Installation Instructions - Sell Buy Invest or Search Oahu Honolulu

Comentarios

Transcripción

Installation Instructions - Sell Buy Invest or Search Oahu Honolulu
GE Profile™ Series 1.7 Cu. Ft. Convection Over-the-Range
Microwave Oven
Model# PVM1790SRSS
FEATURES
Control Type
Display On/Off
Electronic Digital Display with Clock
Variable Scroll Speed
Cooking Modes
Cooking Technology
Cooktop Lighting
Demo Mode
Exhaust Fan
Interior Oven Light
Multi-Language Capability
Power Levels
Time Preference
Rack Type
• 1.7 cu. ft. capacity - 1000 microwave watts (IEC test
procedure) and 1550 convection watts
• Convection cooking - Breads bake to a golden brown
• Sensor cooking controls - Automatically adjusts time
and power
• Fast Bake - Convection and microwave cooking combine
to deliver fast oven-quality results
Yes
Scrolling
5 speeds (sub-pad w/ AM/PM)
Microwave
Convection Bake
Warm
FastBake
Convection
Halogen
Bright/Night/Off
Turntable
Turntable On / Off
Turntable Size
Convection Cooking Controls
Microwave Sensor Cooking Controls
Chicken
• Warming oven - Keeps foods hot and ready to serve
• Removable oven rack - Allows you to cook large
quantities of your family’s favorites
Dial
Yes
3-Speed
Halogen
English/Spanish
10
Yes
2 Wire Oven Racks; 2 Fixed
Positions
Glass
Yes
13.6
Bake
• Auto Recipe conversion - Converts standard recipes to
convection settings
• Full-width hidden vent - Integrated design blends in and
is easy to clean
Touchpads
Microwave Convenience Cooking
Controls
Control Features
Roast
FastBake
Meats
Popcorn
Potatoes
Reheat
Vegetable
Fish
Beverage
Add 30 Seconds (Instant-On)
Cooking Complete Reminder
Auto, Time & Fast Defrost
Clock
Help
Time Cook I & II
Sound Volume Control - 4 Levels
Timer On/Off
Control Lock
Start/Pause
Clear/Off
Auto Night Light
Oven Temperature Calibration
Add Time - Dial
Time Preference
Clock Saver
Resume
Have more questions? Please contact 1-800-626-2005
Microwave Oven Interior
Microwave Watts (IEC-705)
Stainless Steel
1000.0
GE Profile™ Series 1.7 Cu. Ft. Convection Over-the-Range
Microwave Oven
Model# PVM1790SRSS
APPROXIMATE DIMENSIONS (HxDxW)
• 16 7/16 in x 15 3/8 in x 29 15/16 in
CAPACITY
• Total Capacity (cubic feet) 1.7 cu ft
WARRANTY
• Parts Warranty - Limited 1-year entire appliance
Limited 5-year magnetron tube
• Labor Warranty - Limited 1-year entire appliance
• Warranty Notes - See written warranty for full
details
Have more questions? Please contact 1-800-626-2005
PVM1790DR/SR
Over-the-Range Microwave Oven
GE Profile™ 1.7 Cu. Ft. Capacity Over-the-Range
Microwave
Dimensions
(in inches)Oven
Dimensions and Installation Information (in inches)
Note: Requires 120V grounded outlet. Electrical receptacle must be
located in cabinet above Spacemaker microwave oven. No additional
wiring, venting or cabinet rebuilding necessary in many cases. Complete
detailed, easy-to-follow installation instructions and convenient full-size
templates are packed with the Spacemaker microwave oven.
66" MIN.
Mounting
height
from floor
Important Information: When installing the Spacemaker microwave
oven over a range, allow minimum of 2” from bottom of Spacemaker
microwave oven to top of range backguard to allow for removal
of light covers.
Ventilation Options: The Spacemaker microwave ovens and
Spacemaker convection/microwave ovens are designed for
adaptation to the following three types of ventilation:
•Outside exhaust (Vertical – as shown)
•Outside exhaust (horizontal)
•Recirculating (non-vented ductless – see Filter Kit drawing,
order JX81D
Installation Information: This information is not intended to be used for
installing unit described. Before installing, consult installation instructions
packed with product/kit for current dimensional data.
30" MIN.
width required
Exhaust outlet
connects to
3-1/4" X 10" duct
13"
MAX.
12"
MIN.
15-3/8
24-1/2
16-7/16
16-7/16
(Rear)
(without
obstruction)
29-15/16
Minimum distance from
door hinge side to adjacent
wall should equal 1/2-inch.
For answers to your Monogram,® GE Profile™ or
GE® appliance questions, visit our website at
ge.com or call GE Answer Center® service,
800.626.2000.
