hoja-β4 o los posteriores, como K115 y A120, se desplazan más que
con poli(U). En general, se observa que hay más movimiento de las resonancias en la
vecindad de las hojas-β que en las hélices-α, las cuales parecen no verse afectadas por la
interacción con el sustrato. Esto es consistente con observaciones previas que indican
que las hojas-β antiparalelas sirven como una superficie para la interacción con el ARN
(Gorlach et al., 1992; Kanaar et al., 1995). Varios de los residuos que se desplazan en el
dominio RRM de TcUBP-1 están compartidos en el primer dominio de unión a ARN de la
proteína Sxl de D. melanogaster (Handa et al., 1999) y son los involucrados en el
reconocimiento a través de “stacking” de ARN, contactos a partir del esqueleto proteico o
cadena lateral. En la Figura 47 se muestra un alineamiento entre el RRM de TcUBP1ΔQG1, U1A, los motivos RRM1 de Sxl y HuD. En esta Figura se compara la localización
de los residuos que se sabe hacen contacto con el ARN en las proteínas cuya estructura
fue resuelta en presencia del sustrato, con los datos de TcUBP-1ΔQG1 obtenidos a partir
de la titulación con ARN. De esta manera, se observa que la N44 en TcUBP-1ΔQG1
presenta la misma posición que la N130 en la hoja-β1 del RRM1 de Sxl. De manera
similar, en la hoja-β2 la K73 se reemplaza por R175 en Sxl, y ambos aminoácidos presentan
una carga neta positiva. En la hoja-β3, más específicamente en el dominio RNP1, la S83
se reemplaza por S165 y F88 por F170 en Sxl. En la hoja-β4 la N111 se reemplaza por la
N193 de Sxl. Aunque este residuo no interacciona con ARN en Sxl (Handa et al., 1999),
está conservado en posición en ambas proteínas, y por ende quizás tenga un rol importante
en mantener la estructura del dominio RRM. Por su parte, la R113 se reemplaza por la
Figura 47 - Alineamiento de secuencias y estructuras secundarias de los motivos RRM de TcUBP-1,
Sxl, U1A y HuD. Se indican los motivos RNP-2 y RNP-1 característicos del RRM, que forman parte de las
hojas-β1 y -β3 respectivamente. Las interacciones ARN-proteína de TcUBP-1ΔQG1 (obtenidas por
titulaciones con ARN), Sxl (Handa et al., 1999), U1A (Oubridge et al., 1994) y HuD (Wang et al., 2001), se
indican como sigue. Los aminoácidos involucrados en interacciones “stacking” con el ARN se muestran
en colorado. Los aminoácidos que reconocen el ARN con su cadena principal y cadenas laterales se
indican por cuadrados abiertos o llenos, respectivamente. El número entre paréntesis luego del nombre
de cada proteína significa la posición del aminoácido en la cual comienza el alineamiento.
103
Resultados
R195 y la K115 por K197 en el RRM1 de Sxl (Figura 47). Por último, después de la hojaβ4 la A120 se reemplaza por la R220 en Sxl; sin embargo, este cambio no es conservativo
(Figura 47).
A partir de la estructura tridimensional del RRM1 de Sxl y la estructura modelada
de TcUBP-1ΔQG1, se indica la posición de los residuos compartidos entre estas dos
proteínas desde el punto de vista de su interacción con el ARN (Figura 47). Si bien se
observa que TcUBP-1 y las proteínas comparadas presentan similitudes en cuanto a los
aminoácidos que hacen o pueden hacer contacto con el ARN (Figura 47 y 48), existen
algunas diferencias en la posición o el tipo de residuo que hace contacto. Por lo tanto,
estas diferencias podrían estar relacionadas con distintas formas de reconocimiento en
proteínas que presentan uno o más de un dominio del tipo RRM.
Figura 48 - Representación estructural
de las perturbaciones de los
desplazamientos químicos inducidos
por la unión del ARN. Comparación
entre Sxl-RRM1 y TcUBP-1. La
estructura del dominio RRM1 de la
proteína Sxl (Handa et al., 1999) y una
visión del modelo estructural de TcUBP1ΔQG1, se usan para marcar cada
dominio e indicar en rojo las regiones que
presentan las mayores perturbaciones en
los desplazamientos químicos inducida
por la unión del ARN, en el caso de
TcUBP-1, o regiones que contacten con
el ARN en el caso de Sxl.
104
DISCUSION
Discusión
Durante esta tesis doctoral se describieron componentes relacionados con la
regulación a nivel post-transcripcional de la familia de mucinas TcSMUG. Además, se
identificaron y caracterizaron, desde el punto de vista funcional-estructural, una familia
de proteínas de unión a ARN involucradas en la regulación de la estabilidad de TcSMUG.
Los puntos más interesantes que surgen del análisis de los resultados obtenidos son:
(1) La familia de mucinas del grupo TcSMUG se regula a nivel post-transcripcional
a partir de mecanismos de control de la vida-media de sus ARNms en las distintas
etapas del ciclo de vida del parásito.
(2) Existen elementos en cis- localizados en la región 3’-NC de TcSMUG, que están
involucrados en procesos de estabilización y desestabilización del ARNm durante
el desarrollo del parásito.
(3) La identificación de factores en trans- que reconocen los elementos en cis-, y que
están involucrados en el mismo camino de regulación de la estabilidad.
(4) La purificación bioquímica parcial de la proteína de ∼100kDa eAREBP y su análisis
por espectrometría de masas MALDI-TOF.
(5) La caracterización de dos miembros de una gran familia de proteínas de unión a
ARN, TcUBP-1 y TcUBP-2, en términos de los sustratos ribonucleicos que
reconocen “in vitro”.
(6) La descripción del rol funcional de la proteína TcUBP-1 en la desestabilización
de TcSMUG cuando se sobre-expresa en el estadío epimastigote.
(7) Las interacciones proteína-proteína de las cuales forman parte las proteínas
TcUBPs en el complejo ribonucleoproteico identificado.
(8) La caracterización estructural preliminar por RMN de las proteínas TcUBPs.
(9) Estudios de interacción proteína-ARN a partir de ensayos de dinámica molecular.
Regulación post-transcripcional de TcSMUG y elementos involucrados.
La familia TcSMUG está compuesta por dos grupos de ARNms llamados TcSMUGL y TcSMUG-S, los cuales se regulan a nivel post-transcripcional durante el desarrollo
del T. cruzi. Mientras que la tasa de inicio de transcripción de ambos grupos es muy
similar entre los estadíos epimastigote y tripomastigote, los niveles estacionarios de ARNm
son claramente diferentes (Figura 8). A partir de ensayos de inhibición de la transcripción
~ 6 hrs en el estadío
con ActD, se demostró que TcSMUG tiene una vida-media t
1/2
epimastigote (Figura 10), mientras que en tripomastigote TcSMUG es de vida-media corta,
t < 0.5 hr (Figura 11). Esto demuestra que la estabilidad de los ARNms TcSMUG se
1/2
regula durante los diferentes estadíos del ciclo de vida del parásito y que por ende, deben
existir elementos en cis- involucrados en este proceso regulatorio. Ambos grupos de
ARNms (TcSMUG-L y -S) presentan una región 5’-NC conservada entre sí, mientras que
el 3’-NC es más variable en secuencia y tamaño, con bloques específicos en cada ARNm,
como es el retrotransposón SIRE (Vázquez et al., 1994), el cuál esta presente sólo en el
grupo TcSMUG-L. Otros elementos del 3’NC sin embargo, están presentes en ambos
ARNms (ver más adelante). Debido a la complejidad del sistema se decidió continuar
trabajando sólo con el grupo TcSMUG-L, con el objetivo de identificar elementos
106
Discusión
involucrados en la regulación de la estabilidad durante el desarrollo de T. cruzi. A partir
de las construcciones de deleción del 3’-NC de TcSMUG-L (Figura 12), y los experimentos
de transfección, se identificaron elementos que regulan la estabilidad del ARNm TcSMUGL en los estadíos epimastigote y tripomastigote. En primer lugar, se identificó el elemento
GRE, presente en ambos grupos TcSMUG-L y -S. Este elemento está compuesto por 27
nt después del codón de terminación de la traducción y contiene dos pentámeros contiguos
del tipo CGGGG. A partir de ensayos de “Northern blot” de las poblaciones transfectantes,
se determinó que GRE funciona como un elemento regulador positivo sólo en el estadío
epimastigote (Figura 14). En segundo lugar, se demostró que la deleción de otro elemento,
denominado E1 y localizado entre los nt 28 y 62 del 3’-NC aumenta la vida-media del
ARNm cat utilizado como reportero. Estos resultados sugieren que E1 actúa como un
elemento negativo en la estabilidad del ARNm (Figura 13). En tercer lugar, la deleción del
elemento ARE tiene un efecto estadío específico (ver más adelante). Finalmente, la deleción
de los 450 nt que componen SIRE, produce el mismo efecto negativo que la ausencia de
E1 en el 3’-NC, pero debido al gran tamaño de este elemento, es necesario realizar más
experimentos de deleción para confirmar y mapear específicamente el dominio involucrado
en este proceso regulatorio. Previamente, se demostró en otro laboratorio que SIRE es
responsable de la regulación en forma negativa de la expresión de los genes que codifican
las proteínas ribosomales TcP2β, y actúa alterando la eficiencia del trans-“splicing”
(Vázquez et al., 1994). Ya que la localización del SIRE en diversos ARNms es variable
(Vázquez et al., 2000), es posible que cumpla funciones diferentes según su posición en
la región codificante o no codificante. Además, es posible que la reducción del largo de la
región 3’-NC, por deleción del SIRE, tenga un efecto negativo en la traducción (Figura
15). En resumen, durante ésta tesis se identificaron dos elementos funcionalmente
opuestos (ARE y GRE) en el ARNm de TcSMUG-L (Figura 14). Por un lado, el elemento
ARE está involucrado en la desestabilización del ARNm en el estadío tripomastigote,
pero su deleción no afecta el destino del ARNm en el estadío epimastigote. Estos resultados
confirman la idea de que las proteínas que reconocen al ARE en epimastigote, pueden
proveer resistencia a endo- o exo-nucleasas. Por otro lado, a diferencia del ARE, el elemento
GRE genera un efecto en la estabilidad de TcSMUG durante el desarrollo del parásito.
Este elemento puede incrementar la abundancia del ARNm en el estadío epimastigote,
ya que la deleción del 3’-NC genera un transcripto más lábil en términos de estabilidad
(Figura 14).
La presencia del ARE en el 3’-NC del ARNm, también es capaz de modular la tasa
traduccional en forma positiva, mientras que GRE no tiene un efecto considerable en tal
proceso (Figura 15). Esto sugiere que ambos elementos coordinan en forma cooperativa,
la regulación de la abundancia del ARNm TcSMUG en epimastigotes, pero no la traducción.
La interacción de elementos negativos y positivos en forma coordinada, se observó para
elementos localizados en el 3’-NC de ARNms de las prociclinas de los tripanosomas
africanos. Estos elementos afectan tanto la abundancia del ARNm como su tasa
traduccional (Furger et al., 1997). En nuestro sistema, el elemento E1 tiene un efecto
dual negativo en ambos procesos regulatorios (Figura 15). En resumen, se sugiere que
un elemento simple, como ARE o E1, presente dos funciones diferentes pero quizás
acopladas dentro del camino de regulación de la expresión. De la misma manera, se
107
Discusión
demostró que secuencias ARE en el 3’-NC del ARNm tnf-α afectan también ambos procesos
regulatorios de estabilidad y traducción del ARNm (Carballo et al., 1998; Lai et al., 1999;
Xu et al., 1997).
Proteínas que reconocen los elementos regulatorios de TcSMUG.
Proteinas de unión al GRE y al ARE.
La coordinación de la expresión de TcSMUG a nivel post-transcripcional permite
generar un modelo en el que existen factores que interaccionan “in vivo” con ARE y GRE
y formen parte del mismo camino regulatorio. A partir de la resolución de complejos
ARN-proteína por geles nativos, se demostró la existencia de factores capaces de reconocer
ambos elementos (Figura 16 y 18). Por un lado, se identificaron tres complejos de unión
al elemento GRE, los cuales se expresan en forma constitutiva a lo largo del desarrollo
del parásito. Los dos primeros complejos (GRE-1 y GRE-2) se compiten en forma específica
y eficiente con ARN poli(G) (Figura 17). A partir de ensayos de entrecruzamiento, se
determinó que el complejo GRE-1 está compuesto por un polipétido de ~80kDa, mientras
que varios factores de masas aparentes 35, 39 y 66kDa componen el complejo GRE-2
(Figura 16). Por otro lado, el elemento ARE interacciona con proteínas cuya expresión
está regulada durante el desarrollo del parásito (Figura 18). La proteína de ~100kDa
eAREBP interacciona con el ARE en epimastigotes solamente, mientras que en los demás
estadíos, al menos dos polipéptidos de entre 45-50kDa, denominados tAREBPs, reconocen
al ARE (Figura 18).
Es evidente que la presencia de complejos ribonucleoproteicos es capaz de regular
la expresión de ARNms en forma coordinada dependiendo de las proteínas que lo
componen o de las interacciones proteína-proteína generadas durante las distintas etapas
del desarrollo. Debido a la rápida desestabilización de TcSMUG-L en tripomastigotes, la
cual es ocasionada por la presencia del elemento ARE en el 3’-NC, es posible que una
interacción coordinada entre las proteínas de unión al GRE y al ARE esté regulada en el
parásito. Los resultados obtenidos a partir del fraccionamiento subcelular demuestran
que la proteína eAREBP se localiza en el citoplasma o sólo está accesible para reconocer
el ARN en este compartimiento subcelular. A diferencia de ello, las proteínas tAREBPs
están presentes en cantidades equivalentes en núcleo y citoplasma (Figura 20), hecho
que permite sugerir que las proteínas tAREBPs transportan ARNms entre ambos
compartimientos. Varias proteínas en otros tipos celulares, tienen la capacidad de
translocarse entre núcleo y citoplasma (Fan and Steitz, 1998; Loflin et al., 1999; Shyu
and Wilkinson, 2000). En algunos casos se describió que existen estímulos extracelulares
capaces de regular su capacidad intrínseca de movilización como es el estrés por calor
(Gallouzi et al., 2000). En tripanosomas, por su parte, se identificó que existen proteínas
como la proteína de unión a ARN homóloga a La y la histona del tipo H2B, las cuales
presentan una señal de localización nuclear clásica rica en Lisina, involucrada en el
transporte de proteínas del citoplasma al núcleo (Marchetti et al., 2000). De la misma
manera, es posible pensar que existan proteínas con señales del tipo NES involucradas
en el transporte de ARNms del núcleo al citoplasma. Evidencias recientes en nuestro
laboratorio indican que el transporte de proteínas del núcleo al citoplasma está presente
en tripanosomas. Además, el crecimiento de los parásitos en cultivo axénico es sensible
108
Discusión
a la droga leptomicina B, la cual bloquea el transporte de ARNms mediado por el receptor
CRM1/Xpo1. Este receptor se identificó y estudió en T. cruzi y T. brucei y además, se
demostró su localización nuclear (D’Orso et al., resultados no publicados). Por lo tanto,
la caracterización de este receptor, así como también de las proteínas que interaccionan
con éste, es de suma importancia para el estudio de mecanismos de control de la
estabilidad de ARNms mediado por el transporte al citoplasma.
Proteínas TcUBPs e interacción con ARN.
El segundo enfoque utilizado para identificar proteínas que interaccionan con el
elemento ARE de TcSMUG, fue la búsqueda en la base de datos de EST y GSS de T. cruzi,
de homólogos de las proteínas de unión al ARE de eucariotas superiores, como HuR (Fan
and Steitz, 1998). Las proteínas identificadas utilizando este enfoque son las que
denominamos TcUBP-1 y TcUBP-2. En esta tesis se obtuvieron evidencias que indican
que ambas proteínas presentan un motivo idéntico del tipo RRM con regiones N- y Cterminales auxiliares diferentes (Figura 25). La región C-terminal de TcUBP-1 se divide
en dos porciones, una región corta rica en Glicina y un dominio “random-coil” rico en
Glutamina (Figura 25 y 44). A diferencia, la región C-terminal de TcUBP-2 presenta una
región rica en Glicina levemente más larga y con tres motivos YGG solapados y carece
del dominio rico en Glutamina (ver Figura 25).
A partir de experimentos de retardo en gel se demostró que ambas proteínas
tienen la capacidad de interaccionar con el elemento ARE en reacciones de unión ARNproteína. Si bien el ARE de TcSMUG-L es reconocido “in vitro” por TcUBP-1, esta
interacción no es de alta afinidad (K ~ 5 μM). Sin embargo, TcUBP-1 es capaz de regular
d
la estabilidad de TcSMUG-L “in vivo” (ver Figura 41); por lo cual se sugiere que algún
otro componente o modificación post-traduccional de TcUBP-1, se requiera para tal
fenómeno. Se observó a partir de reacciones de unión “in vitro” que tanto TcUBP-1 como
TcUBP-2 reconocen el elemento ARE de TcSMUG-S con alta afinidad (K ~ 500 nM) y
d
además, reconocen elementos ricos en Guanosina-Uridina (GU), presentes en regiones
3’-NC de varios transcriptos de T. cruzi (K ~100-200 nM) (Tabla 4). Es evidente que las
d
proteínas eAREBP, TcUBP-1 y TcUBP-2 presentan, al menos cualitativamente, patrones
similares de reconocimiento de sustratos de ARN “in vitro” (ver Tabla 6). Por lo tanto, se
puede sugerir que las tres proteínas son capaces de competir “in vivo” por la unión al
mismo sustrato ribonucleico.
Comparación de las proteínas TcUBPs con proteínas con múltiples motivos RRM.
Los experimentos de RMN realizados durantes ésta tesis (ver Tabla 7) y la
determinación preliminar de la estructura de TcUBP-1 (ver Figura 47 y 48), permiten
sugerir que ambas proteínas presentan una topología βαββαβ característica de las
proteínas con motivos RRM. De alguna manera, esto puede explicar porqué las dos
proteínas presentan constantes de disociación similares para los ARN utilizados en los
experimentos de retardo en gel (Tabla 4). Aunque el dominio RRM es idéntico entre
TcUBP-1 y TcUBP-2, la extensión C-terminal del RRM, denominada región RV, es diferente
entre ambas proteínas (Figura 25) y su deleción produce un incremento en la constante
aparente de disociación (Tabla 5). De manera similar, un estudio bioquímico y
109
Discusión
espectroscópico del dominio RRM de la proteína U1A, sin su extensión C-terminal, muestra
que presenta la misma topología βαββαβ que la proteína entera. Sin embargo, es incapaz
de interaccionar con ARN (Lu and Hall, 1995). Esto demuestra que los residuos del Cterminal del RRM están involucrados en la estabilidad de la estructura de la proteína en
su forma libre (Avis et al., 1996). Otro ejemplo se observa en la proteína hnRNP D, en
donde la región C-terminal del dominio RRM2 confiere alta afinidad para la unión con el
ARE (DeMaria et al., 1997). Este fenómeno sugiere que aquellos residuos localizados en
la región RV pueden ser importantes para conferir estabilidad al complejo ARN-proteína
a partir de una interacción con los residuos de las hojas β1β3 que reconocen el ARN.
ARN
Secuencia
eAREBP
TcUBP-1
TcUBP-2
SMUG-L-ARE-as
UAAAAAUAAAUAAAUCAAAACAACAUUAAAUAAAUUUUAAAAUUA
-
-
-
SMUG-L-ARE-se
U AAUUUUAAAAUUUAUUUAAUGUUGUUUU GAUUUAUUUAUUUUU
+
+
+
SMUG-L-ARE-1
AUUUAUUUAAUGUUGUUUUGAUUUAUUUAUU
+
+
+
SMUG-L-ARE-2
UUAUUUAUU
-
-
-
SMUG-L-ARE-3
U UUUAUUUAUUUU
+
+
+
HEX-T-ARE
AUUUAUUUAUUUA
-
-
-
PLC-ARE
AUAUAUAUAUAUAUAUAUAUAUAUUUAUUUAUUU
-
-
-
SMUG-S-ARE
AUUUUAUUUUUAUUUUUA
++
++
++
P1
GUUUUGUUUUUGUUUUUG
++
++
++
P2
AUGUUGUUGUUGUUGUUG
+
+
+
P3
AUGGUGUUGGUGUUGGUG
-
-
-
P4
AUAUUAUUAUUAUUAUUA
+
-
-
P1-GGG
GUUUUGUUUUUGUGGGUG
nd
++
++
Tabla 6 - Comparación cualitativa de los resultados obtenidos en ensayos de unión “in vitro”
entre distintos sustratos ribonucleicos y eAREBP, TcUBP-1 o TcUBP-2. Se muestra cada ARN con
su secuencia y el resultado de la interacción en un ensayo de unión “in vitro”, según comparación de los
resultados obtenidos. El signo (-, +, ++, representa en forma cualitatva el resultado del ensayo). nd, no
determinado.
Un rasgo interesante es la estructura modular de los motivos RRM de las proteínas
de unión a ARN en células de eucariotas superiores. Estas proteínas presentan múltiples
dominios RRM y su composición es la que determina la afinidad final por el ARN. El
primer motivo (RRM1), es el más importante en términos de afinidad y especificidad. Sin
embargo, los demás motivos RRM tienen funciones accesorias tales como oligomerización
y localización (Perez et al., 1997), estabilidad de la estructura en solución (Avis et al.,
1996) e interacción proteína-proteína (Khaleghpour et al., 2001). El análisis de mutantes
de deleción de la proteína HuR, la cual presenta 3 motivos RRM, permitió sugerir que el
RRM1 es crítico para la interacción con la secuencia ARE, pero que por lo menos un
motivo RRM adicional es requerido para alcanzar una constante de disociación en el
rango nanomolar (Park et al., 2000). Se sabe que cualquier combinación de dos de los
tres dominios RRM de la proteína HuR es suficiente para alcanzar una interacción fuerte
con el elemento ARE del ARN c-fos “in vitro”. Además, dos dominos RRM, siempre y
cuando se incluya el RRM1, pueden estabilizar c-fos “in vivo” de una manera comparable
a la proteína entera (Chen et al., 2002). En la proteína hnRNP D, ambos motivos RRM1
y RRM2 son importantes para determinar la afinidad por el ARE, aunque no son suficientes
para alcanzar la afinidad de la proteína entera (DeMaria et al., 1997). Es importante
110
Discusión
concluir que algunas proteínas de unión a ARN requieren sólo un motivo RRM para
alcanzar la afinidad y especificidad necesarias para la interacción, como es el caso de la
proteína U1A involucrada en “splicing” (Klein Gunnewiek et al., 2000). Sin embargo,
otras proteínas requieren por lo menos dos (Park et al., 2000) u ocasionalmente más
dominios o superficies de interacción (Perez-Canadillas and Varani, 2001). Algunos rasgos
comunes emergen a partir de la comparación de las estructuras con motivos RRM en
“tandem”, tal es el caso de Sxl (Handa et al., 1999) y PABP1 (Deo et al., 1999). Cada una
de estas proteínas presentan conectores entre los motivos RRM, de aproximadamente 811 residuos. Estas regiones son de gran mobilidad en la proteína libre, y permiten que
los dos dominios sean estructuralmente independientes (Crowder et al., 1999). En esta
tesis, se demuestra que las proteínas TcUBPs conteniendo un sólo motivo RRM pueden
unirse al ARN con gran afinidad y también pueden dimerizar por la región flexible rica en
Glicina (ver más adelante). Este fenómeno, puede estar relacionado con la producción de
un dímero en el cual ambas mitades sean independientes. De este modo, una mayor
afinidad de reconocimiento del ARN puede lograrse “in vivo” a través de la dimerización,
y permitiendo la unión simultánea de dos motivos RRM al ARN.