Listed by
Underwriters
Laboratories
Specification Revised 12/11
240273
PVM1790DR/SR
GE Profile™ 1.7 Cu. Ft. Capacity Over-the-Range Microwave Oven
Optional Accessories (Available at additional cost)
Hood Exhaust Duct: Outside ventilation requires a HOOD EXHAUST DUCT. Read the
following carefully.
Exhaust Connection: The hood exhaust has been designed to mate with a standard
3-1/4" x 10" rectangular duct. If a round duct is required, a rectangular-to-round
transition adaptor must be used. Do not use less than a 6" diameter duct.
Rear Exhaust: If a rear or horizontal exhaust is to be used, care should be taken to
align exhaust with space between studs, or wall should be prepared at the time it
is constructed by leaving enough space between the wall studs to accommodate
exhaust.
Maximum Duct Length: For satisfactory air movement, the total duct length of 3-1/4"
x 10" rectangular or 6" diameter round duct should not exceed 140 equivalent feet.
Filler Panel Kits
JX40/41
When replacing a 36" or
42" range hood, this kit fills
in the additional width to
provide a custom built-in
appearance.
For installation between ­
cabinets only; not for
end-of-cabinet installation.
Each kit ­contains two
3"-wide filler panels.
Filter Kits
JX81D–Recirculating
Charcoal Filter Kit
To be used when
the Spacemaker
microwave oven
cannot be vented
to the outside.
ELBOWS, TRANSITIONS, WALL AND ROOF CAPS: etc., present additional resistance to
airflow and are equivalent to a section of straight duct which is longer than their
actual physical size. When calculating the total duct length, add the equivalent length
of all transitions and adaptors plus the lengths of all straight duct sections. The chart
below shows the approximate feet of equivalent length of some typical ducts.
Duct
Equivalent Feet
A.Rectangular-To-round
Transition Adaptor
5 ft.
B. Wall Cap
40 ft.
C. 90° Elbow
10 ft.
D.45° Elbow
5 ft.
E. 90° Elbow
25 ft.
F. 45° Elbow
5 ft.
G.Roof Cap
24 ft.
Listed by
Underwriters
Laboratories
Specification Revised 12/11
240273
PVM1790DR/SR
GE Profile™ 1.7 Cu. Ft. Capacity Over-the-Range Microwave Oven
Features and Benefits
• 1.7 cu. ft. capacity, 1000 microwave watts (IEC test procedure) and
1550 convection watts
• Convection cooking - Choose this setting when baking or browning
is desired
• Fast Bake - Enjoy oven-quality results up to 25% faster than
conventional cooking
MICROWAVE
POPCORN
CONVECTION
BEVERAGE
ADD 30
START
PAUSE
• Sensor cooking controls - Automatically adjusts time and power for
delicious cooking results
REHEAT
WARM
SEC
CLEAR
OFF
POWER
LEVEL
CLOCK
AM/PM
SETTINGS
VENT FAN
TIMER
ON/OFF
SURFACE
LIGHT
• Warming oven - Warming oven mode keeps foods warm until served
• Auto Recipe™ Conversion - Just set the controls according to the recipe
and the oven automatically converts standard recipe temperatures to
proper convection settings
PVM1790SR
• Stainless steel interior - Stainless steel interior is both stylish and easy
to clean
• Model PVM1790DRWW – White • Model PVM1790DRCC – Bisque
•Model PVM1790DRBB – Black
• Model PVM1790SRSS – Stainless steel
Specification Revised 12/11
240273
,QVWDOODWLRQ
,QVWUXFWLRQV
$ERYHWKH
&RRNWRS2YHQ
390
&90
4XHVWLRQV"&DOO*(&$5(6RU9LVLWRXU:HEVLWHDW*($SSOLDQFHVFRP
%()25(<28%(*,1
5HDGWKHVHLQVWUXFWLRQVFRPSOHWHO\DQGFDUHIXOO\
‡
,03257$17²6DYHWKHVH
‡
,03257$17²2EVHUYHDOO
LQVWUXFWLRQVIRUORFDOLQVSHFWRU·VXVH
JRYHUQLQJFRGHVDQGRUGLQDQFHV
‡ 1RWHWR,QVWDOOHU²%HVXUHWROHDYHWKHVH
LQVWUXFWLRQVZLWKWKH&RQVXPHU
/$6(&&,Ï1(1(63$f2/
(03,(=$(1/$3È*,1$
0)/
1RWHWR&RQVXPHU².HHSWKHVHLQVWUXFWLRQV
IRUIXWXUHUHIHUHQFH
‡ 6NLOOOHYHO²,QVWDOODWLRQRIWKLVDSSOLDQFHUHTXLUHVEDVLF
PHFKDQLFDODQGHOHFWULFDOVNLOOV
‡ 3URSHULQVWDOODWLRQLVWKHUHVSRQVLELOLW\RIWKHLQVWDOOHU
‡ 3URGXFWIDLOXUHGXHWRLPSURSHULQVWDOODWLRQLVQRW
FRYHUHGXQGHUWKH:DUUDQW\
‡
5($'&$5()8//<
.((37+(6(,16758&7,216
,QVWDOODWLRQ,QVWUXFWLRQV
&217(176
*HQHUDOLQIRUPDWLRQ
,PSRUWDQW6DIHW\,QVWUXFWLRQV
& 5HFLUFXODWLQJ²
$WWDFK0RXQWLQJ3ODWHWR:DOO 3UHSDUDWLRQRI7RS&DELQHW $GDSWLQJ%ORZHU
IRU5HFLUFXODWLRQ
+RRG([KDXVW
0RXQWWKH2YHQ
'DPDJH²6KLSPHQW,QVWDOODWLRQ
,QVWDOOLQJWKH&KDUFRDO)LOWHU 3DUWV,QFOXGHG
%HIRUH<RX8VH<RXU2YHQ 7RROV<RX:LOO1HHG
6HFFLyQHQ(VSDxRO²
(OHFWULFDO5HTXLUHPHQWV
0RXQWLQJ6SDFH
6WHSE\VWHSLQVWDOODWLRQJXLGH
3ODFHPHQWRI0RXQWLQJ3ODWH ²
5HPRYLQJWKH0RXQWLQJ3ODWH
)LQGLQJWKH:DOO6WXGV
'HWHUPLQLQJ:DOO3ODWH/RFDWLRQ
$OLJQLQJWKH:DOO3ODWH
,QVWDOODWLRQ7\SHV ²
$ 2XWVLGH7RS([KDXVW ²
$WWDFK0RXQWLQJ3ODWHWR:DOO
3UHSDUDWLRQRI7RS&DELQHW
$VVHPEOHDQG,QVWDOO$GDSWRU
0RXQWWKH2YHQ $GMXVWWKH([KDXVW$GDSWRU
&RQQHFWLQJ'XFWZRUN
% 2XWVLGH%DFN([KDXVW ²
3UHSDULQJ5HDU:DOOIRU
2XWVLGH%DFN([KDXVW
$WWDFK0RXQWLQJ3ODWHWR:DOO 3UHSDUDWLRQRI7RS&DELQHW
$GDSWLQJ%ORZHUIRU2XWVLGH
%DFN([KDXVW 0RXQWWKH2YHQ
,QVWDOODWLRQ,QVWUXFWLRQV
,03257$176$)(7<,16758&7,216
$TXDOLILHGHOHFWULFLDQPXVWSHUIRUPDJURXQGFRQWLQXLW\
FKHFNRQWKHZDOOUHFHSWDFOHEHIRUHEHJLQQLQJWKH
LQVWDOODWLRQWRHQVXUHWKDWWKHRXWOHWER[LVSURSHUO\
JURXQGHG,IQRWSURSHUO\JURXQGHGRULIWKHZDOO
UHFHSWDFOHGRHVQRWPHHWHOHFWULFDOUHTXLUHPHQWVQRWHG
XQGHU(/(&75,&$/5(48,5(0(176DTXDOLILHGHOHFWULFLDQ
VKRXOGEHHPSOR\HGWRFRUUHFWDQ\GHILFLHQFLHV
:KHUHDVWDQGDUGWZRSURQJZDOOUHFHSWDFOHLV