Rol de la región rica en Glicina en la dimerización de las proteínas TcUBPs.
La homodimerización, un fenómeno común para los factores transcripcionales de
las células procariotas, en eucariotas se extiende hacia la heterodimerización. Esta
posibilidad de interacción proteína-proteína, aumenta el rango de secuencias nucleotídicas
que pueden ser reconocidas y el grado de especificidad de la interacción. En términos
evolutivos, este aumento en la capacidad de unión es necesario cuando los genomas se
hacen más grandes y complejos (Branden and Tooze, 1991). Las proteínas TcUBPs pueden
homo-heterodimerizar y en ésta tesis se proveen evidencias que demuestran que la región
rica en Glicina es importante par tal reacción (Figura 37). Sin embargo, el hecho de que
no se detecta en forma efectiva dímeros de TcUBP-1 por “cross-linking” con glutaraldehído,
a diferencia de lo que sucede con TcUBP-1ΔQ (Figura 37), sugiere que el dominio Cterminal “random-coil” puede regular la accesibilidad y la interacción proteína-proteína.
Se describió que ciertos dominios “coil-coil” de algunos factores de transcripción son
capaces de promover o prevenir la formación de homo-heterodímeros (ver revisión en
Branden and Tooze, 1991). De esta manera, es lógico pensar que en el parásito ambos
procesos de dimerización puedan estar regulados. La proteína recombinante TcUBP1(Y-A)ΔQ, la cual carece de las Tirosinas de la region rica en Glicina, no dimeriza en
ensayos de “cross-linking” (Figura 37), a diferencia de lo que sucede con TcUBP-1ΔQ.
Estos resultados, nos permiten sugerir que los residuos de Tirosina de esta región sirven
para generar contactos en la interfase del dímero. Más interesante aún, es que las Tirosinas
de la región rica en Glicina pueden fosforilarse, al menos “in vitro” (Figura 38). Una
reacción reversible como esta podría regular el alcance de la dimerización. Dos ejemplos
de fosforilación en residuos de Tirosina se describieron como capaces de regular la
dimerización de proteínas de unión a ADN y ARN (Amster-Choder and Wright, 1992;
Pype et al., 1994). Más aún, los motivos YGG preferencialmente localizados en la región
rica en Glicina de TcUBP-2, se identificaron en diferentes proteínas de unión a ARN de
Arabidopsis thaliana (Lorkovic and Barta, 2002), la proteína humana hnRNP A0 (Myer
111
Discusión
and Steitz, 1995) y el factor de liberación traduccional RF3 de Zygosaccharomyces rouxii
(Nakayashiki et al., 2001), entre otros ejemplos. Algunos trabajos interesantes describen
la función de la fosforilación en Tirosina en la regulación de la estabilidad y/o traducción
del ARNm (Derry et al., 2000; Ostareck-Lederer et al., 2002; Ostrowski et al., 2000).
En términos generales, la región rica en Glicina presente en varias proteínas de
unión a ARN, no tiene rasgos estructurales comunes más alla de la similitud en la
presencia de residuos de Glicina o Prolina que resultan en “coils” flexibles. También se
demostró que esta región está involucrada en la interacción proteína-proteína y puede
contribuir en la afinidad por la interacción con el ARN (Cartegni et al., 1996; DiNitto and
Huber, 2001). En resumen, las proteínas TcUBPs de tripanosomas presentan un único
motivo RRM y son capaces de interaccionar con secuencias de ARN ricas en Uridina con
gran afinidad. Una segunda porción de la proteína, la región rica en Glicina, podría
contribuir a la mobilidad y flexibilidad del motivo RRM en el dímero, como se deduce a
partir de los resultados obtenidos y por comparación con las proteínas con motivos RRM
de otros tipos celulares.
Complejos ARN-proteína y posibles mecanismos de regulación de la expresión génica
en tripanosomas.
Como se demostró en esta tesis, TcUBP-1 y TcUBP-2 dimerizan y forman parte de
un complejo ribonucleoproteico con TcPABP1 (Figura 34). TcUBP-2 co-precipita en el
estadío epimastigote, mientras que TcUBP-1 interacciona con TcPABP1 en todos los
estadíos de desarrollo del parásito (Figura 34). En experimentos realizados “in vitro”,
TcUBP-1 interacciona directamente con TcPABP1 y el efecto de esta interacción está
relacionado con la disrupción de la formación de homodímeros de TcUBP-1 “in vitro”
(Figura 39). Si bien los dominios involucrados en esta interacción no se mapearon hasta
el momento, se especula que el C-terminal de TcUBP-1 puede estar involucrado en este
proceso, ya que es la porción más disímil cuando se la compara con TcUBP-2. Aunque
TcUBP-1 carece de la secuencia consenso descripta para las proteínas que interaccionan
con el dominio C-terminal de PABP1 humana (Kozlov et al., 2001), esta posibilidad debe
ser evaluada.
Cuando PABP1 se acompleja con la cola de poli(A) en células eucariotas superiores,
circulariza moléculas de ARN a partir de la interacción con el complejo de inicio de la
traducción eIF4, con la concomitante estabilización del ARNm (Wilusz et al., 2001).
Recientemente, se sugirió que la unión de varias proteínas de unión al ARE, como hnRNP
D/AUF1, puede alterar la interacción entre PABP1 y la cola de poli(A), facilitando el
acceso de una ribonucleasa que actúa deadenilando la cola de poli(A) (Chen et al., 2001).
Por lo tanto, la rápida degradación del ARNm involucraría el reconocimiento de los AREs
por las proteínas de unión al ARE, varias de las cuales se demostró que son capaces de
reclutar el exosoma “in vitro”, como hnRNP D/AUF1, y causar la reducción de la afinidad
de la PABP1 por la cola de poli(A) (Chen et al., 2001). En T. brucei, a partir de ensayos de
interferencia de ARN realizados contra las diferentes subunidades del exosoma se
demostró que el mismo está directamente involucrado en el procesamiento del ARNr 5S
(Estévez et al., 2001) y también, al igual que en células eucariotas, en la degradación de
ARNms conteniendo secuencias del tipo ARE en su región 3’-NC (Estévez A. et al.,
112
Discusión
comunicación personal). Más recientemente, se identificó en extractos de tripanosomas
una actividad involucrada en el “decapping” de ARNms y otra relacionada con la
degradación exonucleolítica 3’-5’, la cual se estimula por secuencias ARE presentes en
la región 3’-NC del ARNm (Milone et al., 2002).
En nuestro modelo de regulación, la interacción de TcUBP-1 y TcPABP1, rompe la
unión entre TcPABP1 y la cola de poli(A) a través de una reducción en la afinidad de su
sustrato. Es posible que en el estadío tripomastigote, la presencia de TcUBP-1 sin TcUBP2 en el elemento ARE de TcSMUG pueda reclutar el exosoma (Figura 41). Sin embargo,
se sugiere que en el estadío epimastigote, la presencia de TcUBP-2 y otros factores no
identificados hasta el momento, pueden estabilizar la interacción entre TcUBP-1 y
TcPABP1 en el complejo ribonucleoproteico, generando la estabilización de TcSMUG.
Esta interacción podría prevenir, al menos en parte, la pérdida de afinidad de TcPABP1
por la cola de poli(A) generada por la interacción con TcUBP-1. Esta hipótesis además se
complementa con los resultados obtenidos a partir de la sobre-expresión de TcUBP1 en
epimastigotes, en donde se muestra que niveles de la proteína TcUBP-1 más altos que
los celulares desestabilizan al ARNm TcSMUG (Figura 41). Es posible que este fenómeno
de desestabilización se alcance, en parte, a través de la depleción de TcPABP1 de la cola
de poli(A) por TcUBP-1, y la consecuente degradación del ARNm por deadenilación.
Es evidente que los resultados presentados en esta tesis proveen evidencias que
demuestran la función de proteínas de unión a ARN en procesos de regulación de la
abundancia de ARNms en tripanosomas. Sin embargo, se requieren experimentos
adicionales para establecer el/los mecanismo/s por el cual las proteínas TcUBPs estimulan
la estabilización y la desestabilización del ARNm TcSMUG. A partir de ensayos de doble
híbrido en curso, se pretende encontrar los factores proteicos que interaccionan con
TcUBP-1 y/o TcUBP-2 en el complejo ribonucleoproteico identificado; y de esta manera,
profundizar los conocimientos sobre los mecanismos de regulación de la expresión de
TcSMUG.
Pre-ARNms dicistronicos estables Tcubp-1/Tcubp-2 en el citoplasma del parásito.
Es evidente que la presencia del dicistrón Tcubp-1/Tcubp-2 identificado, el cual
es estable en el citoplasma del parásito, es muy atractivo. Este dicistrón, contiene el SL
en su extremo 5’ y un pequeño tracto de poli(A) en su extremo 3’, es transportado al
citoplasma y es también relativamente estable (t ∼ 4 hrs) (resultados no publicados).
1/2
De estos resultados surgen distintas preguntas: 1) Cuál es el mecanismo que lleva a éste
pre-ARNm no maduro al citoplasma? 2) Cuál es el camino de transporte utilizado por
este pre-ARNm? y 3) Debe este pre-ARNm retornar al núcleo de la célula para su
procesamiento final y generar los dos transcriptos maduros Tcubp-1 y Tcubp-2?
Otros ejemplos de transcriptos que codifican para proteínas regulatorias son
también expresados de la misma manera (D’Orso et al., resultados no publicados). Es
decir, existe una incongruencia en el tamaño de los ADNc completo y el tamaño del
ARNm observado en un ensayo de “Northern blot”. Por lo tanto, es interesante determinar
las bases moleculares de este fenómeno que al menos por ahora parece ser un mecanismo
de regulación específico para los tripanosomas. Recientemente, se describió que ciertos
ARNs celulares presentan regiones 5’-NC relativamente extensas, las cuáles presentan
113
Discusión
extensiones del tipo IRES (“Internal Ribosome Entry Site”) (Vagner et al., 2001). En el
dicistrón Tcubp-1/Tcubp-2 para las proteínas TcUBPs, se observan regiones ricas en
tractos de poli-Purinas, del tipo (A) G(A) GG(A) G(A) GG o G(A) G(A) G(A) . Algunos de
4
2
5
2
3
2
3
estos tractos se describieron como IRES (Chappell et al., 2000; Dorokhov et al., 2002) o
son requeridos como “enhancers” del “splicing” en regiones exónicas. Se sabe que la
inclusión de algunos exones depende de una secuencia de 81 nt, designada “exonic
splicing enhancer”. Esta secuencia contiene un tracto de purina GAAGAAGA denominado
elemento A (Caputi et al., 1994; Cramer et al., 1999), que es requerido para la interacción
con proteínas involucradas en el “splicing” del tipo SR tales como ASF/SF2 (Tacke and
Manley, 1995). Es necesario realizar experimentos para estudiar posibles mecanismos
de traducción a partir de secuencias del tipo IRES y revelar cuáles podrían ser los estímulos
requeridos para el procesamiento del dicistrón.
Interacción TcUBP-ARN y estudios de dinámica molecular.
A partir de los estudios de dinámica molecular realizados durante esta tesis se
obtuvieron varios resultados. En primer lugar, se corroboró por RMN que las proteínas
TcUBP-1 y TcUBP-2, sin su región C-terminal, presentan un espectro 15N-1H HSQC similar.
En segundo lugar, se observó que la topología βαββαβ de TcUBP-1ΔQ es la misma que la
observada en otras proteínas de unión a ARN con motivos del tipo RRM, como por ejemplo
Sxl, HuD y PABP1 (Deo et al., 1999; Handa et al., 1999; Inoue et al., 2000). En tercer
lugar, la titulación con ARN permite sugerir que las hojas β son importantes para generar
una interfase de reconocimiento del sustrato ribonucleico. Además, se identificaron
algunos de los residuos importantes para el reconocimiento del ARN rico en Uridina
(Figura 47 y 48), lo cual demuestra similitudes y también diferencias con proteínas de
otros tipos celulares. Es importante destacar que ensayos futuros relacionados con la
resolución estructural del complejo TcUBP-1-ARN permitirán, en más detalle, analizar
las diferencias en el modo de reconocimiento del ARN en proteínas con motivos RRM
simples como TcUBP-1 y TcUBP-2 o múltiples, de distintos tipos celulares. Esto permitirá
identificar y estudiar nuevos mecanismos y modos de interacción ARN-proteína en
organismos evolutivamente tan lejanos como son los eucariotas superiores y los
tripanosomas.
114
Discusión
Conclusiones.
Los aportes más importantes de esta tesis se resumen en los siguientes puntos:
(1) T. cruzi presenta una familia de genes de mucina denominada TcSMUG, que se
regula en forma post-transcripcional mediante mecanismos de estabilización/
desestabilización del ARNm, durante el desarrollo del parásito.
(2) Los elementos ARE y GRE están involucrados en mecanismos de regulación de la
estabilidad funcionalmente opuestos, e interaccionan con proteínas presentes en
extractos proteicos de los diferentes estadíos del desarrollo del T. cruzi.
(3) Las proteínas AREBPs se expresan en forma diferencial durante el desarrollo y
las proteínas GREBPs se expresan en forma constitutiva.
(4) La expresión de las proteínas TcUBP-1 y TcUBP-2 puede ser regulada a partir de
un dicistrón estable que contiene ambos transcriptos.
(5) Las proteínas TcUBP-1 y TcUBP-2 forman un complejo ribonucleoproteico con el
ARN TcSMUG y con la proteína TcPABP1, y factores adicionales no identificados
hasta el momento.
(6) Las proteínas TcUBPs homo- y hetero-dimerizan “in vitro” e “in vivo”. Los residuos
de Tirosina presentes en la región rica en Glicina del C-terminal están involucrados
en la dimerización, y son sustrato de una actividad Quinasa de Tirosina no
identificada hasta el momento. Se sugiere que la fosforilación puede regular la
formación de dimeros “in vivo”, y de esta manera regular la estabilidad del ARNm
de TcSMUG.
(7) El motivo RRM de ambas TcUBP es necesario para la interacción con el ARN.
Además, aunque la extensión C-terminal (región RV) confiere estabilidad en la
formación del complejo ribonucleoproteico. En cuanto al dominio C-terminal rico
en Glutamina de TcUBP-1, su función es todavía desconocida aunque posiblemente
tenga un rol en la regulación de la formación de homodímeros y/o en la interacción
con TcPABP1.
(8) A partir de los ensayos de RMN, se demostró que la topología βαββαβ del motivo
RRM de las proteínas TcUBP-1 y TcUBP-2 son similares entre sí y al de las proteínas
con motivos RRM múltiples de otros tipos celulares. A partir del uso de
espectroscopía por RMN se mapearon los residuos importantes para el
reconocimiento del ARN por TcUBP-1.
115
Discusión
Perspectivas futuras.
(1) Purificar los factores que reconocen a los elemntos ARE y GRE, e identificar los
genes que codifican estas proteínas sería de gran importancia para el estudio de
la regulación de TcSMUG.
(2) Estudiar la regulación de las proteínas TcUBP-1/TcUBP-2 a partir del dicistrón
de ∼5.5 Kpb identificado. Determinar cuáles son los estímulos ambientales
requeridos para el procesamiento de este pre-ARNm.
(3) Identificar los factores adicionales que forman parte del complejo ribonucleoproteico
del cual TcUBP-1 y TcUBP-2 forman parte, ya sea utilizando experimentos de coinmunoprecipitación y análisis de los productos precipitados por espectrometría
de masa MALDI-TOF o a partir de ensayos de doble híbrido en levaduras.
(4) Identificar la Quinasa de Tirosina capaz de regular la formación de dimeros entre
las proteínas TcUBPs y demostrar la función de la fosforilación/defosforilación en
la estabilidad del ARNm TcSMUG durante el desarrollo del parásito. De essta
manera, se pretende estudiar la conexión entre procesos de estabilización de
ARNms y transducción de señales durante el desarrollo del parásito.
(5) Estudiar bioquímica y estructuralmente cómo es la formación de homo- y heterodímeros entre TcUBP-1 y TcUBP-2.
(6) Utilizar experimentos de espectroscopía por RMN para definir la estructura de la
proteína TcUBP-1 sola en solución o acomplejada con el sustrato ribonucleico,
con el objetivo de definir dianas o pequeñas moleculas para bloquear la interaccion
ARN-proteína y estudiar su función en el desarrollo del parásito.
La identificación de las proteínas TcUBPs en T. cruzi, las cuales interaccionan con el
elemento ARE de TcSMUG y pueden interaccionar entre ellas formando un complejo
ribonucleoproteico con TcPABP1, sugiere un modelo interesante para estudiar mecanismos
de regulación post-transcripcional y control de la formación de homo-heterodímeros “in
vivo”. Es necesario la caracterización de los factores adicionales que formen parte del
complejo identificado en esta tesis, como así también las proteínas involucradas en la
regulación de la formación de dímeros de TcUBP-1, lo cuál permitirá entender cuáles
son las señales necesarias para el reclutamiento en ARNms para ser estabilizados o
desestabilizados. Este punto de regulación es de relevancia para un organismo que,
siendo incapaz de regular la expresión de proteínas a nivel de inicio de la transcripción,
requiere de un estricto y rápido control de mecanismos regulatorios. Estos procesos
deben ser controlados en forma ordenada una vez que el parásito pasa de un hospedador
a otro y se diferencia de estadíos; de lo contrario, las moléculas requeridas para la
protección contra el sistema inmune del hospedador no podrían ser expresadas de manera
apropiada.
116
MATERIALES y METODOS
Materiales y Métodos
Manipulación de organismos vivos.
Parásitos.
La mayoría de los análisis se realizaron sobre la población clonal de Trypanosoma
cruzi CL-Brener, utilizada como clon de referencia en el proyecto genoma del parásito
(Zingales et al., 1997). Las diferentes formas del parásito, epimastigotes, tripomastigotes
derivados de células, tripomastigotes metacíclicos y amastigotes, fueron obtenidas como
se describe. Brevemente, el estadío epimastigote de T. cruzi se obtuvo de cultivos axénicos
en medio BHT (Life Technologies) con 10% de suero fetal bovino, 100 U/ml penicilina,
100 μg/ml estreptomicina, crecidos a 28ºC con agitación. El estadío de tripomastigote
metacíclico se obtuvo por diferenciación a partir de cultivos de epimastigotes en fase
estacionaria, incubados en botellas de plástico a 28ºC y sin agitación. Se purificó utilizando
columnas de DEAE-celulosa según ya fue descripto (de Sousa, 1983). Los tripomastigotes
derivados de células (equivalentes de cultivo al tripomastigote sanguíneo) y amastigotes
se obtuvieron a partir de monocapas de células Vero crecidas en medio MEM (Life
Technologies) con 4% suero fetal bovino. Los tripomastigotes se cosecharon del medio de
las células infectadas, típicamente 5 días post-infección. Los amastigotes se obtuvieron
mediante centrifugación diferencial a partir de lisados de células infectadas.
Bacterias.
Los clonados y la expresión de proteínas recombinantes se realizaron en las cepas
DH5αF’ Iq (supE44 Dlac U169 (Ø80 lacZDM15) hsdR17 recA1 endA1 gyr A96 thi-1 relA1
F’ Iq), XL1-Blue (recA1 endA1 gyrA96 thi-1 hsdR17 supE44 relA1 lac (F’ proAB lacI q
ZDM15)) o BL21 DE3 pLysS (F–ompT hsdS B (r B–m B–) gal dcm (DE3) pLysS (CmR)).
Esta cepa tiene la ventaja de ser deficiente en las proteasas lon y ompT (Phillips et al.,
1984). Las bacterias se crecieron de rutina en medio LB (Sambrook et al., 1989). Para la
recuperación de bacterias transformadas se usó medio Terrific Broth (Sigma) para obtener
mayor eficiencia. Las bacterias conteniendo cósmidos se crecieron en medio Terrific Broth
para aumentar el rendimiento de la purificación. Las bacterias competentes se prepararon
a partir del método de Cl Ca (Inoue et al., 1990) y se transformaron con la mitad de la
2
reacción de ligación en las condiciones descriptas en el mismo trabajo. Alternativamente
se usó el método de electroporación en cubetas de 2 mm utilizando 1/10 de la mezcla de
ligación. A esta mezcla se la sometió a un pulso de 2.500 Voltios y 25 μF en un aparato
Gene Pulser (BioRad).
Purificación y manipulación de ácidos nucleicos.
Purificación de ADN total de T. cruzi
Se cosecharon cultivos de epimastigotes en fase logarítmica por centrifugación a
7.000g, durante 10 min. a 4°C y se lavaron tres veces con PBS. El pellet de parásitos se
resuspendió en solución I (10 mM Tris-HCl pH 7.6, 100 mM NaCl, 100 mM EDTA) a 0,1
gr/ml. Los parásitos en suspensión se lisaron por el agregado de SDS hasta 1%. El
lisado se incubó con proteinasa K (Sigma) 100 μg/ml durante 16 hrs a 55°C. Este lisado
se extrajo varias veces con un volúmen de fenol:cloroformo (1:1) hasta la desaparición de
118
Materiales y Métodos
proteínas en la interfase. El fenol fue equilibrado con Tris-HCl pH 7.6 (Sambrook et al.,
1989) y el cloroformo consistió en una mezcla cloroformo:alcohol isoamílico 24:1. Las
fases se separaron centrifugando 5 min. a 12.000g. Los restos de fenol se extrajeron dos
veces con un volúmen de cloroformo. El ADN se precipitó con 2,5 volúmenes de etanol
100%, el flóculo se extrajo con ansa de vidrio, se lavó en etanol 75%, se dejó secar 5 min.
a temperatura ambiente y se resuspendió en buffer TE (10 mM Tris-HCl pH 7.6, 1 mM
EDTA). Se agregó ARNasa a 20 μg/ml durante 45 min. a 37°C. Después se llevó a 0,5%
SDS y 50 μg/ml proteinasa K y se incubó por 2 hrs a 55°C. Se extrajo una vez con
fenol:cloroformo y una vez con cloroformo; se agregaron 0,1 volumen de acetato de sodio
3 M pH 5,2 y 2.5 volúmenes de etanol absoluto para precipitar el ADN y se centrifugó a
12.000g por 15 min. a 4°C. El pellet se lavó con etanol 70% y se resuspendió en buffer
TE. La concentración fue estimada comparando con patrones de ADN de cantidad conocida
corridos en geles de agarosa. Nota: En estas condiciones se extrae tanto ADN cromosomal
como kinetoplástido.
Purificación de ARN total de T. cruzi
Se utilizó el reactivo comercial TRIzol (Life Technologies), basado en el método de
isotiocianato de guanidina y fenol/cloroformo (Simms et al., 1993), según especificaciones
del fabricante pero adaptando las cantidades de reactivo para T. cruzi. Se utilizó 1 ml de
TRIzol por cada ~5x108 parásitos, no más porque sino la extracción del material no es
propicia. La cuantificación se realizó en un espectrofotómetro, sabiendo que 1 OD a
260nm de Absorbancia corresponden aproximadamente a 40 mg/ml de ARN.
Purificación de plásmidos y cósmidos de E. coli.
Se realizó según el método de lisis alcalina (Sambrook et al., 1989). En el caso de
los cósmidos obtenidos de la biblioteca genómica de CL-Brener se realizaron posteriores
extracciones con fenol:cloroformo:isoamílico y cloroformo:isoamílico para lograr mayor
pureza. Para obtener ADN de calidad superior se utilizaron columnas de intercambio
aniónico Tip100 o Tip500 según la cantidad de ADN requerida (QIAGEN Inc.).
Purificación de fragmentos de ADN de geles de agarosa
Se utilizó el kit QIAEXII (QIAGEN Inc.), el cual se basa en el principio de que el
ADN es capaz de adherirse al vidrio en presencia de altas concentraciones salinas y se
realizó siguiendo las especificaciones del fabricante.
Tratamientos enzimáticos del ADN.
Digestiones con endonucleasas de restricción
Se utilizaron 5-10 U de enzima por μg de ADN a digerir, con el buffer y temperatura
correspondientes a cada enzima según instrucciones del fabricante (New England Biolabs).
Para digestiones totales de ADN genómico, se agregaron las unidades de enzima necesarias
en dos veces sucesivas, para mejorar la eficiencia de la digestión (Sambrook et al., 1989).
La segunda dosis de enzima se agregó en general 2 hrs después de la primera, o tomando
119
Materiales y Métodos
en cuenta el tiempo de sobrevida de la actividad de la enzima en cuestión. Después de la
segunda dosis se continuó incubando 12-16 hrs.
Ligado de fragmentos de ADN
Se mezclaron ~50 ng de vector con el inserto de interés, en una relación molar
aproximada 1:3, en el buffer de reacción provisto por el fabricante, en un volumen final
de 10 μl. Las reacciones se incubaron de 3 hrs a 16°C con 4 U de ADN ligasa del
bacteriofago T4 (New England Biolabs) en caso de ser extremos pegajosos o 16 hrs a
16°C con 40 U de ligasa para extremos romos y ligaciones mixtas. Los vectores fueron
previamente tratados con fosfatasa alcalina intestinal de ternero (New England Biolabs),
1 U de fosfatasa por pmol de extremos en buffer de restricción, excepto cuando se ligaron
oligonucleótidos sintéticos doble cadena. Para el clonado de productos de PCR realizadas
con la enzima Taq ADN polimerasa, se utilizó el vector pGEM-T Easy (Promega) en las
condiciones sugeridas por el fabricante.
Reacción en cadena de la polimerasa (PCR)
Las reacciones de PCR se realizaron utilizando la enzima Taq ADN polimerasa
purificada en el Instituto a partir de lisados de E. coli, en buffer de reacción 1X (Life
Technologies). La concentración de Cl Mg se ajustó al óptimo para cada reacción, siendo
2
por lo general de 1,5 mM y se utilizaron 100 ng de cada oligonucleótido por reacción en
un volúmen final de 100 μl. En general, para la amplificación de fragmentos por PCR se
utilizaron 35 ciclos de desnaturalización (5 min. 93ºC) - hibridización (30 seg.) - extensión
(72ºC) en las mismas condiciones, excepto en el paso de hibridización de los
oligonucleótidos, cuya temperatura se fijó en base al oligonucléotido con menor Tm (Tm
= 2°C x (A+T) + 4°C x (G+C)); en el paso de extensión el tiempo dependió del largo esperado
de la región a amplificar, calculando 1 min. de extensión por kpb.
Electroforesis de ácidos nucleicos.
Geles no desnaturalizantes para ADN
Los fragmentos de ADN fueron fraccionados en geles de agarosa de distintos
porcentajes conteniendo 0,5 μg/ml bromuro de etidio, según indicaciones de los manuales
de laboratorio (Sambrook et al., 1989). Las condiciones de corrida fueron aproximadamente
5 V/cm durante 1 hr para minigeles de rutina y 0,5-4 V/cm para geles medianos y
grandes, corridos durante 12-16 hrs para resolver patrones complejos. A cada muestra
se le agregaron 0,2 volúmenes de buffer de muestra (Ficoll 400 15% (p/v), EDTA 1 mM
pH 7.6 y naranja-G 2% (p/v)). Se utilizó como buffer de electroforesis de rutina TBE
(Tris-borato 90 mM, ácido bórico 90 mM, EDTA 2,5 mM pH 8.3). El ADN fue visualizado
por la fluorescencia inducida por luz ultravioleta sobre el bromuro de etidio intercalado.
Geles desnaturalizantes para ARN
Se utilizó el protocolo descripto en (Fourney et al., 1978). Brevemente, se
sembraron 20-30 μg. de ARN total de T. cruzi en cada calle de un gel desnaturalizante de
120
Materiales y Métodos
1,5% agarosa 0,66 M formaldehído. La muestra se mezcló previamente con 5 volúmenes
de buffer de muestra (53% formamida, 1X MOPS/EDTA, 6% formaldehído, 0,5% azul de
bromofenol, 7% glicerol), y se calentó a 65˚C durante 15 min.. Despues se agregó Bromuro
de Etidio (1 μl de una solución 0.2 mg/ml) y se aplicó directamente en geles de agarosa
desnaturalizantes. La corrida se realizó a 3 V/cm durante 3-4 hrs. El buffer de armado
del gel y de corrida fue MOPS/EDTA (0,02 M MOPS, 0,5 mM acetato de sodio, 0,01 mM
EDTA pH 7,0).
Inmovilización de ácidos nucleicos en filtros de nylon o nitrocelulosa
La transferencia de ácidos nucleicos a filtros de nylon a partir de geles de agarosa
se realizó por la técnica de capilaridad según (Sambrook et al., 1989). La transferencia
de ADN de colonias bacterianas a filtros para rastreo de recombinantes por hibridización
con sondas radiactivas se realizó según (Sambrook et al., 1989). Los ácidos nucleicos se
unieron covalentemente al filtro después de su transferencia mediante irradiación con
luz ultravioleta (256 nm) durante 1 min. Para geles desnaturalizantes de ARN, la
transferencia se realizó por capilaridad durante toda una noche utilizando membranas
de nylon Zeta-Probe (Bio-Rad).
Marcación radiactiva de fragmentos de ADN
La marcación radioactiva se realizó por el método de PCR utilizando la enzima Taq
ADN polimerasa sintetizada en nuestro Instituto de Investigación. Se utilizó en el orden
de 1 ng de ADN molde, en general a partir de una primer PCR fría o como insertos
purificados a partir de geles no desnaturalizantes de agarosa. La PCR se realizó utilizando
100 ng de cada oligonucleótido. Las condiciones utilizadas fueron 1,5 mM Cl Mg, 20 mM
2
Tris-HCl pH 8.4, 50 mM KCl y 1 U de Taq polimerasa. La concentración de deoxinucleótidos
(dATP - dGTP - dTTP) se ajustó a 10 μM de c/u y se utilizaron 0,5 mCi/ml dCTP-α32P) (10
mCi/ml, actividad específica 3.000 Ci/mmol, Perkin Elmer Life Sciences), en un volúmen
final de 100 μl para lograr sondas de alta actividad específica (Mertz and Rashtchian,
1994). Las sondas se purificaron por precipitación con AcNa 0.3 M y 2.5 volúmenes de
etanol 100% o pasando el producto de la PCR por una columna de Sephadex G-50. Las
fracciones de 200 μl se cuantificaron en un contador de centelleo.
Sondas de ADN utilizadas.
NH -TcSMUG: Sintetizada con los cebadores N1, 5’-atgatgctgcgccgcgtcct-3’ y N2, 5’2
gtcgcccccagcagcctca-3’, sobre el clon TcSMUG Mle-1 (Di Noia, 2000).
3’-L: Sintetizada con los cebadores L-se, 5’-gggggaagcgtcggtgcgcc-3’ y L-as, 5’tgtcgctatcggctccctggg-3’ sobre el clon TcSMUG 7.2 (Di Noia, 2000).
3’-S: Sintetizada con los cebadores S-se, 5’-atgaggacggggcggggcg-3’ y S-as, 5’tcagcgccgaaaacgtac-3’ sobre el clon 13n22 (Di Noia, 2000).
UBP-1/N: Sintetizada con los cebadores UBP1-N-se y UBP-1-N-as sobre el clon Tcubp-1.
UBP-2/N: Sintetizada con los cebadores UBP2-N-se y UBP-2-N-as sobre el clon Tcubp-2.
RRM: Sintetizada con los cebadores UBP1-N-se y RNP1-as sobre el clon Tcubp-1.
D-AUX: Sintetizada con los cebadores NES-se y UBP-1/C sobre Tcubp-1.
121
Materiales y Métodos
Ductin: Sintetizada sobre un ADN molde gentilmente provisto por el Sr. Ramiro Verdún.
ARNr: Sintetizada con los cebadores “forward” y “reverse” de m13 sobre un ADN molde
pUC19 gentilmente provisto por el Dr. Esteban Bontempi (Instituto Fatala Chaben).
Hsp70: Sintetizada con los cebadores T7 y T3 utilizando como ADN molde un plásmido
pT7 conteniendo un EST TENG 0042 (Número de acceso Genbank: AI034982), proveniente
del proyecto genoma de T. cruzi.
Hibridización de filtros con sondas radiactivas
Las sondas se marcaron por medio de la técnica de PCR, en presencia de [α32P]dCTP. La reacción de PCR en presencia de marca radiactiva para un volumen final de
100 μl fue la siguiente: 1 ng de ADN molde, 10 μM de una mezcla (dATP, dGTP y dUTP),
5 μl[α32P]-dCTP (3000Ci/mmol), 1.5 mM Cl Mg, 1X Buffer Taq Polimerasa, 1U Taq
2
Polimerasa. Se utilizó esta técnica para la identificación de secuencias con distinto grado
de homología a una sonda determinada, según protocolos comunes de laboratorio
(Sambrook et al., 1989). Los filtros fueron bloqueados entre 2-4 hrs a 65°C en (600 mM
NaH PO pH 7.4, 7% SDS, 1 mM EDTA y 1% seroalbúmina bovina). Se utilizó 500.000
2
4
cpm de sonda por ml de mezcla de hibridización. Se incubó toda la noche a 65°C con
agitación suave. Se utilizó dos condiciones de lavado distintas, (1) las que se definen
como rigurosas o estrictas (20 mM Na+, 0,1% SDS, 65°C) y (2) las que se refieren como de
baja rigurosidad o relajadas (200 mM Na+, 0,1%. SDS, 55°C) siempre con agitación (en
general 3 lavados de 20 min. cada uno). La marca fue detectada por exposición a placas
autoradiográficas del tipo X-OMAT AR (Kodak).
Secuenciación de ADN
Las secuencias se realizaron en forma manual y automática. En el primer caso se
utilizó el kit comercial Sequenase 2.0 (Amersham Life Science), basado en el método de
terminación de cadenas con dideoxinucleótidos de Sanger. Se utilizaron de ~5 μg de
plásmido doble cadena previamente desnaturalizado como molde. Las reacciones de
secuencia se realizaron siguiendo las instrucciones del fabricante utilizando 10-20 ng
del oligonucleótido necesario y dATP-γ-(35S) (Perkin Elmer Life Sciences) y se revelaron
por autoradiografía utilizando placas del tipo BioMax (Kodak). Alternativamente se utilizó
el método de terminadores fluorescentes con el kit ABIPRISM (Perkin Elmer) y se
resolvieron en el secuenciador automático ABI377 (Perkin Elmer) del Instituto. En estos
casos los electroferogramas se analizaron manualmente para confirmar las asignaciones
de bases hechas por el programa.
Análisis de secuencias de ADN.
Las secuencias se ingresaron y manipularon con el paquete Lasergene (DNASTAR
Inc.). Las alineaciones entre secuencias se realizaron en el programa MegAlign de ese
paquete utilizando el algoritmo Clustal W (Thompson et al., 1994). Normalmente, el
porcentaje de identidad se calculó a partir de la relación de bases o aminoácidos idénticos
sobre la longitud total de la secuencia. En algunos casos se utilizó como parámetro para
comparar la semejanza entre secuencias, un índice de similitud que calcula este programa.
122
Materiales y Métodos
El mismo es un valor numérico calculado teniendo en cuenta las bases o residuos idénticos
y el número y calidad de espacios que haya sido necesario incluir para realizar la
alineación, así como la longitud de las secuencias.
Aislamiento de los clones descriptos en esta tesis.
Tcubp-1 y Tcubp-2.
Con el objetivo de identificar posibles secuencias de proteínas de unión a ARN en
T. cruzi, se realizó un t-blast-n contra la base de datos de ESTs de tripanosomátidos del
NCBI utilizando como entrada el marco abierto de lectura de la proteina HuR de mamíferos,
una proteína involucrada en la regulación de la estabilidad de ciertos transcriptos celulares
(Fan and Steitz, 1998). Esta proteína se caracteriza por estar compuesta por 3 motivos
RRM y por tener actividad de unión al ARE. A partir de esta búsqueda, se identificó un
marco abierto de lectura que codificaba una proteína con un sólo motivo RRM. Para su
clonado, se realizó una RT-PCR con el cebador oligo(dT) -ancla 5’-gcgactccgcggccgcg(t) 18
18
3’ el cual sirvió para hacer la síntesis del ADNc. La primer reacción de PCR se realizó
usando los oligonucleótidos SL (5’-tacagtttctgtactatattg-3’), el cual reconoce la secuencia
del “spliced leader” de T. cruzi y RNP-I (5’-aaacttcacaatccataggcc-3’). Los productos finales
se clonaron en el vector pGEM-T Easy (Promega) para su secuenciación automática.
Utilizando esta estrategia, no sólo se clonó parte del gen de interés, denominado Tcubp1, sino también un segundo clon caracterizado por ser un poco más pequeño. El mismo
se llamó Tcubp-2, debido a su alta identidad con Tcubp-1. Para el clonado de los dos
ADNc enteros, se sintetizaron oligonucleótidos que reconocen la región N-terminal de
ambos, UBP1-N-se (5’-cgggatccatgagccaaattgttgtttc-3’) y UBP-2-N-se (5’cgggatccatgtctcaacagatgcaatac-3’). Estos oligonucleótidos, se utilizaron para hacer una
segunda reacción de PCR junto con el oligonucleótido ancla (5’-gcgactccgcggccgcg-3’).
Los productos fueron clonados en el vector pGEM-T Easy (Promega) para su secuenciación.
Una vez determinada la secuencia de ambos ADNcs, se realizó una reacción de PCR para
clonar los marcos abiertos de lectura completos en el vector pGEX-2T (Amersham), para
su posterior expresión en bacterias (ver más adelante). Para Tcubp-1, se utilizó los
oligonucleotidos UBP-1-N-se y UBP-1-C. Para Tcubp-2, se utilizó UBP-2-N-se y UBP-2-C.
Los sitios de restricción BamHI y EcoRI, para su clonado direccional, figuran subrayados.
NOTA: La lista de los oligonucleótidos sintéticos utilizados se muestra en la sección de
Anexos.
Tcpabp1 y Tcpabc.
El clonado de Tcpabp1 se realizó por PCR utilizando ADN genómico del clon CLBrener y los oligonucleótidos PABP-N y PABC-2 según se describió previamente (Batista
et al., 1994). De la misma manera, se amplificaron 249 pbs correspondientes al C-terminal
de TcPABP1, llamado TcPABC, con los oligonucleótidos PABC-1 y PABC-2. Ambos
productos se clonaron en el vector pGEX-2T (Amersham) y se purificaron proteínas de
fusión con GST utilizando columnas de glutation-agarosa (Sigma) como se indica más
adelante. El dominio TcPABC se utilizó para generar anticuerpos policlonales en ratones
como se indica más adelante.
123
Materiales y Métodos
Experimentos de Transcripción con núcleos aislados (“Run-on”).
Se aislaron núcleos provenientes de los diferentes estadíos del parásito a partir de
una modificación del protocolo de lisis con NP-40 (Teixeira et al., 1994). Brevemente,
1x109 células se lavaron con PBS 1X y se resuspendieron en el buffer hipotónico A (10
mM Tris-HCl pH 7.6, 2 mM Cl Mg, 5 mM KCl, 2 mM Cl Ca, 1 mM DTT, 1 mM EDTA, 1
2
2
mM espermidina, 6% PEG ) y se incubó en hielo por 10 min. Después de la adición del
3350
detergente NP-40 1%, las células se lisaron con la ayuda de un homogeneizador en
forma manual. El lisado celular se diluyó con 1 volúmen de buffer B 2X (0.64 M sacarosa,
40 mM Tris-HCl pH 7.6, 60 mM KCl, 1 mM EDTA, 1 mM EGTA, 1 mM DTT y 1 mM
espermidina), y los núcleos se centrifugaron 15 min. a 1000g. El pellet nuclear se lavó
una sola vez con 10 ml de buffer B 1X y se resuspendió en 100 μl de buffer C (25%
glicerol, 50 mM Tris-HCl pH 8, 60 mM KCl, 1 mM DTT, 0.1 mM EDTA, 1 mM espermidina).
Los transcriptos sintetizados se marcaron con [α-32P]-UTP a 30ºC durante 30 min., y
luego fueron extraídos con fenol:cloroformo:alcohol isoamílico (25:24:1), precipitados
con etanol y acetato de sodio y su radiactividad medida en un contador de centelleo β. La
actividad específica de la sonda fue ~1x107 cpm para el estadío de epimastigote y ~1x106
cpm para los estadíos de tripomastigote y amastigote. Las sondas se utilizaron para
hibridizar puntos o “dots” conteniendo ADNc pertenecientes a diferentes clones como se
indica en la sección de Resultados (β-tubulina, ARNr, Mle-1 y 13f5, entre otros). Se
inmobilizaron 3 μg de cada ADN plasmídico por punto.
Tratamiento de los parásitos con drogas inhibidoras de la transcripción y traducción.
Se tomaron cultivos de parásitos del estadío epimastigote a una densidad ∼40x106
células por ml. Los mismos fueron tratados con 10 μg/ml de Actinomicina D (ActD), un
potente inhibidor de la transcripcción que se intercala en el ADN. Resultados previos
deter minaron que ésta concentración de droga, inhibe la transcripción en
tripanosomatidos ~100% (Charest et al., 1996; Furger et al., 1997). Se tomaron alícuotas
de parásitos a diferentes tiempos luego del agregado de la droga y se cosecharon a 1000g
durante 5 min. Los parásitos del estadío tripomastigote se cosecharon a partir de medio
de cultivo conteniendo células Vero infectadas, resuspendidos en medio esencial mínimo
(MEM) con 5% de suero fetal bovino (Life Technologies) a la misma concentración y
tratados de la misma manera que los epimastigotes. La cicloheximida (Sigma), un potente
inhibidor de la elongación de la traducción, fue utilizada a una concentracion final de 50
μg/ml en las mismas condiciones que la ActD. En experimentos en los cuales se utilizó
ambas drogas, los parásitos fueron preincubados con cicloheximida por un período de 2
hrs y después la ActD fue agregada sin remoción de la primer droga. Todas la alícuotas
de parásitos fueron cosechadas por centrifugación, lavadas con PBS y congeladas a 70ºC hasta la extracción de ARN total como se indicó.
Transfección de parásitos.
Las transfecciones se realizaron utilizando un electroporador BTX 600, cubetas
de 2mm de separación entre electrodos y los siguientes parámetros: 1500μF, 335V y
24Ω. Se cosecharon aproximadamente 1x108 parásitos, se lavaron con medio BHT sin
124
Materiales y Métodos
suero fetal bovino, y se resuspendieron en 400 μl de medio BHT más 10-50 μg de ADN
plasmídico de alta pureza. Los parásitos una vez transfectados, se recuperaron en 5 ml
de medio BHT-10% suero fetal bovino. Dos días post-transfección, se adicionó geneticina
a una concentración final de ~250 μg/ml. Los parásitos se mantuvieron durante dos
semanas en este medio, y luego la concentración del antibiótico se aumentó hasta 500
μg/ml. El gen de resistencia a neo, presente en los plásmidos pTEX (Kelly et al., 1992) y
pRIBOTEX (Martinez-Calvillo et al., 1997), se utilizó como marcador de selección y como
un control interno para medir los niveles de transfección, ya que se transcribe de manera
policistrónica por el mismo promotor que el gen introducido.
Ensayos de RT-PCR para determinar los extremos 5’ y 3’ maduros de los ARNms
provenientes de las construcciones TcSMUG-L.
Con el objetivo de determinar los extremos 5’ y 3’ utilizados como sitios aceptores
de trans-“splicing” y agregado de la cola de poli(A), se llevaron a a cabo dos tipos de RTPCRs. Por un lado, para determinar el primer sitio se realizó la RT-PCR con el cebador
CAT-in 5’-cgcaactgactgaaatgc-3’ y la reacción de PCR con el mismo oligo y utilizando la
secuencia del SL de T. cruzi. Por otro lado, para determinar el sitio de agregado de la cola
de poli(A), se realizó la RT-PCR con el cebador oligo-dt-ancla seguido de la reacción de
PCR con los cebadores ancla y CAT -se (5’-gggatggagaaaaaaatcactggatata-3’). Los
fragmentos provenientes de ambas PCRs se clonaron en el vector pGEM-T Easy (Promega)
y se secuenciaron en un secuenciador ABI Prism 377.
Ensayo de Actividad Cloramfenicol Acetil Transferasa (CAT).
Los parásitos utilizados, se cosecharon por centrifugación a 1000g por 5 min. y se
lavaron una vez con “buffer” Tris-HCl 0.25 M pH 8. Los extractos libre de células se
prepararon a partir de 4 ciclos de congelamiento-descongelamiento e inactivacion a 65ºC
por 10 min. Los lisados celulares se utilizaron para medir la actividad CAT como se
describió previamente (Martinez-Calvillo et al., 1997). En resúmen, las reacciones de
actividad se llevaron a cabo durante 1 hr a 37ºC con un lisado proveniente de 108 parásitos.
Este tiempo de reacción se determinó experimentalmente de manera tal de que los valores
de actividad obtenidos entren dentro del rango lineal del ensayo. La conversión de [14C]Cloramfenicol a la forma acetilada se analizó por cromatografia en capa delgada (TLC) y
para ello se usaron placas de sílica delgada (Dupont, NEN). Los productos de reacción se
resolvieron por corrida en “buffer” Cloroformo:Metanol (95:5).
Ensayo de doble-híbrido en levaduras.
Levaduras.
Se utilizaron levaduras de la cepa L40 (Genotipo: MATa his3 D200 trp1-901 leu23112 ade2 LYS2::(4lexAop-HIS3 )URA3::(8lexAop-lacZ) GAL4) y Fenotipo His-, Trp-, Leu, Ade- (Shih et al., 1996).
125
Materiales y Métodos
Vectores.
Este ensayo se utilizó para detectar interacciones proteína-proteína “in vivo” en
un sistema heterólogo que permita la confirmación de los resultados obtenidos por otra
técnica. El sistema de doble híbrido utilizado es el desarrollado por Stan Fields y
colaboradores (Fields and Song, 1989). El mismo se basa en la reconstrucción de un
factor de transcripción híbrido donde el sitio de unión a ADN es el factor LexA y el sitio de
transactivación es del factor VP16. El dominio de LexA está en el vector pBTM116 que es
en el cual se clona la proteina señuelo y el factor VP16 está en el vector pVP16 que es con
el cual se clona la proteina presa.
Cepas y selecciones.
El vector pBTM116 puede ser seleccionado en levaduras porque otorga autotrofismo
para triptofano y pVP16 hace lo propio con leucina. La cepa utilzada es L40 (MATa
his3D200 trp1-901 leu2-3,112 ade2 LYS2::lexAop4HIS3 URA::lexAop8-lacZ). Esta cepa
es auxótrofa para triptofano y leucina, pero también para histidina. La reacción positiva
de doble híbrido puede identificarse porque esta cepa posee dos genes bajo el control de
promotores mínimos que tienen sitios de unión para LexA: HIS3 y lacZ. Entonces, cuando
la proteína señuelo interacciona con la proteína del vector pVP16, los motivos de LexA y
VP16 reconstruyen un factor de transcripción capaz de promover la expresión de un gen
para β galactosidasa (lacZ). De este modo, la reacción positiva de doble híbrido se reconoce
por el autotrofismo para histidina y la reacción colorimetrica de un ensayo para β
galactosidasa.
Medios y soluciones.