HQFRXQWHUHGLWPXVWEHUHSODFHGZLWKDSURSHUO\
JURXQGHGWKUHHSURQJZDOOUHFHSWDFOHLQVWDOOHGE\D
TXDOLILHGHOHFWULFLDQ
:$51,1*
:$51,1*
5LVNRI(OHFWULF6KRFN
&DQFDXVHLQMXU\RUGHDWK
5HPRYHKRXVHIXVHRU
RSHQFLUFXLWEUHDNHUEHIRUH
EHJLQQLQJLQVWDOODWLRQWRDYRLG
VHYHUHRUIDWDOVKRFNLQMXU\
&$87,21
)RUSHUVRQDOVDIHW\WKH
PRXQWLQJVXUIDFHPXVWEHFDSDEOHRIVXSSRUWLQJWKH
FDELQHWORDGLQDGGLWLRQWRWKHDGGHGZHLJKWRIWKLV
²SRXQGSURGXFWSOXVDGGLWLRQDORYHQORDGVRIXS
WRSRXQGVRUDWRWDOZHLJKWRI²SRXQGV
&$87,21
)RUSHUVRQDOVDIHW\WKLVSURGXFW
FDQQRWEHLQVWDOOHGLQFDELQHWDUUDQJHPHQWVVXFKDVDQ
LVODQGRUDSHQLQVXOD,WPXVWEHPRXQWHGWR%27+DWRS
FDELQHW$1'DZDOO
:$51,1*
5LVNRI(OHFWULF6KRFN
&DQFDXVHLQMXU\RUGHDWK7+,6$33/,$1&(0867%(
3523(5/<*5281'('WRDYRLGVHYHUHRUIDWDOVKRFN
&$87,21
7RDYRLGWKHULVNRISHUVRQDO
LQMXU\EDFNLQMXU\RURWKHULQMXULHVGXHWRH[FHVVLYH
ZHLJKWRIWKHPLFURZDYHRYHQRUSURSHUW\GDPDJH\RX
ZLOOQHHGWZRSHRSOHWRLQVWDOOWKLVPLFURZDYHRYHQ
90RGHOV
Ensure proper
ground exists
before use
5LVNRI(OHFWULF6KRFN
&DQFDXVHLQMXU\RUGHDWK'2127XQGHUDQ\
FLUFXPVWDQFHVFXWGHIRUPRUUHPRYHDQ\RIWKHSURQJV
IURPWKHSRZHUFRUG'RQRWXVHZLWKDQH[WHQVLRQFRUG
)DLOXUHWRFRPSO\PD\FDXVH¿UH
7KHSRZHUFRUGRIWKLV
DSSOLDQFHLVHTXLSSHGZLWK
DWKUHHSURQJJURXQGLQJ
SOXJZKLFKPDWHVZLWK
DVWDQGDUGWKUHHSURQJ
JURXQGLQJZDOOUHFHSWDFOH
WRPLQLPL]HWKHSRVVLELOLW\
RIHOHFWULFVKRFNKD]DUG
IURPWKLVDSSOLDQFH
(/(&75,&$/5(48,5(0(176
90RGHOV
7KLVSURGXFWUHTXLUHVDWKUHHSURQJJURXQGHGRXWOHW
3URGXFWUDWLQJLVYROWV$&+HUW]DPSV
DQGNLORZDWWV7KLVSURGXFWPXVWEHFRQQHFWHG
WRDVXSSO\FLUFXLWRIWKHSURSHUYROWDJHDQGIUHTXHQF\
:LUHVL]HPXVWFRQIRUPWRWKHUHTXLUHPHQWVRIWKH
1DWLRQDO(OHFWULFDO&RGHRUWKHSUHYDLOLQJORFDOFRGH
IRUWKLVNLORZDWWUDWLQJ7KHSRZHUVXSSO\FRUGDQG
SOXJVKRXOGEHEURXJKWWRDVHSDUDWHWRDPSHUH
EUDQFKFLUFXLWVLQJOHJURXQGHGRXWOHW7KHRXWOHWER[
VKRXOGEHORFDWHGLQWKHFDELQHWDERYHWKHRYHQDQGDZD\
IURPDQ\SRWHQWLDOPLFURZDYHRYHQGXFWLQJ7KHRXWOHW
ER[DQGVXSSO\FLUFXLWVKRXOGEHLQVWDOOHGE\DTXDOLILHG
HOHFWULFLDQDQGFRQIRUPWRWKH1DWLRQDO(OHFWULFDO&RGHRU
WKHSUHYDLOLQJORFDOFRGH
,QVWDOODWLRQ,QVWUXFWLRQV
+22'(;+$867
127(5HDGWKHVHQH[WWZRSDJHVRQO\LI\RXSODQWRYHQW\RXUH[KDXVWWRWKHRXWVLGH
,I\RXSODQWRUHFLUFXODWHWKHDLUEDFNLQWRWKHURRPSURFHHGWRSDJH
2876,'(723(;+$867(;$03/(21/<
7KHIROORZLQJFKDUWGHVFULEHVDQH[DPSOHRIRQHSRVVLEOH
GXFWZRUNLQVWDOODWLRQ
EQUIVALENT
LENGTH
x
NUMBER
USED
=
EQUIVALENT
LENGTH
Roof Cap
24 Ft.
x
(1)
=
24 Ft.
12 Ft. Straight Duct
(6s Round)
12 Ft.
x
(1)
=
12 Ft.
Rectangular-to-Round
Transition Adaptor*
5 Ft.
x
(1)
=
5 Ft.
Total Length
=
41 Ft.
DUCT PIECES
Equivalent lengths of duct pieces are based on actual tests and
reflect requirements for good venting performance with any vent hood.