YPD: 2% peptona, 1% extracto de levadura, 2% glucosa autoclavada en forma separada
como stock 20%.
Medios Yc: para 1 litro de medio disolver 1.2 gr base nitrogenada de levaduras (Difco,
número catálogo: 291940), 0.1gr. de los aminoácidos ade, arg, cis, (leu), (lys), (trp), ura y
0.05gr. de asp, (his), ile, met, phe, pro, ser, tir, val, en 900 ml de agua, autoclavar y
agregar 100 ml de glucosa 20%. Los aminoácidos entre paréntesis son excluidos en
medios drop-out (excluyentes), según corresponda.
Medios drop-out:
Yc-TULys: Yc sin trp, ura y lys.
Yc-THULL: Yc sin trp, his, ura, lys y leu.
Solución AcLi: 0.1M AcLi, 10 mM Tris-HCl pH 7.6, 1 mM EDTA pH 8.
Solución PEG-AcLi: 40% p/v PEG , 0.1M AcLi, 10 mM Tris-HCl pH 7.6, 1 mM EDTA
3350
pH 8.
Transformación de levaduras.
Aquí sólo se describe el protocolo de transformación a baja escala. Si la expresión de
nuestra proteína no es tóxica para las levaduras, podemos hacer una transformación
secuencial, es decir, primero transformando con el plásmido señuelo (pBMT116) y luego
con el pVP16.
126
Materiales y Métodos
1- Se inoculan 10 ml de medio YPD con una colonia grande de las levaduras a ser
transformadas. Se deja crecer a 28-30°C durante toda la noche con agitación. La
OD
debe alcanzar valores mayores a 2.
600nm
2- Se diluye en 50 ml de YPD hasta una OD
~0.5 y se deja crecer con agitación
600nm
durante 2-4 hrs a la misma temperatura.
3- Se cosecha por centrifugación a 1000g a temperatura ambiente (no a 4°C!). El pellet
se resuspende en 40 ml TE 1X y se vuelve a centrifugar a 1000g a temperatura
ambiente por 10 min.
4- El pellet se resuspende en 2 ml de solucion AcLi y se incuba por 10 min. a temperatura
ambiente.
5- Se mezclan 1-2 μg de plásmido señuelo con 50 μl de ADN “carrier” preparado en el
momento. Preparación del “carrier”: se hierven por 5-10 min. 200 μl de ADN de esperma
de salmón sonicado de concentración 10-20 μg/ml. Se le agregan inmediatamente
800 μl de solución de AcLi, se mezcla vigorosamente y se coloca en hielo hasta alcanzar
temperatura ambiente.
6- A la mezcla de ADN (plásmido + ADN “carrier”) se le agrega 100 μl de las levaduras en
solución AcLi y se mezcla bien.
7- Luego se le adicionan 700 μl de la solución PEG-AcLi y se mezcla con “vortex”. Se
incuba la preparación por 30 min. a 30°C.
8- Agregar 70 μl de DMSO y dar un golpe de calor a 42°C durante 10 min.
9- Centrifugar a 10.000g por 20 segundos. El sobrenadante se descarta y el pellet de
levaduras se resuspende en 150 μl de buffer TE 1X y se plaquea enplacas Yc-TULys.
NOTA-1: Para corroborar que la construcción en el pBTM116 no activa “per se” al sistema
del doble híbrido, se debe plaquear esta transformación también en placas Yc-THULL.
En segundo lugar, las colonias que crecen en la placa YcTULys debemos ensayarlas para
corroborar que no tengan actividad β-galactosidasa. Si ocurre que una construcción
activa al sistema en forma indirecta, debemos plaquear en medio Yc-THULL con
concentraciones crecientes de 3-aminotriazol (3-AT, Sigma), entre 0-50mM. El 3AT es
un compuesto tóxico para las levaduras y que es degradado por la enzima codificada por
HIS3. De este modo, si existe un nivel basal de expresión de HIS3, la proteína se utilizará
para degradar 3AT y no para la síntesis de histidina. Haremos entonces el ensayo de
doble híbrido con la concentración más baja de 3-AT necesaria para impedir que las
levaduras crezcan en Yc-THULL.
NOTA-2: Las levaduras transformadas primariamente con el plásmido señuelo pBTM116
se crecen en Yc-TULys y se transforman ahora con el vector presa pVP16 a ensayar. Esta
transformación se plaquea en Yc-THULL con o sin 3AT dependiendo del señuelo, y se le
mide actividad β-galactosidasa.
Medición de actividad β-Galactosidasa.
Para confirmar el carácter positivo de las levaduras L40 transformadas con ambos
plásmidos y capaces de crecer en medio Yc-THULL, se realizan ensayos de medición de
la actividad β-galactosidasa.
1- Se estrían colonias a una placa fresca Yc-THULL.
2- Se transfieren las colonias de levaduras a filtros de nitrocelulosa.
127
Materiales y Métodos
3- Las membranas se colocan con las colonias hacia arriba sobre un soporte de aluminio
que flota en nitrogeno líquido. Luego de 30 seg. se retira y se deja llegar a temperatura
ambiente. Se repite el proceso 2 veces más. Este proceso permite la lisis celular.
4- Los filtros se colocan, colonias hacia arriba sobre papel Whatman 3MM humedecido
con “buffer” Z + 50 μl de 25 mg/ml X-Gal, y el mismo se monta sobre una caja de
Petri. La caja se tapa y se coloca a 30°C entre 15 min. y 2 hrs.
Buffer Z: 60 mM Na HPO , 40 mM NaH PO , 10 mM KCl, 1 mM MgSO pH 7. Antes de
2
4
2
4
usar se agregan 25 μl de β-mercaptoetanol cada 10 ml de “buffer”.
4
Manipulación del ARN para ensayos de interacción con proteínas.
Reacciones de transcripción in vitro.
Todos los plásmidos utilizados para la transcripción “in vitro” se construyeron de
la siguiente forma. Se sintetizaron oligonucleótidos de ADN (Life Technologies)
complementarios a las cadenas sentido y antisentido de los ARNs a obtener (ver sección
Anexo), conteniendo sitios de restricción para las enzimas EcoRI y HindIII ya abiertos o
digeridos. Los mismos se calentaron 5 min. a 95ºC y se unieron a 37ºC durante 2 hrs.
Luego se clonaron directamente en el vector pBS- (Stratagene), digerido por EcoRI y
HindIII. De esta manera, todos los ARNs sintetizados a partir del promotor para la ARN
polimerasa T7, presentan la secuencia GAATTC en el extremo 5’ y A en el extremo 3’
terminal. Para transcribir la cadena sentido del ARN, se incubaron en un volúmen final
de 20 μl los siguientes reactivos durante 1 h a 37ºC: 1 μg de plásmido digerido con
HindIII, ARN polimerasa T7 (Promega), 500 μM de rATP, rCTP y rGTP, 1 μM [α-32P]-UTP
(800Ci/mmol) y 10 U RNAsin (Promega). La cadena antisentido del ARN se sintetizó de la
misma manera, pero utilizando 1 μg de plásmido digerido con EcoRI y ARN polimerasa
T3 (Promega). Todos los transcriptos fueron purificados en geles de poliacrilamida
conteniendo UREA 8 M y eluídos con agitación durante 3 hrs a 37ºC, en un “buffer”
conteniendo 0.3 M AcNa, 10 mM Cl Mg y 1 mM EDTA. Luego de la elución, los ARNs se
2
precipitaron con etanol 100% y se resuspendieron en agua. Para las transcripciones
preparativas en ausencia de material radioactivo, se realizaron reacciones en un volúmen
final de 200 μl a 37ºC durante toda la noche. Los ARNs se detectaron en geles de
poliacrilamida-UREA por irradiación con luz UV.
Análisis de la interacción ARN-Proteína
Análisis por retardo en geles nativos.
Las reacciones de unión ARN-proteína, se realizaron en un volúmen final de 20 μl
en un “buffer” conteniendo: 20 mM Tris-HCl pH 7.6, 100 mM KCl, 5 mM Cl Mg, 1 mM
2
DTT, 50 ng/μl Heparina, 50 ng/μl ARNt. Además se utilizó 10000 cpm de ARN marcado
y la concentración indicada de proteína recombinante o lisado de parásitos
correspondiente, según cada experimento. Las reacciones se llevaron a cabo durante 10
min. a 25ºC para reacciones realizadas con extractos de parásitos o 37ºC en presencia
de proteínas recombinantes. Cada reacción se sembró directamente en geles nativos
128
Materiales y Métodos
10% de acrilamida-bisacrilamida (38:2) y 0.5 X buffer TBE, realizándose la conocida
técnica de retardo en gel, la cual permite determinar si alguna proteína interacciona con
la secuencia de ARN en cuestión en las condiciones utilizadas. Para los ensayos de
competición de la unión ARN-proteína, se utilizaron por un lado homopolímeros de ARN
no marcados radiactivamente (rA, rC, rG y rU), y por otro lado transcriptos “in vitro”
como se describió anteriormente. Los geles de retardo, se secaron durante 1 hr a 70ºC y
luego se expusieron sobre placas radiográficas, en especial del tipo X-Omat AR (Kodak).
Entrecruzamiento de los complejos ribonucleoproteicos por irradiación con luz
UV.
El ARN marcado radiactivamente se incubó en presencia de un extracto total de
proteínas y se resolvió en un gel nativo como se describió en la sección anterior. Los
complejos ribonucleoproteicos detectados por exposición del gel de retardo a 4ºC sobre
placas radiográficas, se entrecruzaron covalentemente por irradiación con luz UV (254
nm, 500 mJ/cm2) durante 15 min. Luego se trataron con ARNAsa T1 y se eluyeron del
gel en presencia de 0.1% SDS a 37ºC durante 3 hrs y en agitación. Los productos del
entrecruzamiento se resolvieron mediante electroforesis en geles SDS-PAGE 12.5%. De
esta manera y en presencia de marcadores de peso molecular se determinó la masa
molecular aparente de las proteínas detectadas en los geles de retardo.
Determinación de constantes de disociación aparentes.
Para la determinación de una K aparente se hicieron varios ensayos para
d
confirmar: (1) la concentración de ARN necesaria a utilizar en cada ensayo, de manera
tal de que, a una dada concentración proteica, la mitad del ARN este unido; (2) la cantidad
de proteína recombinante activa para cada ensayo. El primer punto se determinó
experimentalmente y en general se utilizó entre 5000-10000 cpm de ARN marcado (lo
cual corresponde a ~1ng). El segundo punto, se estudió realizando ensayos de retardo
en gel con una concentracion fija de proteína y aumentando la cantidad de ARN. De este
modo y utilizando dos cantidades de proteína diferentes, se pudo observar una curva de
saturación en cada caso, que permite hacer el cálculo de proteína activa según se describe
(Smith, 1998). En general, todas las proteínas de fusión construidas tuvieron una actividad
~95% según se determinó por geles de retardo. Luego de puesta a punto la técnica, se
utilizó una concentración fija de ARN (~1ng) y cantidades crecientes de proteínas, de
entre 20 y 1000 nM. Las reacciones se realizaron como se indicó en la sección anterior y
se corrieron geles nativos 10% (Acrilamida:Bisacrilamida, 38:2). Las bandas de los
complejos ribonucleproteicos se cuantificaron por densitometría y el valor de K aparente
d
para cada complejo ARN-Proteína, se calculó a partir de un gráfico de dos ordenadas, %
(ARN unido/ARN libre) vs concentración de proteína utilizada.
Entrecruzamiento covalente de ARN a matrices de agarosa-dihidrazida y ensayos
de unión ARN-Proteína.
En primer lugar se oxidó el ARN, de manera tal de obtener extremos 3’ C=O en los
C-2’ y C-3’, los cuales de esa manera, pueden reaccionar con la matriz de agarosa activada
con dihidrazida (Sigma). Para este procedimiento se resuspenden 500 pmoles de ARN en
129
Materiales y Métodos
AcNa 0.1 M y se usa 50 mM NaIO como agente oxidante durante 1 hr a temperatura
4
ambiente y en oscuridad para preservar su capacidad oxidante. Una vez oxidado el ARN,
se lo precipita con etanol 100% y se lo lava con etanol 75% para eliminar el oxidante
remanente. El ARN se resuspende en 500 μl de AcNa 0.1 M. Luego se prepara la matriz
de la siguiente forma. Por cada muestra de ARN a entrecruzar a la matriz, se toman 400
μl de la agarosa 50% hidratada y se la lava 4 veces con 1 ml de AcNa 0.1 M, centrifugando
en cada paso 1000g durante 1 min. Una vez equilibrada la matriz, se la mezcla con el
ARN durante 12 hrs a 4°C con agitación para obtener el ARN-entrecruzado con la matriz
de agarosa para los ensayos. El día siguiente, se procede a eliminar el ARN que no se
unió con la matriz. Para ello se realizan 3 lavados con 2M ClNa de 1 ml cada uno. Por
último, se equilibra en el buffer de unión a utilizar posteriormente, 3 lavados de 1 ml
cada uno es suficiente. El “buffer” utilizado en mi caso, fue el siguiente: 20 mM Tris-HCl
pH 7.6, 1 mM DTT, 100 mM KCl, 5 mM Cl Mg, 10% glicerol, 50 μg/ml Heparina. Para
2
realizar la unión de proteínas recombinantes, se utiliza alrededor de 5 μg, y para extractos
de parásitos se usan 200 μl de un lisado (~10 mg/ml) por tubo. El ensayo de unión se
lleva a cabo durante 1 hr y luego se procede a lavar con el buffer de unión en presencia
de 0.5% NP-40. Se realizan 4 lavados de 10 min. cada uno, centrifugando en cada caso
1 min. a 1000g. Las proteínas unidas a la matriz se eluyen calentando a 100°C por 10
min. en presencia de 2X Laemmli buffer.
Proteínas
Expresión de Proteínas Recombinantes.
La preparación de proteínas recombinantes se realizó en dos vectores de expresión.
Por un lado, se usó el vector pGEX-2T (Pharmacia), el cual permite generar una fusión
con la Glutation-S-Transferasa (GST) de Schistosoma japonicum; y por otro lado se utilizó
el vector pTRIS-A (Invitrogen) el cual genera una fusión en el C-terminal con un “tag” de
poli-Histidina. En la Sección Anexo se muestra el nombre y la secuencia de los clones
TcUBPs utilizados durante la tesis doctoral, como así también los cebadores que se
utilizaron en las reacciones de PCR para su construcción. Los clones Tcubp-1 y Tcubp-2
no se expresan en forma correcta utilizando el vector pTRIS-A (Invitrogen), pero si se
logró generar fusiones activas con la GST en el vector pGEX-2T. Los clones se
transformaron en E. coli, preferencialmente en la cepa BL21 DE3 pLys S (Novagen), la
cual cuenta con una deficiencia en la capacidad para degradar proteínas (DE3) y también
presenta una lisozima que facilita la lisis celular (pLYS). A partir de placas de LB-antibiótico
frescas, se realizaron cultivos durante toda la noche a 37°C. Al próximo día se realizaron
diluciones 1/20-1/50 a un medio rico como es el Terrific-broth, en presencia del antibiótico
correspondiente. Una vez alcanzada una DO
de aproximadamente 0.8, se adicionó
600nm
el inductor de la expresión, en este caso Isopropil β-D-tiogalactopiranósido (IPTG) durante
3 hrs a 37°C. La cantidad de IPTG utilizada fue de 0.2 mM cuando se utilizó el vector
pGEX-2T y 1 mM para cultivos conteniendo el plásmido pTRIS-A. Las proteínas
recombinantes se purificaron en columnas de Glutation-agarosa o en una columna “HiTrap” quelante de metales, respectivamente. Luego de la inducción durante 3 hrs las
bacterias se cosecharon por centrifugación a 5000g durante 10 min. El pellet bacteriano
130
Materiales y Métodos
se resuspendió en “buffer” TBS (~1/20 del volúmen inducido), en presencia de 1 mM
PMSF y 3 mM EDTA como inhibidores de Serin y metalo-proteasas, respectivamente. La
lisis se realizó por sonicación, con 4 pulsos de 30 seg. cada uno, después se adicionó 1%
Triton-X100 y se incubó durante 5 min. en hielo para terminar con la lisis. Por último, el
lisado se separó de los restos celulares por centrifugación a 10000g por 20 min.
Purificación de proteinas de fusión a GST y separación de la GST por digestión con
Trombina.
Se utilizó una columna de glutatión-agarosa de 1 ml de volúmen, y se equilibró de
la siguiente manera: (1) lavado con 5 volúmenes de TBS Triton-X100 1%, (2) lavado con
5 volúmenes ClNa 3 M, y (3) lavado con 10 volúmenes de TBS 1% Triton-X100. El lisado
proteico obtenido se pasó por la columna de glutatión-agarosa y luego se lavó con 10
volúmenes de TBS. Por último, se eluyó con 5 ml de glutation reducido (Sigma) en alícuotas
de 1 ml cada una. La columna se regeneró lavandola en presencia de 5 volúmnes de
NaCl 3 M y luego se la almacenó a 4°C hasta su próximo uso. Para la determinacion de
actividad, las proteínas de fusión se cortaron con Trombina, ya que el plásmido pGEX2T tiene sitio de corte para esta proteasa (ver más adelante). De este modo, se separó la
proteína de interés de la proteína de fusión con GST. Para tal motivo, la proteína de
fusión producida y pegada a la columna no se eluyó con glutation-agarosa, sino que se
cortó directamente en la columna. Para el protocolo de digestión, se utilizó 10 U Trombina
(Sigma) por mg de proteína fusión y el tiempo de digestión se determinó en forma
experimental ya que el mismo depende de la accesibilidad de la proteasa al sitio de corte.
Para las proteínas de fusión producidas en esta tesis, incluyendo TcUBP-1, TcUBP-2,
sus mutantes de deleción y TcPABP1, fue suficiente con digerir 2 hrs a 25°C en presencia
de un “buffer” conteniendo 20 mM Tris-HCl pH 7.6, 150 mM NaCl y 2,5 mM Cl Ca. El
2
sitio de reconocimiento para la Trombina puede ser según (Chang, 1985): (1) A4-A3-PR/K-A1-A2, donde A4-A3 son residuos hidrofóbicos (M,Y,I,L,V) y A1-A2 son residuos no
acídicos (G,N,K,L,S); (2) A2-R/K-A1, donde A2 o A1 son G.
Fraccionamiento subcelular y preparación de extractos proteicos y polisomas.
Para la preparación de extractos citosólicos, los parásitos se resuspendieron en
“buffer” de lisis a una concentración de ~1x106 células por μl de solución. El “buffer” de
lisis utilizado contiene: 20 mM Tris-HCl pH 7.6, 0.5% NP-40, 10 mM Cl2Mg, 1 mM DTT,
1 mM EGTA, 10% glicerol y se suplementa con inhibidores de proteasas: 1 mM PMSF y
10 μM E-64. Esta mezcla se incubó durante 15 min. a 4ºC y luego se centrifugó a 1000g
durante 10 min. para separar los núcleos, restos celulares y parásitos no lisados. El
sobrenadante (S1000) corresponde a la fracción citosólica. Si se pretende continuar
trabajando con los núcleos hay que realizar dos lisis adicionales y centrifugación de
cada una para separarlos de los restos celulares y contaminantes citosólicos. De esta
manera, contamos con un “pellet” de 1000g (P1000), el cual está compuesto por las
proteínas nucleares y de la membrana nuclear. Esta fracción, por sonicación (10 pulsos
de 15 seg. cada uno) rinde una fracción nuclear libre de membranas. Por otro lado, el
sobrenadante 1000g (S1000) se puede purificar aun más. Por centrifugacion a 10000g
15 min., clarificamos un poco más el sobrenadante. El mismo se puede centrifugar a
131
Materiales y Métodos
100.000g en una ultracentrifuga refrigerada (rotor 70Ti, ~40000rpm) durante 1 hr. El
S100.000 contiene proteínas solubles mayoritariamente y el P100.000 es la fracción
correspondiente a microsomas y en la cual están presentes los polisomas libres de retículo
endoplásmico. Los polisomas también pueden purificarse de forma alternativa. El S10000,
se siembra en un colchón de sacarosa de dos fases, 1 y 2 M, como se describió previamente
(Gonzalez and Cazzulo, 1989). Este colchón se centrifuga durante 2 hrs a 4ºC a una
velocidad de 100.000g (~40.000 rpm en un rotor 70Ti). El “pellet” del centrifugado contiene
los poliribosomas separados de las demás fracciones sub-celulares.
Producción de anticuerpos policlonales y conjugación de péptidos a KLH.
Los anticuerpos se prepararon mezclando partes iguales de péptidos y/o proteínas
con adyuvante de Freund (Sigma) como emulsionante. La primera inyección se dió con
adjuvante de Freund completo, es decir, conteniendo el mycoplasma para estimular la
respuesta inmunológica. En cambio, el primer y segundo desafío se realizaron en presencia
de adjuvante incompleto (Sigma). Se inyectaron conejos y/o ratones cada 15 días y después
del segundo o tercer desafío, los animales se sangraron a blanco. Para la primera inyección
de los ratones se utilizó alrededor de 30 μg proteína en un volúmen de 200 μl final. La
primera inyección de los conejos se hizo con 200 μg de proteína en un volúmen final de
1 ml. Para los desafios con la mezcla proteína-adyuvante incompleto se utilizó sólo la
mitad de proteína que para la primera inyección. Para generar anticuerpos contra péptidos
sintéticos (Sigma GENOSYS), se adicionó una Cisteína en el C-terminal del mismo. Este
aminoácido permite su conjugación covalente a la proteína KLH (“maleimide-activated
keyhole limpet hemocyanin”). Para favorecer ésta reacción, se incubó cantidades
equimolares de péptido y KLH durante 1 hr a temperatura ambiente con agitación suave.
La mezcla de reacción contiene péptido acoplado y libre, y sirve para inyectar animales
directamente en presencia de la emulsión.
Los anticuerpos generados fueron:
1- anti-RRM, generado contra los 92 aminoácidos del dominio de unión a ARN
(RRM) de TcUBP-1 fusionado a GST;
2- anti-TcUBP-1, generado contra el péptido VSQYDPYGQTAC de la región Nterminal de TcUBP-1 acoplado a KLH;
3- anti-TcUBP-2, generado contra el péptido RNRNGVSTFGAC de los aminoácidos
111-122 de TcUBP-2 acoplado a KLH;
4- anti-TcPABC, generado contra los 83 aminoácidos del dominio C-terminal de
TcPABP1 fusionado a GST.
Geles desnaturalizantes SDS-PAGE.
Se utilizaron geles de 7.5, 10 y 12.5% de acrilamida:bisacrilamida (29:1) con el
sistema de “buffers” discontinuo de Laemmli (Sambrook et al., 1989). Las muestras de
proteínas provenientes de lisados de parásitos, bacterias, levaduras y purificaciones de
proteínas recombinantes se sembraron en geles desnaturalizantes mezclándolas con
“buffer” de muestra (100 mM Tris-HCl pH 6.8, 2% SDS, 200 mM DTT, 20% glicerol, 0,1%
azul de bromofenol). Los geles se tiñeron con “Coomasie Blue” R-250 (Sigma) o con
Nitrato de plata (Sigma) según se indique en cada caso, o transferidos a membranas de
132
Materiales y Métodos
nitrocelulosa para la realización de ensayos de “Western blot”.
Ensayos de “Western blot” e inmunorevelados.