,03257$17,IDUHFWDQJXODUWRURXQGWUDQVLWLRQDGDSWRULVXVHGWKHERWWRPFRUQHUVRIWKHGDPSHUZLOO
KDYHWREHFXWWRILWXVLQJWKHWLQVQLSVLQRUGHUWRDOORZIUHHPRYHPHQWRIWKHGDPSHU
2876,'(%$&.(;+$867(;$03/(21/<
7KHIROORZLQJFKDUWGHVFULEHVDQH[DPSOHRIRQHSRVVLEOH
GXFWZRUNLQVWDOODWLRQ
EQUIVALENT
LENGTH*
x
NUMBER
USED
=
EQUIVALENT
LENGTH
Wall Cap
40 Ft.
x
(1)
=
40 Ft.
3 Ft. Straight Duct
(31⁄4s x 10s Rectangular)
3 Ft.
x
(1)
=
3 Ft.
90° Elbow
10 Ft.
x
(2)
=
20 Ft.
Total Length
=
63 Ft
DUCT PIECES
Equivalent lengths of duct pieces are based on actual tests and
reflect requirements for good venting performance with any vent hood.
127()RUEDFNH[KDXVWFDUHVKRXOGEHWDNHQWRDOLJQH[KDXVWZLWKVSDFHEHWZHHQVWXGVRUZDOOVKRXOGEHSUHSDUHG
DWWKHWLPHLWLVFRQVWUXFWHGE\OHDYLQJHQRXJKVSDFHEHWZHHQWKHZDOOVWXGVWRDFFRPPRGDWHH[KDXVW
,QVWDOODWLRQ,QVWUXFWLRQV
0D[LPXPGXFWOHQJWK
127(,I\RXQHHGWRLQVWDOOGXFWVQRWHWKDWWKHWRWDOGXFW
OHQJWKRIøs[sUHFWDQJXODURUsGLDPHWHUURXQGGXFW
VKRXOGQRWH[FHHGHTXLYDOHQWIHHW
2XWVLGHYHQWLODWLRQUHTXLUHVD+22'(;+$867'8&7
5HDGWKHIROORZLQJFDUHIXOO\
127(,WLVLPSRUWDQWWKDWYHQWLQJEHLQVWDOOHGXVLQJ
WKHPRVWGLUHFWURXWHDQGZLWKDVIHZHOERZVDVSRVVLEOH
7KLVHQVXUHVFOHDUYHQWLQJRIH[KDXVWDQGKHOSVSUHYHQW
EORFNDJHV$OVRPDNHVXUHGDPSHUVVZLQJIUHHO\DQG
QRWKLQJLVEORFNLQJWKHGXFWV
)RUVDWLVIDFWRU\DLUPRYHPHQWWKHWRWDOGXFWOHQJWKRI
øs[sUHFWDQJXODURUsGLDPHWHUURXQGGXFWVKRXOG
QRWH[FHHGHTXLYDOHQWIHHW
(OERZVWUDQVLWLRQVZDOODQGURRIFDSVHWF
SUHVHQWDGGLWLRQDOUHVLVWDQFHWRDLUIORZDQGDUHHTXLYDOHQW
WRDVHFWLRQRIVWUDLJKWGXFWZKLFKLVORQJHUWKDQWKHLUDFWXDO
SK\VLFDOVL]H:KHQFDOFXODWLQJWKHWRWDOGXFWOHQJWKDGGWKH
HTXLYDOHQWOHQJWKVRIDOOWUDQVLWLRQVDQGDGDSWRUVSOXVWKH
OHQJWKRIDOOVWUDLJKWGXFWVHFWLRQV7KHFKDUWEHORZVKRZV
\RXKRZWRFDOFXODWHWRWDOHTXLYDOHQWGXFWZRUNOHQJWKXVLQJ
WKHDSSUR[LPDWHIHHWRIHTXLYDOHQWOHQJWK
RIVRPHW\SLFDOGXFWV
([KDXVWFRQQHFWLRQ
7KHKRRGH[KDXVWKDVEHHQGHVLJQHGWRPDWHZLWK
DVWDQGDUGøs[sUHFWDQJXODUGXFW
,IDURXQGGXFWLVUHTXLUHGDUHFWDQJXODUWRURXQG
WUDQVLWLRQDGDSWRUPXVWEHXVHG'RQRWXVHOHVVWKDQ
DsGLDPHWHUGXFW
EQUIVALENT
LENGTH
x
NUMBER
USED
=
Rectangular-to-Round
Transition Adaptor*
5 Ft.
x
( )
=
Ft.
Wall Cap
40 Ft.
x
( )
=
Ft.
90° Elbow
10 Ft.
x
( )
=
Ft.
45° Elbow
5 Ft.
x
( )
=
Ft.
90° Elbow
25 Ft.
x
( )
=
Ft.
45° Elbow
5 Ft.
x
( )
=
Ft.