Las muestras proteicas separadas en geles SDS-PAGE, se transfirieron a filtros
de nitrocelulosa utilizando la técnica de electrotransferencia húmeda durante 1 hr en
“buffer” Towbin (25 mM Tris, 192 mM Glicina, 0.1% SDS, 10-20% Metanol) a 250 mA
constante. La transferencia se monitoreó por tinción de la membrana en solución Ponceau
S (0.1% p/v Ponceau S en 5% ácido acético glacial). La membrana se incuba 1 min. con
la solución, y luego se realizan sucesivos lavados con agua deionizada para sacar el
exceso de colorante. De esta manera, se puede determinar la posición de los marcadores
de peso molecular y cada una de las calles sembradas. Luego se decolora la membrana
lavando con TBS por unos minutos. Para detectar bandas específicas, los filtros se
bloquearon en TBS-5% leche descremada durante 1 h y se incubaron con el suero de
inmunización en TBS-5% leche durante 1-2 hr y en general utilizando una dilución ~1/
200 del suero primario. Se realizan dos lavados de 10 min. cada uno en presencia de
TBS-Tween 0.1%, y luego se incubó con un segundo anticuerpo acoplado a peroxidasa
en una dilución 1/10.000, seguido por dos lavados de TBS-Tween 0.1%. Finalmente, se
reveló por quimioluminiscencia detectada por autorradiografía utilizando el “kit”
Supersignal® West Pico Chemiluminescent Substrate (Pierce). La membrana húmeda se
expone a placas radiograficas X-Omat AR (Kodak).
Ensayos de inmunoprecipitación con proteína-A-sefarosa.
Extractos proteicos correspondientes a 108 parásitos se incubaron con suero preinmune, o el correspondiente suero (anti-TcUBP-1, anti-TcUBP-2, anti-TcPABP1), en
una dilución ~1/50, durante 2 hrs a 4°C en agitación. En un segundo paso, se adicionó
50 μl de proteína-A-sefarosa (Sigma) y se incubó por 2 hrs más con agitación a 4°C,
luego la mezcla se centrifugó a 1000g por 1 min., se descartó el sobrenadante y el
immunoprecipitado se lavó 3 veces con 400 μl de TBS-Tween 0.1%. Las proteínas retenidas
durante la immunoprecipitación, se eluyeron calentando en presencia de Laemmli buffer
2X. Estas se separaron en geles SDS-PAGE seguido de un ensayo de “Western blot” con
el anticuerpo indicado en cada caso. En algunos casos y donde se indica, el extracto
libre de células se pretrató durante 30 min. a 25°C con 0.1 μg/μl ARNasa A (USB).
Estudios de “Cross-linking” proteína-proteína.
Para los ensayos de “cross-linking” se utilizaron diferentes concentraciones de
proteína recombinante según se indica (0.25, 0.5 y 1 μM). Las proteínas resuspendidas
en “buffer” TBS se trataron durante 30 min. a temperatura ambiente en presencia de
glutaraldehido 0.01% final como agente para generar el entrecruzamiento covalente de
las proteínas. El glutaraldehido utilizado a ésta concentración final permite unir
covalentemente aquellos residuos que están haciendo contacto a casi 0Å de distancia
(Wan et al., 2001). Los productos fueron resueltos en geles SDS-PAGE y teñidos con
“Coomasie Blue” R250.
Ensayos de Fosforilación “in vitro”.
133
Materiales y Métodos
Para los ensayos de fosforilación se utilizó alrededor de 1 μg de proteína
recombinante en presencia de la Quinasa de Tirosina c-Src humana (Sigma, S5439), en
15 μl de volúmen final y utilizando un buffer con la siguiente composición: 10% glicerol,
50 mM Hepes pH 7.5, 2 mM DTT, 10 mM Cl Mg, 0.25% Triton X-100 y 1 μl de [γ32P]-ATP
2
(6000 Ci/mmol). Las reacciones se llevaron a cabo a 30ºC durante 1 hr y los productos
se resolvieron en geles SDS-PAGE 10% y se tiñeron con “Coomasie Blue” R250 antes de
exponer a placas radiográficas X-Omat-AR (Kodak).
Métodos de Purificación Analítica o Preparativa de Proteínas.
1- Cromatografia de Filtración en Gel.
Se prepararon extractos citosólicos correspondientes a 5-108 parásitos del estadío
epimastigote, de la manera que se indicó más arriba. A este extracto se le ajustó la
concentración salina, 150 o 500 mM NaCl, es decir baja o alta fuerza iónica,
respectivamente. De la misma manera el pH se ajustó a 6.8 con “buffer” Tris-HCl 1 M pH
6.8. La muestra se pasó por un filtro 0.2 μM y se inyectaron no más de 300 μl (10 mg/ml)
por corrida, volúmen que permite una resolución adecuada en las columnas utilizadas.
Se utilizaron dos tipos de columnas. En primer lugar, BioSil SEC-250 (BioRad) que tiene
un rango de separación de 10-300 kDa. En segundo lugar, se utilizó la columna Superosa
6 (Amersham), cuyo rango de separación es mayor. En ambos casos, el flujo de la corrida
se mantuvo en 1 ml/min. y se colectaron fracciones de 0.5 ml. Las muestras de cada
corrida fueron analizadas en geles SDS-PAGE seguido de ensayos de “Western blot.” Y la
calibración de las columnas se realizó previamente utilizando los siguientes estándares
de peso molecular (Sigma): 670kDa, Tiroglobulina; 180kDa, α2-Macroglobulina; 45kDa,
Ovalbumina; 17kDa, Mioglobina.
2- Cromatografía de intercambio iónico. DEAE Sefarosa.
La columna de intercambio catiónico DEAE (Amersham), se equilibró de la siguiente
manera: (1) 5 volúmenes de “buffer” A (20 mM Tris-HCl pH 7.6); (2) 5 volúmenes de
“buffer” B (20 mM Tris-HCl pH 7.6 + 500 mM NaCl), y (3) 10 volúmenes de “buffer” A.
Para la purificación de la proteína eAREBP, se utilizaron 500 ml de un lisado
correspondiente a 100 gr. de parásitos. El lisado libre de células se cargó en una columna
conteniendo un volúmen de matriz de ~500 ml, a un flujo constante de 5 ml/min. Luego
se lavó con 5 volúmenes de columna y se eluyó con un gradiente lineal de NaCl (buffer B)
utilizando un flujo de 1 ml/min. Se colectaron 50 fracciones de 9 ml cada una y se midió
actividad por geles de retardo utilizando 10 μl de cada fracción. El gel de retardo se
corrió por 1 hr 30 min. y luego de su secado por vacio se expuso a -70°C a placas
radiográficas durante 2 hrs.
3- Cromatografia de afinidad Heparin-HyperD.
Esta columna (BioSepra) se equilibró de la siguiente manera: (1) 5 volúmenes de
“buffer” A (50 mM MES pH 6.2); (2) 5 volúmenes de “buffer” B (50 mM MES pH 6.2 + 1 M
NaCl), y (3) 10 volúmenes de “buffer” A. El pool de la DEAE Sefarosa (~10 ml), se cargó en
una columna de Heparina (BioSepra) de 10 ml de volúmen, utilzando un flujo constante
de 3 ml/min. El protocolo de elución utilizado fue el siguiente: a) 0-3.33 min., 0-0.25 M
134
Materiales y Métodos
NaCl; b) 3.33-16.6 min, 0.25-0.6 M NaCl; c) 16.6-17, 0.6-1 M NaCl; d) 17-20 min., 1 M
NaCl. Se recolectaron 25 fracciones de 1.4 ml y se midió actividad por geles de retardo
utilizando 10 μl de cada fracción. El gel de retardo se corrió por 1 hr 30 min. y luego de
su secado se expuso a -70°C a placas radiográficas durante 2 hrs.
4- Cromatografía de intercambio catiónico Mono S.
La columna Mono S (Amersham) se equilibró de la siguiente manera y utilizando
un flujo de 1 ml/min.: (1) 5 volúmenes de “buffer” A (50 mM MES pH 6.2); (2) 5 volúmenes
de “buffer” B (50 mM MES pH 6.2 + 0.5 M NaCl), y (3) 10 volúmenes de “buffer” A. El pool
de la cromatografía de afinidad en Heparina (~7ml) se diluyó 1/5 y se lo aplicó a esta
columna con el flujo indicado. La elución se realizó con un gradiente lineal de 0-0.5 M
NaCl y se recolectaron 20 fracciones de 1.4 ml. Se utilizó al igual que en el paso anterior,
10 μl para la medición de actividad evaluada por geles de retardo.
5- Cromatografía de hidrofobicidad Fenil Sefarosa.
El último paso para la purificación fue de hidrofobicidad, utilizando una columna
de Fenil Sefarosa (Amersham), la cual se equilibró de la siguiente manera a un flujo de
0.5 ml/min. (1) 5 volúmenes de “buffer” A (20 mM Tris-HCl pH 7.6 + 1 M SO (NH4) ); (2)
4
2
5 volúmenes de “buffer” B (20 mM Tris-HCl pH 7.6 + 5% sacarosa), y (3) 10 volúmenes de
“buffer” A. La elución se realizó con un gradiente lineal decreciente en concentración de
SO (NH4) de 1 a 0 M. Se recolectaron 40 fracciones de 0.5 ml cada uno.
4
2
Transferencia a membranas de PVDF (Polyvinylidene Fluoride) para el análisis del
N-terminal por Edman.
La mitad de la muestra de purificación se separó en un gel SDS-PAGE 7.5%, ya
que la proteína eAREBP tiene un tamaño de ~100kDa. La corrida se realizó en “buffer”
CAPS (3-[cilohexilamino]-1-ácido propanesulfónico) 1X (Caps 10 mM pH 11) y para la
transferencia se procedió utilizando en “buffer” CAPS 1X con 10% Metanol para análisis.
La transferencia se realizó por 1 hr. a 50V constantes a temperatura ambiente y la
membrana de PVDF se tiñó en 0.1% “Coomasie-Blue” preparado en 40% Metanol/1%
Acido acético, y destiñó con 50% Metanol. Luego se lavó con agua deionizada y se cortó
la banda identificada para realizar un ensayo de secuencia de la región N-terminal por la
reacción de Edman en el laboratorio del Dr. Ulf Hellman (Uppsala University, Sweden).
Espectrometria de masa y análisis por MALDI-TOF.
La otra mitad de la purificación se corrió en el mismo gel desnaturalizante SDSPAGE. La banda identificada se cortó y se envió también al Dr. Ulf Hellman, quien realizó
un digerido tríptico de la proteína y separación de los péptidos por HPLC y análisis por
espectrometría de masa MALDI-TOF según se describió (Hellman, 2000).
135
Materiales y Métodos
Resonancia Magnética Nuclear y ensayos de dinámica molecular.
Expresión de proteínas en medio mínimo M9.
Los plásmidos pGEX2T-TcUBP-1ΔQ, pGEX2T-TcUBP-1ΔQG1 o pGEX2T-TcUBP2ΔCt se transformaron en bacterias BL21 Gold/DE3 (Stratagene) y se crecieron en medio
mínimo M9 (6 gr Na HPO , 3 gr KH PO , 0.5 gr NaCl, 0.5 gr 15N-NH4Cl (Isotec, Inc), 2 gr
13
2
4
2
4
C-glucosa (Cambridge Isotope Laboratory) por litro de cultivo, suplementado con 100
μg/ml de ampicilina. La expresión y purificación de las proteínas fusionadas a GST se
realizó como se indicó. La proteína de fusión no se eluyó con glutatión reducido, sino que
se realizó la digestión de la proteína de fusión con Trombina (Amersham) en la columna,
durante 2 hrs a temperatura ambiente y con agitación suave. Se utilizó 50 U de Trombina
en 4 ml de “buffer” TBS suplementado con 2.5 mM Cl Ca, para digerir la proteína de
2
fusión proveniente de la inducción de 1-2 litros de medio de cultivo. Luego de la digestión
se recuperan los 4 ml conteniendo la proteína de interés, sin el “tag” de GST. Luego de la
digestión, también se eluye con glutation-reducido (Sigma) 10 mM para testear que no
haya proteína de fusión sin digerir y determinar sí la expresión funcionó correctamente.
Para los ensayos de RMN, las proteínas se prepararon por desalado en columnas NAP-25
(Amersham) y concentración por liofilización en una centrífuga refrigerada. La
concentración se realizó hasta obtener un volúmen final de 200 μl conteniendo 20 mM
Tris-HCl pH 7.2, 150 mM NaCl. Por último, se agregó a la muestra 1 mM NaN y 1 mM
3
DTT.
Espectroscopías por RMN.
La asignación de las resonancias de la proteína TcUBP-1ΔQG1 se determinó usando
técnicas de resonancia-triple estandares sobre la muestra marcada con 13C o 15N (Grzesiek
and Bax, 1993). Para ello se utilizó los espectrómetros de RMN Bruker DRX500 y Varian
UNITYplus 800 MHz. Todos los experimentos se procesaron a una temperatura de 303K.
Las resonancias de cadena principal Cα, N, HN, y cadenas laterales Cα fueron asignadas
a partir de experimentos HNCACB y CBCA(CO)NH (Grzesiek et al., 1992); Constantine,
1993 #28]. Las asignaciones de las resonancias de los Hα y de las constantes de
acoplamiento 3J N α se obtuvieron a partir del experimento HNHA (Kuboniwa et al., 1994).
H -H
Otras asignaciones de cadena principal y laterales se obtuvieron a partir de experimentos
tridimensionales NOESY (“Nuclear Overhauser Effect SpectroscopY”) y TOCSY (“TOtal
Correlation SpectroscopY”) a 500 MHz. Los espectros fueron procesados utilizando los
programas GIFA (Malliavin et al., 1998) y XWIN-NMR version 2.5 (Bruker Biospin). El
análisis final se realizó con el programa XEASY (Bartels et al., 1995). La estructura
secundaria de la proteína TcUBP-1ΔQG1 se analizó usando desplazamientos químicos
conocidos para H y C (Wishart et al., 1991).
Experimentos de Titulación.
Titulación con ARN.
Las titulaciones con ARN se llevaron a cabo en experimentos separados, con el
ARN P1 (5’-guuuuguuuuuguuuuug-3’), generado por transcripción “in vitro” a partir del
“kit” Megashort (Ambion) purificado por gel desnaturalizante PAGE y el homoribipolímero
136
Materiales y Métodos
poly(U) (Sigma), utilizando un espectro de correlación cuántica simple heteronuclear
(HSQC) 15N-1H a 500MHz, a una temperatura de 303K sobre la muestra 15N-TcUBP1ΔQG1
(~0.5 mM). Se calcularon los desplazamientos químicos en ppm, [(Δ 1H shift)2 + (Δ 15N shift
x 0.2)2]1/2, de los residuos de la proteína 15N-TcUBP1ΔQG1 sobre el agregado de cantidades
crecientes de los ARNs utilizados. Las razones molares de proteína-ARN P1 utilizadas
fueron 1:0.1, 1:0.2, 1;0.35; 1:0.7, de manera tal de facilitar el movimiento de los residuos
desplazados y asignar las resonancias de los residuos perturbados por la interacción
con el ARN. De la misma manera, la titulación de 15N-TcUBP1ΔQG1 con poly(U) se llevó
a cabo con las siguientes relaciones molares (1:0, 1;0.1, 1:0.2, 1:0.5). Este experimento
es muy sensible, y permite detectar perturbaciones en el medio ambiente de las amidas
de cadena principal debido a la unión del ligando. Los desplazamientos químicos de las
amidas también son sensibles a las perturbaciones de las cadenas-laterales conectadas,
que también interaccionan con el sustrato, pero también deben ser afectadas por cambios
conformacionales en el esqueleto de la proteína, y esto a veces puede complicar la detección
del sitio de unión. Para facilitar la delineación apropiada de la superficie de unión proteínaligando (sea éste ARN o proteína), se puso énfasis en la determinación de grandes
desplazamientos químicos observados por titulación y de las amidas desplazadas que se
ubican en superficies posibles expuestas según (Yuan et al., 2001).
Titulación con proteínas.
Las titulaciones se realizaron con la proteína TcUBP-2ΔCt (residuos 1-143) sin
marcar, utilizando un espectro de correlación cuántica simple heteronuclear (HSQC)
15
N-1H a 500 MHz, a una temperatura de 303K sobre la muestra 15N-TcUBP1ΔQG1
(~0.2mM). Se calcularon los desplazamientos químicos en ppm, [(Δ 1H shift)2 + (Δ 15N shift
x 0.2)2]1/2, de los residuos de la proteína 15N-TcUBP1ΔQG1 sobre el agregado de cantidades
crecientes de TcUBP-2ΔCt (1:0, 1:0.1, 1:0.3 y 1:0.6).
137
Materiales y Métodos
Tabla 7 - Experimentos de Resonancia Magnética Nuclear realizados sobre la proteína TcUBP1ΔQG1.
nd, no determinado.
Experimento
Objetivo del experimento
HNCACB
CBCA(CO)NH
Asignar los Cα y Cβ a partir 1H- 15N
HSQC.
Para saber si existe degeneración, es
decir más de un residuo en la
misma posición de la matriz.
Identificar los Hα y calcular los
ángulos dihedricos entre los átomos
HN-N-C-Hα.
Asignar los protones de acuerdo a
las correlaciones C-C de cada
residuo.
Asignar los protones de H N de cada
residuo.
Identificar las restricciones de las
distancias interprotones para los
cálculos de
l a estructura, y
chequear el asignamiento. Residuo
en a-helix (fuerte NOE entre HN i y
HN i +1). Residuo en hoja-β ( fuerte
NOE entre Ha i y HN i+1).
Asignar los protones a partir de los
protones de la HN del próximo
residuo.
Asignar los carbonos a partir de los
protones de la HN del próximo
residuo.
Asignar protones de cadena lateral,
siempre y cuando el residuo no este
solapado con otros residuos o con
grupos metilos que tienen los
protones más de splazados (~1 ppm).
Asignar los protones de re siduos
aromáticos, de acuerdo a los NOEs
entre estos y Hβ.
HNCO
HNHA
(H)CCH-Cosy
TOCSY-HSQC
NOESY-HSQC
H-TOCSY
CONH
C-TOCSY
CONH
2D TOCSY
homonuclear
2D NOESY
homonuclear
C-NOESY
13
Identificar las restricciones de las
distancias inter-H para cálculos de
estructura.
HNCA
CA(CO)NH
Asignar los Cα a partir del 1 H- 15N
HSQC.
512(1H)x64(15N)x92(13C)
512(1H)x64(13C)x96(15N)
Número
de repeticiones
16
8
Tiempo
de
mezcla
/
/
90 % (CO)
512(1H)x66(13C)x100(15N)
4
/
63 % (Ha)
Falta analizar los
ángulos.
512(1H)x110(15N)x110( 1H)
4
/
Falta analizar
512(1H)x104(13C)x100( 1H)
4
/
Se obtuvo poca
información
512(1H)x48( 15N)x180(1H)
8
70 mseg
512(1H)x48( 15N)x180(1H)
8
100 mseg
512(1H)x78(13C)x150(15N)
8
/
512(1H)x60(15N)x62(13C)
8
/
Falta analizar
1024(1H)x512(1H)
104
110 mseg
Falta analizar
1024(1H)x512(1H)
176
110 mseg
nd
nd
100 mseg
nd
nd
/
nd
nd
/
(%) residuos
asignados
Tamaño de la matriz
88 % (N, HN) y
96% (Cα, Cβ)
Falta analizar
Falta analizar
Se realizará en el
futuro para
refinar la
estructura
Confirmar las
asignaciones de
los Cα, por
HNCACB y
CBCA(CO)NH
138
Materiales y Métodos
ANEXO I
Lista de oligonucleótidos de ADN utilizados para realizar las construcciones de CAT
flanqueadas por las regiones intergénicas completa o delecionada de TcSMUG-L.
Clon
Oligonucleótido
Secuencia
CAT
CAT-se
5’-gggATGGAGAAAAAAATCACTGGATATA-3’
CAT-as
5’-cccaagcttTTACGCCCCGCCCTGCCA-3’
SMUG-LΔGRE
1-SE
5’-cccaagcttTCGGTCTGGAGTCCCGTTGTG-3’
3-AS
5’-cggaattcGCACGCACAACCAAAGACACC-3’
1+-SE
5’-cccaagcttTGCGCCGCGTATATTTGAGC-3’
SMUG-LΔ1
SMUG-LΔ2
SMUG-LΔ3
SMUG-LΔARE
SMUG-LΔSire
“sense”
5’-gcttTGAGGACGGGGCGGGGCGCGTGCGCCGA-3’
“antisense”
5’-agcttCGGCGCACGCGCCCCGCCCCGTCCTCAA-3’
2-SE
5’-cggaattcTGCCCGTGCATTCTCTGCGAC-3’
2-AS
5’-cggaattcAAATATACGCGGCGCAGGCGCC-3’
3-SE
5’-cggaattcGTGGGGGGAAGCGTCGGTGCG-3’
3-AS
5’-cggaattcGCACGCACAACCAAAGACACC-3’
3-SE
5’-cggaattcGTGGGGGGAAGCGTCGGTGCG-3’
ΔARE-1
5’-cggaattcTTGTGAAAGGGATGTTCGC-3’
ΔARE-2
5’-cggaattcGGCGCACCGACGCTTCCCCC-3’
3-AS
5’-cggaattcGCACGCACAACCAAAGACACC-3’
Sire-SE
5’-cggaattcAGGCGAATATTTTTTTTCATCGG-3’
Sire-AS
5’-cggaattcCCCCCGCGAACATCCCTTTCAC-3’
139
Materiales y Métodos
ANEXO II
Se indica la secuencia de los oligonucleótidos utilizados, clasificados según el clon sobre
el que se diseñó cada uno. En minúsculas se indican las secuencias agregadas que no
corresponden al molde y se subrayan los sitios de restricción utilizados.
Oligos de ADN sintetizados para el clonado por PCR de un homologo de DEF-3 en T.
cruzi.Nota: R, purina; Y, pirimidina; I, deoxi-Inosina.
Oligonucleótido
Secuencia
Sentido
QSESELA
5’-AGRTAIGCIAGYTCYTGCTC-3’
Antisentido
KENEDDK
5’-GACGACAARCTIACIGAYTTG-3’
Sentido
LACLLC
5’-AAACTGGCTTGTCTGCTCTGC-3’
Sentido
EVGPCMEFK
5’-GACCTICARGAYCARGAYTAY-3’
Sentido
KRDEGQE-1
5’-CTCYTGICCYTCRTCICGYTT-3’
Antisentido
KRDEGQE-2
5’-TTRGCIGAYGARCCICAGGAG-3’
Sentido
DREMPPMDPK
5’-GAGATGCCICCIATGGAYCC-3’
Sentido
DAQQDLQDQDY-1
5’-GACCTICARGAYCARGAYTAY-3’
Sentido
DAQQDLQDQDY-2
5’-TGIAGGTCYTGYTGIGCRTC-3’
Antisentido
140
Materiales y Métodos
ANEXO III
Números de acceso al GenBank de los clones obtenidos durante esta Tesis.