Roof Cap
24 Ft.
x
( )
=
Ft.
Straight Duct 6s Round or
31⁄4s x 10s Rectangular
1 Ft.
x
( )
=
Ft.
Total Ductwork =
Ft.
DUCT PIECES
EQUIVALENT
LENGTH
(TXLYDOHQWOHQJWKVRIGXFWSLHFHVDUHEDVHGRQDFWXDOWHVWVDQG
UHIOHFWUHTXLUHPHQWVIRUJRRGYHQWLQJSHUIRUPDQFHZLWKDQ\YHQW
KRRG
,03257$17,IDUHFWDQJXODUWRURXQGWUDQVLWLRQ
DGDSWRULVXVHGWKHERWWRPFRUQHUVRIWKHGDPSHU
ZLOOKDYHWREHFXWWRILWXVLQJWKHWLQVQLSVLQRUGHU
WRDOORZIUHHPRYHPHQWRIWKHGDPSHU
,QVWDOODWLRQ,QVWUXFWLRQV
3$576,1&/8'('
'$0$*(²6+,30(17
,167$//$7,21
$'',7,21$/3$576
‡,IWKHXQLWLVGDPDJHGLQVKLSPHQWUHWXUQ
WKHXQLWWRWKHVWRUHLQZKLFKLWZDVERXJKWIRU
UHSDLURUUHSODFHPHQW
‡,IWKHXQLWLVGDPDJHGE\WKHFXVWRPHUUHSDLURU
UHSODFHPHQWLVWKHUHVSRQVLELOLW\RIWKHFXVWRPHU
‡,IWKHXQLWLVGDPDJHGE\WKHLQVWDOOHULIRWKHUWKDQ
WKHFXVWRPHUUHSDLURUUHSODFHPHQWPXVW
EHPDGHE\DUUDQJHPHQWEHWZHHQFXVWRPHU
DQGLQVWDOOHU
PART
≤
≤
≤
3$576,1&/8'('
+$5':$5(3$&.(7
PART
QUANTITY
Top Cabinet
Template
1
Rear Wall
Template
1
Installation
Instructions
1
Separately
Packed
Grease
Filters
2
Exhaust
Adaptor
1
Damper
1
QUANTITY
Wood Screws
(1⁄4s x 2s)
2
Toggle Bolts (and
wing nuts) (1⁄4s x 3s)
4
Self-aligning Machine
Screw (1⁄4s-28 x 25⁄8s)
3
Nylon Grommet
(for metal cabinets)
2
Metal Screws
(1⁄8s x 1⁄2s)
1 black
2 bronze
<RXZLOOILQGWKHLQVWDOODWLRQKDUGZDUHFRQWDLQHG
LQDSDFNHWZLWKWKHXQLW&KHFNWRPDNHVXUH\RX
KDYHDOOWKHVHSDUWV
127(6RPHH[WUDSDUWVDUHLQFOXGHG
,QVWDOODWLRQ,QVWUXFWLRQV
722/6<28:,//1(('
Pencil
# 1 and #2 Phillips screwdriver
Tin snips (for cutting
damper, if required)
Ruler or tape measure
and straight edge
Scissors
(to cut template, if necessary)
Electric drill with 3⁄16s, 7⁄16s,
1⁄2s and 5⁄8s drill bits
Gloves
Stud finder or
Saw (saber, hole or keyhole)
Safety goggles
Level
02817,1*63$&(
13smax.
16-1⁄4s
30s
2s
30s
min.
Bottom edge of
cabinet needs to
be 30s or more
from the cooking
surface
Backsplash
66s or more
from the floor
to the top of
the oven
Carpenter square
(optional)
Filler blocks or scrap
wood pieces, if needed
for top cabinet spacing
(used on recessed bottom
cabinet installations only)
Hammer (optional)
Duct and masking tape
127(6
‡7KHVSDFHEHWZHHQWKHFDELQHWVPXVWEHsZLGH
DQGIUHHRIREVWUXFWLRQV
‡,IWKHVSDFHEHWZHHQWKHFDELQHWVLVJUHDWHUWKDQ
sD)LOOHU3DQHO.LWPD\EHXVHGWRILOOLQWKHJDS
EHWZHHQWKHRYHQDQGWKHFDELQHWV<RXU2ZQHU·V
0DQXDOFRQWDLQVWKHNLWQXPEHUIRU\RXUPRGHO
‡7KLVRYHQLVIRULQVWDOODWLRQRYHUUDQJHVXSWR
sZLGH
‡,I\RXDUHJRLQJWRYHQW\RXURYHQWRWKHRXWVLGH
VHH+RRG([KDXVW6HFWLRQIRUH[KDXVWGXFW
SUHSDUDWLRQ
‡:KHQLQVWDOOLQJWKHRYHQEHQHDWKVPRRWKIODW
FDELQHWVEHFDUHIXOWRIROORZWKHLQVWUXFWLRQV
RQWKHWRSFDELQHWWHPSODWHIRUSRZHUFRUG
FOHDUDQFH
‡0D[LPXPFDELQHWGHSWKDERYHDQGEHVLGHWKHXQLW
LVs
‡)RUPRGHOVZLWKWRSYHQWLQJKROHV'RQRWDOORZ
FDELQHWU\RURWKHUREMHFWVWREORFNWKHDLUIORZRIWKH
YHQW
‡7KHSURGXFWVKRXOGQRWEHLQVWDOOHGRYHUDQ\
FRRNWRSRUUDQJHZLWKDFRPELQHG%78JUHDWHU
WKDQ%78
,QVWDOODWLRQ,QVWUXFWLRQV
3/$&(0(172)7+(02817,1*3/$7(
$ 5(029,1*7+(29(1)520
7+(&$57215(029,1*
7+(02817,1*3/$7(
% ),1',1*7+(:$//678'6
5HPRYHWKHER[FRQWDLQLQJWKHLQVWDOODWLRQ
LQVWUXFWLRQVILOWHUVH[KDXVWDGDSWRUGDPSHU
DQGWKHVPDOOKDUGZDUHEDJ'RQRWUHPRYH
WKH6W\URIRDPSURWHFWLQJWKHIURQWRIWKHRYHQ
Wall
Studs
)ROGEDFNDOOFDUWRQIODSVIXOO\DJDLQVWFDUWRQVLGHV
7KHQFDUHIXOO\UROOWKHRYHQDQGFDUWRQRYHURQWR
WKHWRSVLGH7KHRYHQVKRXOGEHUHVWLQJLQWKH
6W\URIRDP
Center
)LQGWKHVWXGVXVLQJRQHRIWKHIROORZLQJPHWKRGV
$6WXGILQGHU²DPDJQHWLFGHYLFHZKLFKORFDWHVQDLOV
25
%8VHDKDPPHUWRWDSOLJKWO\DFURVVWKHPRXQWLQJ
VXUIDFHWRILQGDVROLGVRXQG7KLVZLOOLQGLFDWH
DVWXGORFDWLRQ
$IWHUORFDWLQJWKHVWXGVILQGWKHFHQWHUE\SURELQJ
WKHZDOOZLWKDVPDOOQDLOWRILQGWKHHGJHVRIWKHVWXG
7KHQSODFHDPDUNKDOIZD\EHWZHHQWKHHGJHV
7KHFHQWHURIDQ\DGMDFHQWVWXGVVKRXOGEHsRUs
IURPWKLVPDUN
'UDZDOLQHGRZQWKHFHQWHURIWKHVWXGV
,03257$177KHPLFURZDYHRYHQPXVWEHFRQQHFWHGWR
DWOHDVWRQHZDOOVWXG
Carton
Styrofoam
3XOOWKHFDUWRQXSDQGRIIWKHRYHQ
7KHPRXQWLQJSODWHLVDWWDFKHGWRWKHEDFNRIWKH
RYHQ5HPRYHWKHWZRVFUHZVKROGLQJLWWRWKHRYHQ
7KHSODWHZLOOEHXVHGDVWKHUHDUZDOOWHPSODWHDQG
IRUPRXQWLQJWKHRYHQWRWKHZDOO
6HWWKHRYHQXSULJKW5HPRYHDQGSURSHUO\GLVFDUG
SODVWLFEDJVDQG6W\URIRDP
2SHQWKHRYHQGRRUDQGUHPRYHWKHVW\URIRDP
SDFNIURPLQVLGHWKHRYHQ5HPRYHWKHWDSH
FRYHULQJWKHWXUQWDEOHKXE
,QVWDOODWLRQ,QVWUXFWLRQV
&
'(7(50,1,1*:$//3/$7(/2&$7,2181'(5<285&$%,1(7