Tcubp-1 AF372519
Tcubp-2 AF497746
Clon
a
TcUBP-1
TcUBP-1ΔN
TcUBP-1ΔNQ
TcUBP-1ΔQ
TcUBP-1ΔQG1
TcUBP-1ΔQG2
TcUBP-1 (Y-A)ΔQ
TcUBP-2
TcUBP-2ΔN
TcUBP-2ΔC
TcUBP-2ΔCG1
TcUBP-2ΔCG2
TcPABC
TcPABP1
Cebador
Secuencia
NH2 -BamHI
COOHh-EcoRI
NH2 -int-BamHI
COOH-EcoRI
NH2 -int-BamHI
G ln-as-EcoRI
NH2 -BamHI
G ln-as-EcoRI
NH2 -BamHI
dgngyl-EcoRI
NH2 -BamHI
NES-as-EcoRI
NH2 -BamHI
UBP1-GNGYLGA
UBP1(Y-A)
COOHh-EcoRI
NH2 -BamHI
COOH-EcoRI
NH2 -int-BamHI
COOH-EcoRI
NH2 -BamHI
G ln-as-EcoRI
NH2 -BamHI
gvstgf-EcoRI
NH2 -BamHI
Nes-as-EcoRI
PABC-1
PABC-2
PABP-N
PABC-2
5’-cgggatccATGAGCCAAATTCCGTTGGTTTC-3’
5’-cggaattcTTACCTTCGAACAGGACGGGC-3’
5’-cgggatccATGAACCCCGAGCCCGATGTT-3’
5’-cggaattcTTACCTTCGAACAGGACGGGC-3’
5’-cgggatccATGAACCCCGAGCCCGATGTT-3’
5’-cgaattcTTACGCGTACGGGTTCGCAGCG-3 ’
5’-cgggatccATGAGCCAAATTCCGTTGGTTTC-3’
5’-cgaattcTTACGCGTACGGGTTCGCAGCG-3 ’
5’-cgggatccATGAGCCAAATTCCGTTGGTTTC-3’
5’-ggaattcTTAAAGATATCCGTTGCCGTCTCC-3’
5’-cgggatccATGAGCCAAATTCCGTTGGTTTC-3’
5’-cgaattcTTAGGGGCGCTGGTGACCACTGGC-3’
5’-cgggatccATGAGCCAAATTCCGTTGGTTTC-3’
5’-gatatcCGCGCCAAGATATCCGTTGCC-3’
5’-gatatcGCCGGTGGCGCCGGCGCAGCCCCT-3’
5’-cggaattcTTACCTTCGAACAGGACGGGC-3’
5’-cgggatccATGTCTCAACAGATGCAATAC-3’
5’-cggaattcCTACTGACGCGGCACCGACGG-3’
5’-cgggatccATGAACCCCGAGCCCGATGTT-3’
5’-cggaattcCTACTGACGCGGCACCGACGG-3’
5’-cgggatccATGTCTCAACAGATGCAATAC-3’
5’-cgaattcTTACGCGTACGGGTTCGCAGCG-3 ’
5’-cgggatccATGTCTCAACAGATGCAATAC-3’
5’-cggaattcTTAAAACCCAGTGCTTACGCCG-3’
5’-cgggatccATGTCTCAACAGATGCAATAC-3’
5’-cgaattcTTAGGGGCGCTGGTGACCACTGGC-3’
5’-ggatccTCTTTGGCTTCACAGGGACAG-3’
5’-gaattcGTAAACGTTCATGTGGCGATTC-3’
5’-ggatccATGTCGAACTTTCCTGCTGCG-3’
5’-gaattcGTAAACGTTCATGTGGCGATTC-3’
b
a
Todas las construcciones fueron clonadas en el vector pGEX-2T (Amersham).
b
Los sitios de restricción utilizados para los clonados se encuentran subrayados.
141
Materiales y Métodos
ANEXO IV.
Oligonucleótidos sintéticos utilizados para preparar los sustratos de ARN por transcripción
“in vitro”. Nota: Los sitios de restricción utilizados para los clonados se encuentran subrayados.
ARN
SMUG-L-ARE
SMUG-L-ARE-1
SMUG-L-ARE-2
SMUG-L-ARE-3
SMUG-S-ARE
HEX-T-ARE
PLC-ARE
P1
P2
P3
P4
P1-GGG
Oligonucleótidos
5’-aattcAATTTTAAAATTTATTTAATGTTGTTTTGATTTATTTATTTTAAa-3’
5’-ttcgaATTAAAATAAATAAATCAAAACAACATTAAATAAATTTTAAAATTg-3’
5’-aattcATTTATTTAATGTTGTTTTGATTTATTTATTa-3’
5’-ttcgaAATAAATAAATCAAAACAACATTAAATAAATg-3’
5’-aattcTTATTTATTa -3’
5’-ttcgaAATAAATAAg-3’
5’-aattcTTTTATTTATTTT a-3’
5’-ttcgaAAAATAAATAAAAg-3’
5’-aattcATTTTATTTTTATTTTTAa-3’
5’-ttcgaTAAAAATAAAAATAAAATg-3’
5’-ttcgaTAAATAAATAAATg-3’
5’-ttcgaTAAATAAATAAATg-3’
5’-aattcATATATATATATATATATATATATTTATTTa-3’
5’-ttcgaAAATAAATATATATATATATATATATATATg-3 ’
5’-aattcGTTTTGTTTTTGTTTTTGa-3’
5’-ttcgaCAAAAACAAAAACAAAAg-3 ’
5’-aattcATGTTGTTGTTGTTGTTGa-3’
5’-ttcgaCAACAACAACAACAACATG-3’
5’-aattcATGGTGTTGGTGTTGGTGa-3’
5’-ttcgaCACCAA CACCAACACCATg-3’
5’-aattcATATTATTATTATTATTAa-3’
5’-ttcgaTAATAATAATAATAATATg-3’
5’-aattcGTTTTGTTTTTGTGGGTGa-3’
5’-ttcgaCACCCACAAAAACAAAAg-3’
142
REFERENCIAS
Referencias
Aeschbach, R., Amado, R. and Neukom, H. (1976) Formation of dityrosine cross-links in
proteins by oxidation of tyrosine residues. Biochim Biophys Acta, 439, 292-301.
Aguero, F., Verdun, R.E., Frasch, A.C. and Sanchez, D.O. (2000) A random sequencing approach
for the analysis of the Trypanosoma cruzi genome: general structure, large gene and repetitive
DNA families, and gene discovery. Genome Res, 10, 1996-2005.
Akhtar, A., Zink, D. and Becker, P.B. (2000) Chromodomains are protein-RNA interaction modules.
Nature, 407, 405-409.
Allmang, C., Petfalski, E., Podtelejnikov, A., Mann, M., Tollervey, D. and Mitchell, P. (1999) The
yeast exosome and human PM-Scl are related complexes of 3' —> 5' exonucleases. Genes Dev,
13, 2148-2158.
Almeida, I.C., Ferguson, M.A., Schenkman, S. and Travassos, L.R. (1994) Lytic anti-alpha-galactosyl
antibodies from patients with chronic Chagas’ disease recognize novel O-linked oligosaccharides
on mucin-like glycosyl-phosphatidylinositol-anchored glycoproteins of Trypanosoma cruzi. Biochem
J, 304, 793-802.
Amster-Choder, O. and Wright, A. (1992) Modulation of the dimerization of a transcriptional
antiterminator protein by phosphorylation.Science, 257, 1395-1398.
Andrews, N.W., Abrams, C.K., Slatin, S.L. and Griffiths, G. (1990) A T. cruzi-secreted protein
immunologically related to the complement component C9: evidence for membrane pore-forming
activity at low pH. Cell, 61, 1277-1287.
Aphasizhev, R., Sbicego, S., Peris, M., Jang, S.H., Aphasizheva, I., Simpson, A.M., Rivlin, A. and
Simpson, L. (2002) Trypanosome mitochondrial 3' terminal uridylyl transferase (TUTase): the key
enzyme in U-insertion/deletion RNA editing. Cell, 108, 637-648.
Argaman, M., Aly, R. and Shapira, M. (1994) Expression of heat shock protein 83 in Leishmania
is regulated post-transcriptionally. Mol Biochem Parasitol, 64, 95-110.
Avis, J.M., Allain, F.H., Howe, P.W., Varani, G., Nagai, K. and Neuhaus, D. (1996) Solution structure
of the N-terminal RNP domain of U1A protein: the role of C-terminal residues in structure stability
and RNA binding. J Mol Biol, 257, 398-411.
Bakheet, T., Frevel, M., Williams, B.R., Greer, W. and Khabar, K.S. (2001) ARED: human AU-rich
element-containing mRNA database reveals an unexpectedly diverse functional repertoire of
encoded proteins. Nucleic Acids Res, 29, 246-254.
Bartels, C., Xia, T.H., Billeter, M., Güntert, P. and Wüthrich, K. (1995) The program XEASY for
computer-supported NMR spectral analysis of biological macromolecules. J. Biomol. NMR, 6, 110.
Bastin, P., Ellis, K., Kohl, L. and Gull, K. (2000) Flagellum ontogeny in trypanosomes studied via
an inherited and regulated RNA interference system. J Cell Sci, 113, 3321-3328.
Bates, E.J., Knuepfer, E. and Smith, D.F. (2000) Poly(A)-binding protein I of Leishmania: functional
analysis and localisation in trypanosomatid parasites. Nucleic Acids Res, 28, 1211-1220.
Batista, J.A., Teixeira, S.M., Donelson, J.E., Kirchhoff, L.V. and de Sa, C.M. (1994) Characterization
of a Trypanosoma cruzi poly(A)-binding protein and its genes. Mol Biochem Parasitol, 67, 301312.
Benne, R., Van den Burg, J., Brakenhoff, J.P., Sloof, P., Van Boom, J.H. and Tromp, M.C. (1986)
Major transcript of the frameshifted coxII gene from trypanosome mitochondria contains four
nucleotides that are not encoded in the DNA. Cell, 46, 819-826.
Berberof, M., Vanhamme, L., Tebabi, P., Pays, A., Jefferies, D., Welburn, S. and Pays, E. (1995)
144
Referencias
The 3'-terminal region of the mRNAs for VSG and procyclin can confer stage specificity to gene
expression in Trypanosoma brucei. EMBO J, 14, 2925-2934.
Bernstein, E., Caudy, A.A., Hammond, S.M. and Hannon, G.J. (2001) Role for a bidentate
ribonuclease in the initiation step of RNA interference. Nature, 409, 363-366.
Biamonti, G. and Riva, S. (1994) New insights into the auxiliary domains of eukaryotic RNAbinding proteins. FEBS Letters, 340, 1-8.
Billaut-Mulot, O., Fernandez-Gomez, R., Loyens, M. and Ouaissi, A. (1996) Trypanosoma cruzi
elongation factor 1-alpha: nuclear localization in parasites undergoing apoptosis. Gene, 174, 1926.
Borst, P. (2002) Antigenic variation and allelic exclusion. Cell, 109, 5-8.
Bousquet-Antonelli, C., Presutti, C. and Tollervey, D. (2000) Identification of a regulated pathway
for nuclear pre-mRNA turnover. Cell, 102, 765-775.
Branden, C. and Tooze, J. (1991) In: Introduction to Protein Structure. Garland Publishing, Inc.,
New York.
Brener, Z. (1973) Biology of Trypanosoma cruzi. Annu Rev Microbiol, 27, 347-382.
Brittingham, A., Miller, M.A., Donelson, J.E. and Wilson, M.E. (2001) Regulation of GP63 mRNA
stability in promastigotes of virulent and attenuated Leishmania chagasi. Mol Biochem Parasitol,
112, 51-59.
Buckanovich, R.J. and Darnell, R.B. (1997) The neuronal RNA binding protein Nova-1 recognizes
specific RNA targets in vitro and in vivo. Mol Cell Biol, 17, 3194-3201.
Burd, C.G. and Dreyfuss, G. (1994) Conserved structures and diversity of functions of RNAbinding proteins. Science, 265, 615-621.
Caputi, M., Casari, G., Guenzi, S., Tagliabue, R., Sidoli, A., Melo, C.A. and Baralle, F.E. (1994) A
novel bipartite splicing enhancer modulates the differential processing of the human fibronectin
EDA exon. Nucleic Acids Res, 22, 1018-1022.
Carballo, E., Lai, W.S. and Blackshear, P.J. (1998) Feedback inhibition of macrophage tumor
necrosis factor-alpha production by tristetraprolin. Science, 281, 1001-1005.
Cartegni, L., Maconi, M., Morandi, E., Cobianchi, F., Riva, S. and Biamonti, G. (1996) hnRNP A1
selectively interacts through its Gly-rich domain with different RNA-binding proteins. J Mol Biol,
259, 337-348.
Chang, J.Y. (1985) Thrombin specificity. Requirement for apolar amino acids adjacent to the
thrombin cleavage site of polypeptide substrate. Eur J Biochem, 151, 217-224.
Chappell, S.A., Edelman, G.M. and Mauro, V.P. (2000) A 9-nt segment of cellular mRNA can
function as an internal ribosome entry site (IRES) and when present in linked copies greatly
enhances IRES activity. Proc Natl Acad Sci U S A, 97, 1536-1541.
Charest, H., Zhang, W.W. and Matlashewski, G. (1996) The developmental expression of Leishmania
donovani A2 amastigote- specific genes is post-transcriptionally mediated and involves elements
located in the 3'-untranslated region. J Biol Chem, 271, 17081-17090.
Chen, C.Y., Gherzi, R., Ong, S.E., Chan, E.L., Raijmakers, R., Pruijn, G.J., Stoecklin, G., Moroni,
C., Mann, M. and Karin, M. (2001) AU-binding proteins recruit the exosome to degrade AREcontaining mRNAs. Cell, 107, 451-464.
Chen, C.Y. and Shyu, A.B. (1995) AU-rich elements: characterization and importance in mRNA
145
Referencias
degradation. Trends Biochem Sci, 20, 465-470.
Chen, C.Y., Xu, N. and Shyu, A.B. (2002) Highly selective actions of HuR in antagonizing AU-rich
element- mediated mRNA destabilization. Mol Cell Biol, 22, 7268-7278.
Clayton, C.E. (2002) Life without transcriptional control? From fly to man and back again. EMBO
J, 21, 1881-1888.
Clayton, C.E., Fueri, J.P., Itzhaki, J.E., Bellofatto, V., Sherman, D.R., Wisdom, G.S., Vijayasarathy,
S. and Mowatt, M.R. (1990) Transcription of the procyclic acidic repetitive protein genes of
Trypanosoma brucei. Mol Cell Biol, 10, 3036-3047.
Clore, G.M. and Gronenborn, A.M. (1991) Structures of larger proteins in solution: three- and
four-dimensional heteronuclear NMR spectroscopy. Science, 252, 1390-1399.
Clore, G.M. and Gronenborn, A.M. (1998) New methods of structure refinement for macromolecular
structure determination by NMR. Proc Natl Acad Sci U S A, 95, 5891-5898.
Clore, G.M. and Schwieters, C.D. (2002) Theoretical and computational advances in biomolecular
NMR spectroscopy. Curr Opin Struct Biol, 12, 146-153.
Cobianchi, F., Calvio, C., Stoppini, M., Buvoli, M. and Riva, S. (1993) Phosphorylation of human
hnRNP protein A1 abrogates in vitro strand annealing activity. Nucleic Acids Res, 21, 949-955.
Cogoni, C. and Macino, G. (1999) Homology-dependent gene silencing in plants and fungi: a
number of variations on the same theme. Curr Opin Microbiol, 2, 657-662.
Constantine, K.L., Goldfarb, V., Wittekind, M., Friedrichs, M.S., Anthony, J., Ng, S.C. and Mueller,
L. (1993) Aliphatic 1H and 13C resonance assignments for the 26-10 antibody VL domain derived
from heteronuclear multidimensional NMR spectroscopy. J Biomol NMR, 3, 41-54.
Conte, M.R., Grune, T., Ghuman, J., Kelly, G., Ladas, A., Matthews, S. and Curry, S. (2000)
Structure of tandem RNA recognition motifs from polypyrimidine tract binding protein reveals
novel features of the RRM fold. EMBO J, 19, 3132-3141.
Craig, A.W., Haghighat, A., Yu, A.T. and Sonenberg, N. (1998) Interaction of polyadenylate-binding
protein with the eIF4G homologue PAIP enhances translation. Nature, 392, 520-523.
Cramer, P., Caceres, J.F., Cazalla, D., Kadener, S., Muro, A.F., Baralle, F.E. and Kornblihtt, A.R.
(1999) Coupling of transcription with alternative splicing: RNA pol II promoters modulate SF2/
ASF and 9G8 effects on an exonic splicing enhancer. Mol Cell, 4, 251-258.
Crowder, S., Holton, J. and Alber, T. (2001) Covariance analysis of RNA recognition motifs identifies
functionally linked amino acids. J Mol Biol, 310, 793-800.
Crowder, S.M., Kanaar, R., Rio, D.C. and Alber, T. (1999) Absence of interdomain contacts in the
crystal structure of the RNA recognition motifs of Sex-lethal. Proc Natl Acad Sci U S A, 96, 48924897.
Das, A. and Bellofatto, V. (2003) RNA polymerse II-dependent transcription in trypanosomes is
associated with a SNAP complex-like transcription factor. Proc Natl Acad Sci U S A, 100, 80-85.
Das, A., Peterson, G.C., Kanner, S.B., Frevert, U. and Parsons, M. (1996) A major tyrosinephosphorylated protein of Trypanosoma brucei is a nucleolar RNA-binding protein. J Biol Chem,
271, 15675-15681.
de Sousa, M.A. (1983) A simple method to purify biologically and antigenically preserved
bloodstream trypomastigotes of Trypanosoma cruzi using DEAE-cellulose columns. Mem Inst
Oswaldo Cruz, 78, 317-333.
146
Referencias
DeMaria, C.T., Sun, Y., Long, L., Wagner, B.J. and Brewer, G. (1997) Structural determinants in
AUF1 required for high affinity binding to A + U-rich elements. J Biol Chem, 272, 27635-27643.
Deo, R.C., Bonanno, J.B., Sonenberg, N. and Burley, S.K. (1999) Recognition of polyadenylate
RNA by the poly(A)-binding protein. Cell, 98, 835-845.
Derry, J.J., Richard, S., Valderrama Carvajal, H., Ye, X., Vasioukhin, V., Cochrane, A.W., Chen, T.
and Tyner, A.L. (2000) Sik (BRK) phosphorylates Sam68 in the nucleus and negatively regulates
its RNA-binding ability. Mol Cell Biol, 20, 6114-6126.
Di Noia, J.M. (2000) Família de genes que codifican proteínas de tipo mucina en Trypanosoma
cruzi. Universidad Nacional de Buenos Aires, Argentina, Buenos Aires.
Di Noia, J.M., Buscaglia, C.A., De Marchi, C.R., Almeida, I.C. and Frasch, A.C. (2002) A
Trypanosoma cruzi small surface molecule provides the first immunological evidence that Chagas’
disease is due to a single parasite lineage. J Exp Med, 195, 401-413.
Di Noia, J.M., D’Orso, I., Aslund, L., Sanchez, D.O. and Frasch, A.C. (1998) The Trypanosoma
cruzi mucin family is transcribed from hundreds of genes having hypervariable regions. J Biol
Chem, 273, 10843-10850.
Di Noia, J.M., D’Orso, I., Sanchez, D.O. and Frasch, A.C. (2000) AU-rich elements in the 3'untranslated region of a new mucin-type gene family of Trypanosoma cruzi confers mRNA instability
and modulates translation efficiency. J Biol Chem, 275, 10218-10227.
Di Noia, J.M., Sanchez, D.O. and Frasch, A.C. (1995) The protozoan Trypanosoma cruzi has a
family of genes resembling the mucin genes of mammalian cells. J Biol Chem, 270, 24146-24149.
Ding, J., Hayashi, M.K., Zhang, Y., Manche, L., Krainer, A.R. and Xu, R.M. (1999) Crystal structure
of the two-RRM domain of hnRNP A1 (UP1) complexed with single-stranded telomeric DNA. Genes
Dev, 13, 1102-1115.
DiNitto, J.P. and Huber, P.W. (2001) A role for aromatic amino acids in the binding of Xenopus
ribosomal protein L5 to 5S rRNA. Biochemistry, 40, 12645-12653.
Djikeng, A., Shi, H., Tschudi, C. and Ullu, E. (2001) RNA interference in Trypanosoma brucei:
cloning of small interfering RNAs provides evidence for retroposon-derived 24-26-nucleotide RNAs.
RNA, 7, 1522-1530.
Dorn, P.L., Aman, R.A. and Boothroyd, J.C. (1991) Inhibition of protein synthesis results in
super-induction of procyclin RNA levels. Mol Biochem Parasitol, 44, 133-139.
Dorokhov, Y.L., Skulachev, M.V., Ivanov, P.A., Zvereva, S.D., Tjulkina, L.G., Merits, A., Gleba,
Y.Y., Hohn, T. and Atabekov, J.G. (2002) Polypurine (A)-rich sequences promote cross-kingdom
conservation of internal ribosome entry site. Proc Natl Acad Sci U S A, 99, 5301-5306.
Downey, N. and Donelson, J.E. (1999) Search for promoters for the GARP and rRNA genes of
Trypanosoma congolense. Mol Biochem Parasitol, 104, 25-38.
Drabkin, H.A., West, J.D., Hotfilder, M., Heng, Y.M., Erickson, P., Calvo, R., Dalmau, J., Gemmill,
R.M. and Sablitzky, F. (1999) DEF-3(g16/NY-LU-12), an RNA binding protein from the 3p21.3
homozygous deletion region in SCLC. Oncogene, 18, 2589-2597.
Dragon, E.A., Sias, S.R., Kato, E.A. and Gabe, J.D. (1987) The genome of Trypanosoma cruzi
contains a constitutively expressed, tandemly arranged multicopy gene homologous to a major
heat shock protein. Mol Cell Biol, 7, 1271-1275.
Dreyfuss, G., Kim, V.N. and Kataoka, N. (2002) Messenger-RNA-binding proteins and the messages
they carry. Nat Rev Mol Cell Biol, 3, 195-205.
147
Referencias
Edwards, T.A., Pyle, S.E., Wharton, R.P. and Aggarwal, A.K. (2001) Structure of Pumilio reveals
similarity between RNA and peptide binding motifs. Cell, 105, 281-289.
Elias, M.C., Faria, M., Mortara, R.A., Motta, M.C., de Souza, W., Thiry, M. and Schenkman, S.
(2002) Chromosome localization changes in the Trypanosoma cruzi nucleus. Eukaryot Cell, 1,
944-953.
Elias, M.C., Marques-Porto, R., Freymuller, E. and Schenkman, S. (2001) Transcription rate
modulation through the Trypanosoma cruzi life cycle occurs in parallel with changes in nuclear
organisation. Mol Biochem Parasitol, 112, 79-90.
Estevez, A.M., Kempf, T. and Clayton, C. (2001) The exosome of Trypanosoma brucei. EMBO J, 20,
3831-3839.
Evers, R., Hammer, A., Kock, J., Jess, W., Borst, P., Memet, S. and Cornelissen, A.W. (1989)
Trypanosoma brucei contains two RNA polymerase II largest subunit genes with an altered Cterminal domain. Cell, 56, 585-597.
Fan, X.C. and Steitz, J.A. (1998) Overexpression of HuR, a nuclear-cytoplasmic shuttling protein,
increases the in vivo stability of ARE-containing mRNAs. EMBO J, 17, 3448-3460.
Fersht, A.R. and Daggett, V. (2002) Protein folding and unfolding at atomic resolution. Cell, 108,
573-582.
Fields, S. and Song, O. (1989) A novel genetic system to detect protein-protein interactions. Nature,
340, 245-246.
Fierro-Monti, I. and Mathews, M.B. (2000) Proteins binding to duplexed RNA: one motif, multiple
functions. Trends Biochem Sci, 25, 241-246.
Ford, L.P., Bagga, P.S. and Wilusz, J. (1997) The poly(A) tail inhibits the assembly of a 3'-to-5'
exonuclease in an in vitro RNA stability system. Mol Cell Biol, 17, 398-406.
Fourney, R.M., Miyakoshi, J., Day III, R.S. and Paterson, M. (1978) Northern blotting: efficient
RNA staining and transfer. FOCUS, 10, 5-9.
Frasch, A.C. (1994) Trans-sialidase, SAPA amino acid repeats and the relationship between
Trypanosoma cruzi and the mammalian host. Parasitology, 108, S37-44.
Fraser, H.B., Hirsh, A.E., Steinmetz, L.M., Scharfe, C. and Feldman, M.W. (2002) Evolutionary
rate in the protein interaction network. Science, 296, 750-752.
Frey, S., Pool, M. and Seedorf, M. (2001) Scp160p, an RNA-binding, polysome-associated protein,
localizes to the endoplasmic reticulum of Saccharomyces cerevisiae in a microtubule- dependent
manner. J Biol Chem, 276, 15905-15912.
Furger, A., Schurch, N., Kurath, U. and Roditi, I. (1997) Elements in the 3' untranslated region of
procyclin mRNA regulate expression in insect forms of Trypanosoma brucei by modulating RNA
stability and translation. Mol Cell Biol, 17, 4372-4380.
Gallouzi, I.E., Brennan, C.M., Stenberg, M.G., Swanson, M.S., Eversole, A., Maizels, N. and Steitz,
J.A. (2000) HuR binding to cytoplasmic mRNA is perturbed by heat shock. Proc Natl Acad Sci U S
A, 97, 3073-3078.
Gazzinelli, R.T., Pereira, M.E., Romanha, A., Gazzinelli, G. and Brener, Z. (1991) Direct lysis of
Trypanosoma cruzi: a novel effector mechanism of protection mediated by human anti-gal
antibodies. Parasite Immunol, 13, 345-356.
Ghisolfi, L., Joseph, G., Amalric, F. and Erard, M. (1992a) The glycine-rich domain of nucleolin
has an unusual supersecondary structure responsible for its RNA-helix-destabilizing properties.
148
Referencias
J Biol Chem, 267, 2955-2959.
Ghisolfi, L., Kharrat, A., Joseph, G., Amalric, F. and Erard, M. (1992b) Concerted activities of the
RNA recognition and the glycine-rich C- terminal domains of nucleolin are required for efficient
complex formation with pre-ribosomal RNA. Eur J Biochem, 209, 541-548.
Gilinger, G. and Bellofatto, V. (2001) Trypanosome spliced leader RNA genes contain the first
identified RNA polymerase II gene promoter in these organisms. Nucleic Acids Res, 29, 15561564.
Gonzalez, N.S. and Cazzulo, J.J. (1989) Effects of trypanocidal drugs on protein biosynthesis in
vitro and in vivo by Trypanosoma cruzi. Biochem Pharmacol, 38, 2873-2877.
Gorlach, M., Wittekind, M., Beckman, R.A., Mueller, L. and Dreyfuss, G. (1992) Interaction of the
RNA-binding domain of the hnRNP C proteins with RNA. EMBO J, 11, 3289-3295.
Gosser, Y., Hermann, T., Majumdar, A., Hu, W., Frederick, R., Jiang, F., Xu, W. and Patel, D.J.
(2001) Peptide-triggered conformational switch in HIV-1 RRE RNA complexes. Nat Struct Biol, 8,
146-150.
Graham, S.V. and Barry, J.D. (1995) Transcriptional regulation of metacyclic variant surface
glycoprotein gene expression during the life cycle of Trypanosoma brucei. Mol Cell Biol, 15, 59455956.
Graham, S.V. and Barry, J.D. (1996) Polysomal, procyclin mRNAs accumulate in bloodstream
forms of monomorphic and pleomorphic trypanosomes treated with protein synthesis inhibitors.
Mol Biochem Parasitol, 80, 179-191.
Grishin, N. (2001) KH domain: one motif, two folds. Nucleic Acids Res, 29, 638-643.
Grishok, A., Pasquinelli, A.E., Conte, D., Li, N., Parrish, S., Ha, I., Baillie, D.L., Fire, A., Ruvkun,
G. and Mello, C.C. (2001) Genes and mechanisms related to RNA interference regulate expression
of the small temporal RNAs that control C. elegans developmental timing. Cell, 106, 23-34.
Grosset, C., Chen, C.Y., Xu, N., Sonenberg, N., Jacquemin-Sablon, H. and Shyu, A.B. (2000) A
mechanism for translationally coupled mRNA turnover: interaction between the poly(A) tail and a
c-fos RNA coding determinant via a protein complex. Cell, 103, 29-40.
Grzesiek, S. and Bax, A. (1993) Amino acid type determination in the sequential assingment
procedure of uniformly 13C/15N-enriched proteins. J Biomol NMR, 3, 185-204.
Grzesiek, S., Dobeli, H., Gentz, R., Garotta, G., Labhardt, A.M. and Bax, A. (1992) 1H, 13C, and
15N NMR backbone assignments and secondary structure of human interferon-gamma.
Biochemistry, 31, 8180-8190.
Handa, N., Nureki, O., Kurimoto, K., Kim, I., Sakamoto, H., Shimura, Y., Muto, Y. and Yokoyama,
S. (1999) Structural basis for recognition of the tra mRNA precursor by the Sex- lethal protein.
Nature, 398, 579-585.
Hellman, U. (2000) In: Sample preparation by SDS-PAGE and in gel-digestion. Proteomics in
functional genomics. Protein structure analysis, Birkhauser Verlag AG, Basel, pp. 43-54.
Hendriks, E.F., Robinson, D.R., Hinkins, M. and Matthews, K.R. (2001) A novel CCCH protein
which modulates differentiation of Trypanosoma brucei to its procyclic form. EMBO J, 20, 67006711.
Herold, A., Klymenko, T. and Izaurralde, E. (2001) NXF1/p15 heterodimers are essential for
mRNA nuclear export in Drosophila. RNA, 7, 1768-1780.
Herold, A., Suyama, M., Rodrigues, J.P., Braun, I.C., Kutay, U., Carmo-Fonseca, M., Bork, P. and
149
Referencias
Izaurralde, E. (2000) TAP (NXF1) belongs to a multigene family of putative RNA export factors
with a conserved modular architecture. Mol Cell Biol, 20, 8996-9008.
Hirsh, A.E. and Fraser, H.B. (2001) Protein dispensability and rate of evolution. Nature, 411,
1046-1049.
Hoek, M., Zanders, T. and Cross, G.A. (2002) Trypanosoma brucei expression-site-associatedgene-8 protein interacts with a Pumilio family protein. Mol Biochem Parasitol, 120, 269-283.
Hoshino, S., Hosoda, N., Araki, Y., Kobayashi, T., Uchida, N., Funakoshi, Y. and Katada, T. (1999)
Novel function of the eukaryotic polypeptide-chain releasing factor 3 (eRF3/GSPT) in the mRNA
degradation pathway. Biochemistry (Mosc), 64, 1367-1372.
Hotchkiss, T.L., Nerantzakis, G.E., Dills, S.C., Shang, L. and Read, L.K. (1999) Trypanosoma
brucei poly(A)-binding protein I cDNA cloning, expression and binding to 5 untranslated region
sequence elements. Mol Biochem Parasitol, 98, 117-129.
Hotz, H.R., Biebinger, S., Flaspohler, J. and Clayton, C. (1998) PARP gene expression: control at
many levels. Mol Biochem Parasitol, 91, 131-143.
Hotz, H.R., Hartmann, C., Huober, K., Hug, M. and Clayton, C. (1997) Mechanisms of developmental
regulation in Trypanosoma brucei: a polypyrimidine tract in the 3'-untranslated region of a surface
protein mRNA affects RNA abundance and translation. Nucleic Acids Res, 25, 3017-3026.
Hotz, H.R., Lorenz, P., Fischer, R., Krieger, S. and Clayton, C. (1995) Role of 3'-untranslated
regions in the regulation of hexose transporter mRNAs in Trypanosoma brucei. Mol Biochem
Parasitol, 75, 1-14.
Hutvagner, G., McLachlan, J., Pasquinelli, A.E., Balint, E., Tuschl, T. and Zamore, P.D. (2001) A
cellular function for the RNA-interference enzyme Dicer in the maturation of the let-7 small
temporal RNA. Science, 293, 834-838.
Inoue, H., Nojima, H. and Okayama, H. (1990) High efficiency transformation of Escherichia coli
with plasmids. Gene, 96, 23-28.
Inoue, M., Muto, Y., Sakamoto, H. and Yokoyama, S. (2000) NMR studies on functional structures
of the AU-rich element-binding domains of Hu antigen C. Nucleic Acids Res, 28, 1743-1750.
Irmer, H. and Clayton, C. (2001) Degradation of the unstable EP1 mRNA in Trypanosoma brucei
involves initial destruction of the 3'-untranslated region. Nucleic Acids Res, 29, 4707-4715.
Ishigaki, Y., Li, X., Serin, G. and Maquat, L.E. (2001) Evidence for a pioneer round of mRNA
translation: mRNAs subject to nonsense-mediated decay in mammalian cells are bound by CBP80
and CBP20. Cell, 106, 607-617.
Ishima, R. and Torchia, D.A. (2000) Protein dynamics from NMR. Nat Struct Biol, 7, 740-743.
Ismaili, N., Perez-Morga, D., Walsh, P., Cadogan, M., Pays, A., Tebabi, P. and Pays, E. (2000)
Characterization of a Trypanosoma brucei SR domain-containing protein bearing homology to
cis-spliceosomal U1 70 kDa proteins. Mol Biochem Parasitol, 106, 109-120.
Ismaili, N., Perez-Morga, D., Walsh, P., Mayeda, A., Pays, A., Tebabi, P., Krainer, A.R. and Pays, E.
(1999) Characterization of a SR protein from Trypanosoma brucei with homology to RNA-binding
cis-splicing proteins. Mol Biochem Parasitol, 102, 103-115.
Jackson, D.A., Pombo, A. and Iborra, F. (2000) The balance sheet for transcription: an analysis of
nuclear RNA metabolism in mammalian cells. FASEB J, 14, 242-254.
Jacobson, A. and Peltz, S.W. (1996) Interrelationships of the pathways of mRNA decay and
translation in eukaryotic cells. Annu Rev Biochem, 65, 693-739.
150
Referencias
Jess, W., Hammer, A. and Cornelissen, A.W. (1989) Complete sequence of the gene encoding the
largest subunit of RNA polymerase I of Trypanosoma brucei. FEBS Lett, 249, 123-128.
Kanaar, R., Lee, A.L., Rudner, D.Z., Wemmer, D. and Rio, D.C. (1995) Interaction of the sex-lethal
RNA binding domain with RNA. EMBO J, 14, 4530-4539.
Kapotas, N. and Bellofatto, V. (1993) Differential response to RNA trans-splicing signals within
the phosphoglycerate kinase gene cluster in Trypanosoma brucei. Nucleic Acids Res, 21, 40674072.
Kataoka, N., Yong, J., Kim, V.N., Velazquez, F., Perkinson, R.A., Wang, F. and Dreyfuss, G. (2000)
Pre-mRNA splicing imprints mRNA in the nucleus with a novel RNA-binding protein that persists
in the cytoplasm. Mol Cell, 6, 673-682.
Kelly, J.M., Ward, H.M., Miles, M.A. and Kendall, G. (1992) A shuttle vector which facilitates the
expression of transfected genes in Trypanosoma cruzi and Leishmania. Nucleic Acids Res, 20,
3963-3969.
Ketting, R.F., Haverkamp, T.H., van Luenen, H.G. and Plasterk, R.H. (1999) Mut-7 of C. elegans,
required for transposon silencing and RNA interference, is a homolog of Werner syndrome helicase
and RNaseD. Cell, 99, 133-141.
Khaleghpour, K., Svitkin, Y.V., Craig, A.W., DeMaria, C.T., Deo, R.C., Burley, S.K. and Sonenberg,
N. (2001) Translational repression by a novel partner of human poly(A) binding protein, Paip2.
Mol Cell, 7, 205-216.
Kiledjian, M. and Dreyfuss, G. (1992) Primary structure and binding activity of the hnRNP U
protein: binding RNA through RGG box. EMBO J, 11, 2655-2664.
Kim, V.N., Kataoka, N. and Dreyfuss, G. (2001) Role of the nonsense-mediated decay factor hUpf3
in the splicing-dependent exon-exon junction complex. Science, 293, 1832-1836.
Klein Gunnewiek, J.M., Hussein, R.I., van Aarssen, Y., Palacios, D., de Jong, R., van Venrooij,
W.J. and Gunderson, S.I. (2000) Fourteen residues of the U1 snRNP-specific U1A protein are
required for homodimerization, cooperative RNA binding, and inhibition of polyadenylation. Mol
Cell Biol, 20, 2209-2217.
Kock, J., Evers, R. and Cornelissen, A.W. (1988) Structure and sequence of the gene for the
largest subunit of trypanosomal RNA polymerase III. Nucleic Acids Res, 16, 8753-8772.
Kontoyiannis, D., Pasparakis, M., Pizarro, T.T., Cominelli, F. and Kollias, G. (1999) Impaired on/
off regulation of TNF biosynthesis in mice lacking TNF AU- rich elements: implications for joint
and gut-associated immunopathologies. Immunity, 10, 387-398.
Kooter, J.M., Matzke, M.A. and Meyer, P. (1999) Listening to the silent genes: transgene silencing,
gene regulation and pathogen control. Trends Plant Sci, 4, 340-347.
Kozlov, G., Siddiqui, N., Coillet-Matillon, S., Trempe, J.F., Ekiel, I., Sprules, T. and Gehring, K.
(2002) Solution structure of the orphan PABC domain from Saccharomyces cerevisiae poly(A)binding protein. J Biol Chem, 277, 22822-22828.
Kozlov, G., Trempe, J.F., Khaleghpour, K., Kahvejian, A., Ekiel, I. and Gehring, K. (2001) Structure
and function of the C-terminal PABC domain of human poly(A)- binding protein. Proc Natl Acad
Sci U S A, 98, 4409-4413.
Kuboniwa, H., Grzesiek, S., Delaglio, F. and Bax, A. (1994) Measurement of HN-H alpha J couplings
in calcium-free calmodulin using new 2D and 3D water-flip-back methods. J Biomol NMR, 4, 871878.
Lagnado, C.A., Brown, C.Y. and Goodall, G.J. (1994) AUUUA is not sufficient to promote poly(A)
151
Referencias
shortening and degradation of an mRNA: the functional sequence within AU-rich elements may
be UUAUUUA(U/A)(U/A). Mol Cell Biol, 14, 7984-7995.
Lai, W.S., Carballo, E., Strum, J.R., Kennington, E.A., Phillips, R.S. and Blackshear, P.J. (1999)
Evidence that tristetraprolin binds to AU-rich elements and promotes the deadenylation and
destabilization of tumor necrosis factor alpha mRNA. Mol Cell Biol, 19, 4311-4323.
Lander, E.S., et al. (2001) Initial sequencing and analysis of the human genome. Nature, 409,
860-921.
Laufer, G., Schaaf, G., Bollgonn, S. and Gunzl, A. (1999) In vitro analysis of alpha-amanitinresistant transcription from the rRNA, procyclic acidic repetitive protein, and variant surface
glycoprotein gene promoters in Trypanosoma brucei. Mol Cell Biol, 19, 5466-5473.
LeBowitz, J.H., Smith, H.Q., Rusche, L. and Beverley, S.M. (1993) Coupling of poly(A) site selection
and trans-splicing in Leishmania. Genes Dev, 7, 996-1007.
Lee, M.G. and Van der Ploeg, L.H. (1997) Transcription of protein-coding genes in trypanosomes
by RNA polymerase I. Annu Rev Microbiol, 51, 463-489.
Levine, N.D., Corliss, J.O., Cox, F.E., Deroux, G., Grain, J., Honigberg, B.M., Leedale, G.F., Loeblich,
A.R., 3rd, Lom, J., Lynn, D., Merinfeld, E.G., Page, F.C., Poljansky, G., Sprague, V., Vavra, J. and
Wallace, F.G. (1980) A newly revised classification of the protozoa. J Protozool, 27, 37-58.
Lewin, B. (1997) In: Genes VI. Oxford Uniervsity Press and Cell Press, New York.
Lewis, H.A., Chen, H., Edo, C., Buckanovich, R.J., Yang, Y.Y., Musunuru, K., Zhong, R., Darnell,
R.B. and Burley, S.K. (1999) Crystal structures of Nova-1 and Nova-2 K-homology RNA-binding
domains. Structure Fold Des, 7, 191-203.
Liniger, M., Bodenmuller, K., Pays, E., Gallati, S. and Roditi, I. (2001) Overlapping sense and
antisense transcription units in Trypanosoma brucei. Mol Microbiol, 40, 869-878.
Liu, Q. and Dreyfuss, G. (1995) In vivo and in vitro arginine methylation of RNA-binding proteins.
Mol Cell Biol, 15, 2800-2808.
Loflin, P., Chen, C.Y. and Shyu, A.B. (1999) Unraveling a cytoplasmic role for hnRNP D in the in
vivo mRNA destabilization directed by the AU-rich element. Genes Dev, 13, 1884-1897.
Lopez-Estrano, C., Tschudi, C. and Ullu, E. (1998) Exonic sequences in the 5' untranslated region
of alpha-tubulin mRNA modulate trans-splicing in Trypanosoma brucei. Mol Cell Biol, 18, 46204628.
Lorkovic, Z.J. and Barta, A. (2002) Genome analysis: RNA recognition motif (RRM) and K homology
(KH) domain RNA-binding proteins from the flowering plant Arabidopsis thaliana. Nucleic Acids
Res, 30, 623-635.
Lu, J. and Hall, K.B. (1995) An RBD that does not bind RNA: NMR secondary structure
determination and biochemical properties of the C-terminal RNA binding domain from the human
U1A protein. J Mol Biol, 247, 739-752.
Luger, K., Mader, A.W., Richmond, R.K., Sargent, D.F. and Richmond, T.J. (1997) Crystal structure
of the nucleosome core particle at 2.8 A resolution. Nature, 389, 251-260.
Luo, H., Gilinger, G., Mukherjee, D. and Bellofatto, V. (1999) Transcription initiation at the TATAless spliced leader RNA gene promoter requires at least two DNA-binding proteins and a tripartite
architecture that includes an initiator element. J Biol Chem, 274, 31947-31954.
Lykke-Andersen, J., Shu, M.D. and Steitz, J.A. (2000) Human Upf proteins target an mRNA for
nonsense-mediated decay when bound downstream of a termination codon. Cell, 103, 1121152
Referencias
1131.
Lykke-Andersen, J., Shu, M.D. and Steitz, J.A. (2001) Communication of the position of exonexon junctions to the mRNA surveillance machinery by the protein RNPS1. Science, 293, 18361839.
Macara, I.G. (2001) Transport into and out of the nucleus. Microbiol Mol Biol Rev, 65, 570-594.
Madison-Antenucci, S., Grams, J. and Hajduk, S.L. (2002) Editing machines: the complexities of
trypanosome RNA editing. Cell, 108, 435-438.
Madison-Antenucci, S. and Hajduk, S.L. (2001) RNA editing-associated protein 1 is an RNA binding
protein with specificity for preedited mRNA. Mol Cell, 7, 879-886.
Mair, G., Shi, H., Li, H., Djikeng, A., Aviles, H.O., Bishop, J.R., Falcone, F.H., Gavrilescu, C.,
Montgomery, J.L., Santori, M.I., Stern, L.S., Wang, Z., Ullu, E. and Tschudi, C. (2000) A new twist
in trypanosome RNA metabolism: cis-splicing of pre-mRNA. RNA, 6, 163-169.
Malliavin, T.E., Pons, J.L. and Delsuc, M.A. (1998) An NMR assignment module implemented in
the Gifa NMR processing program. Bioinformatics, 14, 624-631.
Mangus, D.A., Amrani, N. and Jacobson, A. (1998) Pbp1p, a factor interacting with Saccharomyces
cerevisiae poly(A)- binding protein, regulates polyadenylation. Mol Cell Biol, 18, 7383-7396.
Maquat, L.E. and Carmichael, G.G. (2001) Quality control of mRNA function. Cell, 104, 173-176.
Maranon, C., Puerta, C., Alonso, C. and Lopez, M.C. (1998) Control mechanisms of the H2A genes
expression in Trypanosoma cruzi. Mol Biochem Parasitol, 92, 313-324.
Marchetti, M.A., Tschudi, C., Kwon, H., Wolin, S.L. and Ullu, E. (2000) Import of proteins into the
trypanosome nucleus and their distribution at karyokinesis. J Cell Sci, 113, 899-906.
Martinez-Calvillo, S., Lopez, I. and Hernandez, R. (1997) pRIBOTEX expression vector: a pTEX
derivative for a rapid selection of Trypanosoma cruzi transfectants. Gene, 199, 71-76.
Maruyama, K., Sato, N. and Ohta, N. (1999) Conservation of structure and cold-regulation of
RNA-binding proteins in cyanobacteria: probable convergent evolution with eukaryotic glycinerich RNA-binding proteins. Nucleic Acids Res, 27, 2029-2036.
Matkin, A., Das, A. and Bellofatto, V. (2001) The Leptomonas seymouri spliced leader RNA promoter
requires a novel transcription factor. Int J Parasitol, 31, 545-549.
Mattaj, I.W. (1993) RNA recognition: a family matter? Cell, 73, 837-840.
Mattaj, I.W. and Englmeier, L. (1998) Nucleocytoplasmic transport: the soluble phase. Annu Rev
Biochem, 67, 265-306.
Matthews, K.R., Tschudi, C. and Ullu, E. (1994) A common pyrimidine-rich motif governs transsplicing and polyadenylation of tubulin polycistronic pre-mRNA in trypanosomes. Genes Dev, 8,
491-501.
McAndrew, M., Graham, S., Hartmann, C. and Clayton, C. (1998) Testing promoter activity in the
trypanosome genome: isolation of a metacyclic-type VSG promoter, and unexpected insights into
RNA polymerase II transcription. Exp Parasitol, 90, 65-76.
McDonagh, P.D., Myler, P.J. and Stuart, K. (2000) The unusual gene organization of Leishmania
major chromosome 1 may reflect novel transcription processes. Nucleic Acids Res, 28, 28002803.
Mertz, L. and Rashtchian, A. (1994) PCR radioactive labeling system: a rapid method for synthesis
153
Referencias
of high specific activity DNA probe. FOCUS, 16, 45-48.
Micklem, D.R., Adams, J., Grunert, S. and St Johnston, D. (2000) Distinct roles of two conserved
Staufen domains in oskar mRNA localization and translation. EMBO J, 19, 1366-1377.
Mignone, F., Gissi, C., Liuni, S. and Pesole, G. (2002) Untranslated regions of mRNAs. Genome
Biol, 3. Reviews 0004.
Milone, J., Wilusz, J. and Bellofatto, V. (2002) Identification of mRNA decapping activities and an
ARE-regulated 3' to 5' exonuclease activity in trypanosome extracts. Nucleic Acids Res, 30, 40404050.
Missel, A., Lambert, L., Norskau, G. and Goringer, H.U. (1999) DEAD-box protein HEL64 from
Trypanosoma brucei: subcellular localization and gene knockout analysis. Parasitol Res, 85, 324330.
Mitchell, P. and Tollervey, D. (2000) Musing on the structural organization of the exosome complex.
Nat Struct Biol, 7, 843-846.
Moore, M.J. (2002) Nuclear RNA turnover. Cell, 108, 431-434.
Musco, G., Kharrat, A., Stier, G., Fraternali, F., Gibson, T.J., Nilges, M. and Pastore, A. (1997) The
solution structure of the first KH domain of FMR1, the protein responsible for the fragile X
syndrome. Nat Struct Biol, 4, 712-716.
Musco, G., Stier, G., Joseph, C., Castiglione Morelli, M.A., Nilges, M., Gibson, T.J. and Pastore, A.
(1996) Three-dimensional structure and stability of the KH domain: molecular insights into the
fragile X syndrome. Cell, 85, 237-245.
Myer, V.E. and Steitz, J.A. (1995) Isolation and characterization of a novel, low abundance hnRNP
protein: A0. RNA, 1, 171-182.
Myler, P.J., Audleman, L., deVos, T., Hixson, G., Kiser, P., Lemley, C., Magness, C., Rickel, E.,
Sisk, E., Sunkin, S., Swartzell, S., Westlake, T., Bastien, P., Fu, G., Ivens, A. and Stuart, K. (1999)
Leishmania major Friedlin chromosome 1 has an unusual distribution of protein-coding genes.
Proc Natl Acad Sci U S A, 96, 2902-2906.
Nagai, K., Oubridge, C., Jessen, T.H., Li, J. and Evans, P.R. (1990) Crystal structure of the RNAbinding domain of the U1 small nuclear ribonucleoprotein A. Nature, 348, 515-520.
Nagy, E. and Rigby, W.F. (1995) Glyceraldehyde-3-phosphate dehydrogenase selectively binds
AU-rich RNA in the NAD(+)-binding region (Rossmann fold). J Biol Chem, 270, 2755-2763.
Nakaar, V., Gunzl, A., Ullu, E. and Tschudi, C. (1997) Structure of the Trypanosoma brucei U6
snRNA gene promoter. Mol Biochem Parasitol, 88, 13-23.
Nakayashiki, T., Ebihara, K., Bannai, H. and Nakamura, Y. (2001) Yeast [PSI+] “prions” that are
crosstransmissible and susceptible beyond a species barrier through a quasi-prion state. Mol
Cell, 7, 1121-1130.
Nakielny, S. and Dreyfuss, G. (1999) Transport of proteins and RNAs in and out of the nucleus.
Cell, 99, 677-690.
Narlikar, G.J., Fan, H.Y. and Kingston, R.E. (2002) Cooperation between complexes that regulate
chromatin structure and transcription. Cell, 108, 475-487.
Navarro, M. and Gull, K. (2001) A pol I transcriptional body associated with VSG mono-allelic
expression in Trypanosoma brucei. Nature, 414, 759-763.
Ngo, H., Tschudi, C., Gull, K. and Ullu, E. (1998) Double-stranded RNA induces mRNA degradation
154
Referencias
in Trypanosoma brucei. Proc Natl Acad Sci U S A, 95, 14687-14692.
Ohno, M., Segref, A., Bachi, A., Wilm, M. and Mattaj, I.W. (2000) PHAX, a mediator of U snRNA
nuclear export whose activity is regulated by phosphorylation. Cell, 101, 187-198.
Orphanides, G. and Reinberg, D. (2002) A unified theory of gene expression. Cell, 108, 439-451.
Ostareck-Lederer, A., Ostareck, D.H., Cans, C., Neubauer, G., Bomsztyk, K., Superti-Furga, G.
and Hentze, M.W. (2002) c-Src-mediated phosphorylation of hnRNP K drives translational activation
of specifically silenced mRNAs. Mol Cell Biol, 22, 4535-4543.
Ostrowski, J., Schullery, D.S., Denisenko, O.N., Higaki, Y., Watts, J., Aebersold, R., Stempka, L.,
Gschwendt, M. and Bomsztyk, K. (2000) Role of tyrosine phosphorylation in the regulation of the
interaction of the heterogenous nuclear ribonucleoprotein K protein with its protein and RNA
partners. J Biol Chem, 275, 3619-3628.
Park, S., Myszka, D.G., Yu, M., Littler, S.J. and Laird-Offringa, I.A. (2000) HuD RNA recognition
motifs play distinct roles in the formation of a stable complex with AU-rich RNA. Mol Cell Biol, 20,
4765-4772.
Peng, J.W. and Wagner, G. (1994) Investigation of protein motions via relaxation measurements.
Methods Enzymol, 239, 563-596.
Peppel, K., Vinci, J.M. and Baglioni, C. (1991) The AU-rich sequences in the 3' untranslated
region mediate the increased turnover of interferon mRNA induced by glucocorticoids. J Exp Med,
173, 349-355.
Perez, I., McAfee, J.G. and Patton, J.G. (1997) Multiple RRMs contribute to RNA binding specificity and affinity for polypyrimidine tract binding protein. Biochemistry, 36, 11881-11890.
Perez-Canadillas, J.M. and Varani, G. (2001) Recent advances in RNA-protein recognition. Curr
Opin Struct Biol, 11, 53-58.
Phillips, T.A., VanBogelen, R.A. and Neidhardt, F.C. (1984) lon gene product of Escherichia coli is
a heat-shock protein. J Bacteriol, 159, 283-287.
Pitula, J.S., Park, J., Parsons, M., Ruyechan, W.T. and Williams, N. (2002) Two families of RNA
binding proteins from Trypanosoma brucei associate in a direct protein-protein interaction. Mol
Biochem Parasitol, 122, 81-89.
Priest, J.W. and Hajduk, S.L. (1994) Developmental regulation of Trypanosoma brucei cytochrome
c reductase during bloodstream to procyclic differentiation. Mol Biochem Parasitol, 65, 291-304.
Proudfoot, N.J., Furger, A. and Dye, M.J. (2002) Integrating mRNA processing with transcription.
Cell, 108, 501-512.
Pype, S., Slegers, H., Moens, L., Merlevede, W. and Goris, J. (1994) Tyrosine phosphorylation of a
M(r) 38,000 A/B-type hnRNP protein selectively modulates its RNA binding. J Biol Chem, 269,
31457-31465.
Quijada, L., Soto, M., Alonso, C. and Requena, J.M. (1997) Analysis of post-transcriptional
regulation operating on transcription products of the tandemly linked Leishmania infantum hsp70
genes. J Biol Chem, 272, 4493-4499.
Ramakrishnan, V. (2002) Ribosome structure and the mechanism of translation. Cell, 108, 557572.
Ramos, A., Grunert, S., Adams, J., Micklem, D.R., Proctor, M.R., Freund, S., Bycroft, M., St
Johnston, D. and Varani, G. (2000) RNA recognition by a Staufen double-stranded RNA-binding
domain. EMBO J, 19, 997-1009.
155
Referencias
Reed, R. and Hurt, E. (2002) A conserved mRNA export machinery coupled to pre-mRNA splicing.
Cell, 108, 523-531.
Reid, D.G. (1997) In: Protein NMR Spectroscopy. Humana Press, Totowa, New Jersey, USA.
Revollo, S., Oury, B., Laurent, J.P., Barnabe, C., Quesney, V., Carriere, V., Noel, S. and Tibayrenc,
M. (1998) Trypanosoma cruzi: impact of clonal evolution of the parasite on its biological and
medical properties. Exp Parasitol, 89, 30-39.
Reyes, M.B., Pollevick, G.D. and Frasch, A.C. (1994) An unusually small gene encoding a putative
mucin-like glycoprotein in Trypanosoma cruzi. Gene, 140, 139-140.
Richards, E.J. and Elgin, S.C. (2002) Epigenetic codes for heterochromatin formation and silencing:
rounding up the usual suspects. Cell, 108, 489-500.
Ross, J. (1997) A hypothesis to explain why translation inhibitors stabilize mRNAs in mammalian
cells: mRNA stability and mitosis. Bioessays, 19, 527-529.
Rout, M.P. and Field, M.C. (2001) Isolation and characterization of subnuclear compartments
from Trypanosoma brucei. Identification of a major repetitive nuclear lamina component. J Biol
Chem, 276, 38261-38271.
Ryter, J.M. and Schultz, S.C. (1998) Molecular basis of double-stranded RNA-protein interactions:
structure of a dsRNA-binding domain complexed with dsRNA. EMBO J, 17, 7505-7513.
Sachs, A.B., Sarnow, P. and Hentze, M.W. (1997) Starting at the beginning, middle, and end:
translation initiation in eukaryotes. Cell, 89, 831-838.
Sacks, D. and Sher, A. (2002) Evasion of innate immunity by parasitic protozoa. Nat Immunol, 3,
1041-1047.
Salmon, D., Montero-Lomeli, M. and Goldenberg, S. (2001) A DnaJ-like protein homologous to
the yeast co-chaperone Sis1 (TcJ6p) is involved in initiation of translation in Trypanosoma cruzi.
J Biol Chem, 276, 43970-43979.
Sambrook, J., Fritsch, E.F. and Maniatis, T. (1989) In Molecular cloning: A laboratory manual.
Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y.
Sato, N. (1994) A cold-regulated cyanobacterial gene cluster encodes RNA-binding protein and
ribosomal protein S21. Plant Mol Biol, 24, 819-823.
Schauer, R., Reuter, G., Muhlpfordt, H., Andrade, A.F. and Pereira, M.E. (1983) The occurrence of
N-acetyl- and N-glycoloylneuraminic acid in Trypanosoma cruzi. Hoppe Seylers Z Physiol Chem,
364, 1053-1057.
Schenkman, S., Eichinger, D., Pereira, M.E. and Nussenzweig, V. (1994) Structural and functional
properties of trypanosome trans-sialidase. Annu Rev Microbiol, 48, 499-523.
Schenkman, S., Ferguson, M.A., Heise, N., de Almeida, M.L., Mortara, R.A. and Yoshida, N. (1993)
Mucin-like glycoproteins linked to the membrane by glycosylphosphatidylinositol anchor are the
major acceptors of sialic acid in a reaction catalyzed by trans-sialidase in metacyclic forms of
Trypanosoma cruzi. Mol Biochem Parasitol, 59, 293-303.
Schmid, S.R. and Linder, P. (1992) D-E-A-D protein family of putative RNA helicases. Mol Microbiol,
6, 283-291.
Schurch, N., Furger, A., Kurath, U. and Roditi, I. (1997) Contributions of the procyclin 3'
untranslated region and coding region to the regulation of expression in bloodstream forms of
Trypanosoma brucei. Mol Biochem Parasitol, 89, 109-121.
156
Referencias
Shen, E.C., Henry, M.F., Weiss, V.H., Valentini, S.R., Silver, P.A. and Lee, M.S. (1998) Arginine
methylation facilitates the nuclear export of hnRNP proteins. Genes Dev, 12, 679-691.
Shi, H., Djikeng, A., Mark, T., Wirtz, E., Tschudi, C. and Ullu, E. (2000) Genetic interference in
Trypanosoma brucei by heritable and inducible double-stranded RNA. RNA, 6, 1069-1076.
Shih, H.M., Goldman, P.S., DeMaggio, A.J., Hollenberg, S.M., Goodman, R.H. and Hoekstra, M.F.
(1996) A positive genetic selection for disrupting protein-protein interactions: identification of
CREB mutations that prevent association with the coactivator CBP. Proc Natl Acad Sci U S A, 93,
13896-13901.
Shyu, A.B. and Wilkinson, M.F. (2000) The double lives of shuttling mRNA binding proteins. Cell,
102, 135-138.
Siddiqui, N., Kozlov, G., D’Orso, I., Trempe J.F. and Gehring, K. (2003) Solution Structure of the
C-terminal domain from PABP in Trypanosoma cruzi: A vegetal class PABC domain. Enviado a
publicar.
Silva, E., Ullu, E., Kobayashi, R. and Tschudi, C. (1998) Trypanosome capping enzymes display a
novel two-domain structure. Mol Cell Biol, 18, 4612-4619.
Simms, D., Cizdziel, P.E. and Chomczynski, P. (1993) TRIZOL™ : A New Reagent for optimal
single-step isolation of rna. FOCUS, 15, 99-102.
Siomi, H., Siomi, M.C., Nussbaum, R.L. and Dreyfuss, G. (1993) The protein product of the fragile
X gene, FMR1, has characteristics of an RNA-binding protein. Cell, 74, 291-298.
Smith, C. (1998) In RNA:Protein Interactions, A Practical Approach. Oxford University Press, Inc.,
New York.
Smith, J.L., Levin, J.R., Ingles, C.J. and Agabian, N. (1989) In trypanosomes the homolog of the
largest subunit of RNA polymerase II is encoded by two genes and has a highly unusual Cterminal domain structure. Cell, 56, 815-827.
Spadiliero, B., Nicolini, C., Mascetti, G., Henriquez, D. and Vergani, L. (2002a) Chromatin of
Trypanosoma cruzi: In situ analysis revealed its unusual structure and nuclear organization. J
Cell Biochem, 85, 798-808.
Spadiliero, B., Sanchez, F., Slezynger, T.C. and Henriquez, D.A. (2002b) Differences in the nuclear
chromatin among various stages of the life cycle of Trypanosoma cruzi. J Cell Biochem, 84, 832839.
Stoecklin, G., Hahn, S. and Moroni, C. (1994) Functional hierarchy of AUUUA motifs in mediating
rapid interleukin-3 mRNA decay. J Biol Chem, 269, 28591-28597.
Tacke, R. and Manley, J.L. (1995) The human splicing factors ASF/SF2 and SC35 possess distinct,
functionally significant RNA binding specificities. EMBO J, 14, 3540-3551.
Tarun, S.Z., Jr. and Sachs, A.B. (1995) A common function for mRNA 5' and 3' ends in translation
initiation in yeast. Genes Dev, 9, 2997-3007.
Tarun, S.Z., Jr. and Sachs, A.B. (1996) Association of the yeast poly(A) tail binding protein with
translation initiation factor eIF-4G. EMBO J, 15, 7168-7177.
Tarun, S.Z., Jr., Wells, S.E., Deardorff, J.A. and Sachs, A.B. (1997) Translation initiation factor
eIF4G mediates in vitro poly(A) tail- dependent translation. Proc Natl Acad Sci U S A, 94, 90469051.
Teixeira, S.M., Kirchhoff, L.V. and Donelson, J.E. (1995) Post-transcriptional elements regulating
expression of mRNAs from the amastin/tuzin gene cluster of Trypanosoma cruzi. J Biol Chem,
157
Referencias
270, 22586-22594.
Teixeira, S.M., Kirchhoff, L.V. and Donelson, J.E. (1999) Trypanosoma cruzi: suppression of tuzin
gene expression by its 5'-UTR and spliced leader addition site. Exp Parasitol, 93, 143-151.
Teixeira, S.M., Russell, D.G., Kirchhoff, L.V. and Donelson, J.E. (1994) A differentially expressed
gene family encoding “amastin,” a surface protein of Trypanosoma cruzi amastigotes. J Biol Chem,
269, 20509-20516.
ter Kuile, B.H. and Salles, F.J. (2000) The length of the combined 3' untranslated region and
poly(A) tail does not control rates of glyceraldehyde-3-phosphate dehydrogenase mRNA translation
in three species of parasitic protists. J Bacteriol, 182, 3587-3589.
Tetaud, E., Giroud, C., Prescott, A.R., Parkin, D.W., Baltz, D., Biteau, N., Baltz, T. and Fairlamb,
A.H. (2001) Molecular characterisation of mitochondrial and cytosolic trypanothione- dependent
tryparedoxin peroxidases in Trypanosoma brucei. Mol Biochem Parasitol, 116, 171-183.
Thompson, J.D., Higgins, D.G. and Gibson, T.J. (1994) CLUSTAL W: improving the sensitivity of
progressive multiple sequence alignment through sequence weighting, position-specific gap
penalties and weight matrix choice. Nucleic Acids Res, 22, 4673-4680.
Tibayrenc, M., Ward, P., Moya, A. and Ayala, F.J. (1986) Natural populations of Trypanosoma
cruzi, the agent of Chagas disease, have a complex multiclonal structure. Proc Natl Acad Sci U S A,
83, 115-119.
Tomlinson, S., Vandekerckhove, F., Frevert, U. and Nussenzweig, V. (1995) The induction of
Trypanosoma cruzi trypomastigote to amastigote transformation by low pH. Parasitology, 110,
547-554.
Torri, A.F. and Hajduk, S.L. (1988) Posttranscriptional regulation of cytochrome c expression
during the developmental cycle of Trypanosoma brucei. Mol Cell Biol, 8, 4625-4633.
Tupler, R., Perini, G. and Green, M.R. (2001) Expressing the human genome. Nature, 409, 832833.
Ullu, E., Matthews, K.R. and Tschudi, C. (1993) Temporal order of RNA-processing reactions in
trypanosomes: rapid trans-splicing precedes polyadenylation of newly synthesized tubulin
transcripts. Mol Cell Biol, 13, 720-725.
Vagner, S., Galy, B. and Pyronnet, S. (2001) Irresistible IRES. Attracting the translation machinery
to internal ribosome entry sites. EMBO Reports, 2, 893-898.
van Hoof, A. and Parker, R. (1999) The exosome: a proteasome for RNA? Cell, 99, 347-350.
Vanhamme, L. and Pays, E. (1995) Control of gene expression in trypanosomes. Microbiol Rev, 59,
223-240.
Vanhamme, L., Pays, E., McCulloch, R. and Barry, J.D. (2001) An update on antigenic variation
in African trypanosomes. Trends Parasitol, 17, 338-343.
Vanhamme, L., Postiaux, S., Poelvoorde, P. and Pays, E. (1999) Differential regulation of ESAG
transcripts in Trypanosoma brucei. Mol Biochem Parasitol, 102, 35-42.
Varani, G. and Nagai, K. (1998) RNA recognition by RNP proteins during RNA processing. Annu
Rev Biophys Biomol Struct, 27, 407-445.
Vasu, S.K. and Forbes, D.J. (2001) Nuclear pores and nuclear assembly. Curr Opin Cell Biol, 13,
363-375.
Vázquez, M., Ben-Dov, C., Lorenzi, H., Moore, T., Schijman, A. and Levin, M.J. (2000) The short
158
Referencias
interspersed repetitive element of Trypanosoma cruzi, SIRE, is part of VIPER, an unusual
retroelement related to long terminal repeat retrotransposons. Proc Natl Acad Sci U S A, 97, 21282133.
Vázquez, M., Lorenzi, H., Schijman, A.G., Ben-Dov, C. and Levin, M.J. (1999) Analysis of the
distribution of SIRE in the nuclear genome of Trypanosoma cruzi. Gene, 239, 207-216.
Vázquez, M.P., Schijman, A.G. and Levin, M.J. (1994) A short interspersed repetitive element
provides a new 3' acceptor site for trans-splicing in certain ribosomal P2 beta protein genes of
Trypanosoma cruzi. Mol Biochem Parasitol, 64, 327-336.
Vermel, M., Guermann, B., Delage, L., Grienenberger, J.M., Marechal-Drouard, L. and Gualberto,
J.M. (2002) A family of RRM-type RNA-binding proteins specific to plant mitochondria. Proc Natl
Acad Sci U S A, 99, 5866-5871.
Wahle, E. and Ruegsegger, U. (1999) 3'-End processing of pre-mRNA in eukaryotes. FEMS Microbiol
Rev, 23, 277-295.
Wan, L., Kim, J.K., Pollard, V.W. and Dreyfuss, G. (2001) Mutational definition of RNA-binding
and protein-protein interaction domains of heterogeneous nuclear RNP C1. J Biol Chem, 276,
7681-7688.
Wand, A.J. (2001) Dynamic activation of protein function: a view emerging from NMR spectroscopy.
Nat Struct Biol, 8, 926-931.
Wang, L., Eckmann, C.R., Kadyk, L.C., Wickens, M. and Kimble, J. (2002) A regulatory cytoplasmic
poly(A) polymerase in Caenorhabditis elegans. Nature, 419, 312-316.
Wang, X. and Tanaka Hall, T.M. (2001) Structural basis for recognition of AU-rich element RNA
by the HuD protein. Nat Struct Biol, 8, 141-145.
Wang, Z. and Kiledjian, M. (2001) Functional link between the mammalian exosome and mRNA
decapping. Cell, 107, 751-762.
Westermann, S. and Weber, K. (2000) Cloning and recombinant expression of the La RNA-binding
protein from Trypanosoma brucei. Biochim Biophys Acta, 1492, 483-487.
Wickens, M., Bernstein, D.S., Kimble, J. and Parker, R. (2002) A PUF family portrait: 3’UTR
regulation as a way of life. Trends Genet, 18, 150-157.
Williamson, J.R. (2000) Induced fit in RNA-protein recognition. Nat Struct Biol, 7, 834-837.
Wilusz, C.J., Wormington, M. and Peltz, S.W. (2001) The cap-to-tail guide to mRNA turnover. Nat
Rev Mol Cell Biol, 2, 237-246.
Winstall, E., Gamache, M. and Raymond, V. (1995) Rapid mRNA degradation mediated by the cfos 3' AU-rich element and that mediated by the granulocyte-macrophage colony-stimulating
factor 3' AU-rich element occur through similar polysome-associated mechanisms. Mol Cell Biol,
15, 3796-3804.
Wishart, D.S., Bigam, C.G., Holm, A., Hodges, R.S. and Sykes, B.D. (1995) 1H, 13C and 15N
random coil NMR chemical shifts of the common amino acids. Investigations of nearest-neighbor
effects. J Biomol NMR, 5, 67-81.
Wishart, D.S., Bigam, C.G., Yao, J., Abildgaard, F., Dyson, H.J., Oldfield, E., Markley, J.L. and
Sykes, B.D. (1995b) 1H, 13C and 15N chemical shift referencing in biomolecular NMR. J Biomol
NMR, 6, 135-140.
Wishart, D.S. and Sykes, B.D. (1994) The 13C chemical-shift index: a simple method for the
identification of protein secondary structure using 13C chemical-shift data. J Biomol NMR, 4,
159
Referencias
171-180.
Wishart, D.S., Sykes, B.D. and Richards, F.M. (1991) Relationship between nuclear magnetic
resonance chemical shift and protein secondary structure. J Mol Biol, 222, 311-333.
Xu, N., Chen, C.Y. and Shyu, A.B. (1997) Modulation of the fate of cytoplasmic mRNA by AU-rich
elements: key sequence features controlling mRNA deadenylation and decay. Mol Cell Biol, 17,
4611-4621.
Xu, P., Wen, L., Benegal, G., Wang, X. and Buck, G.A. (2001a) Identification of a spliced leader
RNA binding protein from Trypanosoma cruzi. Mol Biochem Parasitol, 112, 39-49.
Xu, Y., Liu, L., Lopez-Estrano, C. and Michaeli, S. (2001b) Expression studies on clustered
trypanosomatid box C/D small nucleolar RNAs. J Biol Chem, 276, 14289-14298.
Yuan, C., Yongkiettrakul, S., Byeon, I.J., Zhou, S. and Tsai, M.D. (2001) Solution structure of two
FHA-1phosphothreonine peptide complexes provide insight into the structural basis of the ligand
specificity of FHA1 from yeast. J Mol Biol, 314, 563-575.
Zamore, P.D., Tuschl, T., Sharp, P.A. and Bartel, D.P. (2000) RNAi: double-stranded RNA directs
the ATP-dependent cleavage of mRNA at 21 to 23 nucleotide intervals. Cell, 101, 25-33.
Zamore, P.D., Williamson, J.R. and Lehmann, R. (1997) The Pumilio protein binds RNA through
a conserved domain that defines a new class of RNA-binding proteins. RNA, 3, 1421-1433.
Zhang, J., Ruyechan, W. and Williams, N. (1998) Developmental regulation of two nuclear RNA
binding proteins, p34 and p37, from Trypanosoma brucei. Mol Biochem Parasitol, 92, 79-88.
Zhang, W., Wagner, B.J., Ehrenman, K., Schaefer, A.W., DeMaria, C.T., Crater, D., DeHaven, K.,
Long, L. and Brewer, G. (1993) Purification, characterization, and cDNA cloning of an AU-rich
element RNA-binding protein, AUF1. Mol Cell Biol, 13, 7652-7665.
Zingales, B., Pereira, M.E., Almeida, K.A., Umezawa, E.S., Nehme, N.S., Oliveira, R.P., Macedo, A.
and Souto, R.P. (1997) Biological parameters and molecular markers of clone CL Brener-the
reference organism of the Trypanosoma cruzi genome project. Mem Inst Oswaldo Cruz, 92, 811814.
Zubiaga, A.M., Belasco, J.G. and Greenberg, M.E. (1995) The nonamer UUAUUUAUU is the key
AU-rich sequence motif that mediates mRNA degradation. Mol Cell Biol, 15, 2219-2230.
160
Notas
161
Notas
162

Documentos relacionados