3ODWHSRVLWLRQ²EHQHDWKIUDPHGUHFHVVHG
FDELQHWERWWRP
3ODWHSRVLWLRQ²EHQHDWKIODWERWWRP
FDELQHW
Mounting Plate Tabs
Touching the Cabinet Bottom
Mounting Plate Tabs
Touching the Back
Frame
30s to Cooktop
At least 30s, up to 36s
3ODWHSRVLWLRQ²EHQHDWKUHFHVVHGERWWRP
FDELQHWZLWKIURQWRYHUKDQJ
<RXUFDELQHWVPD\KDYHGHFRUDWLYHWULPWKDWLQWHUIHUHV
ZLWKWKHRYHQLQVWDOODWLRQ5HPRYHWKHGHFRUDWLYHWULP
WRLQVWDOOWKHRYHQSURSHUO\DQGWRPDNHLWOHYHO
7+(29(10867%(/(9(/
8VHDOHYHOWRPDNHVXUHWKHFDELQHWERWWRPLVOHYHO
Mounting Plate with
Tabs Below Cabinet
Bottom the Same
Distance as the Front
Overhang Depth
,IWKHFDELQHWVKDYHDIURQWRYHUKDQJRQO\ZLWKQREDFN
RUVLGHIUDPHLQVWDOOWKHPRXQWLQJSODWHGRZQWKHVDPH
GLVWDQFHDVWKHIURQWRYHUKDQJGHSWK7KLVZLOONHHS
WKHRYHQOHYHO
0HDVXUHWKHLQVLGHGHSWKRIWKHIURQWRYHUKDQJ
'UDZDKRUL]RQWDOOLQHRQWKHEDFNZDOODQHTXDO
GLVWDQFHEHORZWKHFDELQHWERWWRPDVWKHLQVLGHGHSWK
RIWKHIURQWRYHUKDQJ
)RUWKLVW\SHRILQVWDOODWLRQZLWKIURQWRYHUKDQJRQO\
DOLJQWKHPRXQWLQJWDEVZLWKWKLVKRUL]RQWDOOLQHQRW
WRXFKLQJWKHFDELQHWERWWRPDVGHVFULEHGLQ6WHS'
30s to Cooktop
,QVWDOODWLRQ,QVWUXFWLRQV
' $/,*1,1*7+(:$//3/$7(
Hole B
Draw a Vertical
Line on Wall
from Center of
Top Cabinet
Hole A
Hole D
Hole C
Area E
&$87,21
:HDUJORYHVWRDYRLGFXWWLQJ
ILQJHUVRQVKDUSHGJHV
'UDZDYHUWLFDOOLQHRQWKHZDOODWWKHFHQWHURIWKHs
ZLGHVSDFH
8VHWKHPRXQWLQJSODWHDVWKHWHPSODWHIRUWKHUHDUZDOO
3ODFHWKHPRXQWLQJSODWHRQWKHZDOOPDNLQJVXUHWKDW
WKHWDEVDUHWRXFKLQJWKHERWWRPRIWKHFDELQHWRU
WKHOHYHOOLQHGUDZQLQ6WHS&IRUFDELQHWVZLWKIURQW
RYHUKDQJ/LQHXSWKHQRWFKDQGFHQWHUOLQHRQ
WKHPRXQWLQJSODWHWRWKHFHQWHUOLQHRQWKHZDOO
:KLOHKROGLQJWKHPRXQWLQJSODWHZLWKRQHKDQGGUDZ
FLUFOHVRQWKHZDOODWKROHV$%&DQG'VHHLOOXVWUDWLRQ
DERYHDFWXDOSODWHPDUNHGZLWKDUURZV)RXUKROHV
PXVWEHXVHGIRUPRXQWLQJ
127(+ROHV&DQG'DUHLQVLGHDUHD(,IQHLWKHU&QRU'
LVLQDVWXGILQGDVWXGVRPHZKHUHLQDUHD(DQGGUDZD
ILIWKFLUFOHWROLQHXSZLWKWKHVWXG,WLVLPSRUWDQWWRXVH
DWOHDVWRQHZRRGVFUHZPRXQWHGILUPO\LQDVWXG
WRVXSSRUWWKHZHLJKWRIWKHRYHQ
6HWWKHPRXQWLQJSODWHDVLGH
:$51,1*
5LVNRIHOHFWULFVKRFN&DQFDXVH
LQMXU\RUGHDWK7DNHFDUHWRQRWGULOOLQWRHOHFWULFDOZLULQJ
LQVLGHZDOOVRUFDELQHWV
'ULOOKROHVRQWKHFLUFOHV,IWKHUHLVDVWXGGULOODøsKROH
IRUZRRGVFUHZV)RUKROHVWKDWGRQ·WOLQHXSZLWKDVWXG
GULOODøsKROHIRUWRJJOHEROWV
127('2127028177+(3/$7($77+,67,0(
,QVWDOODWLRQ,QVWUXFWLRQV
,167$//$7,217<3(6&KRRVH$%RU&
7KLVRYHQLVGHVLJQHGIRUDGDSWDWLRQWRWKHIROORZLQJ
W\SHVRIYHQWLODWLRQ
$2XWVLGH7RS([KDXVW9HUWLFDO'XFW
%2XWVLGH%DFN([KDXVW+RUL]RQWDO'XFW
&5HFLUFXODWLQJ1RQ9HQWHG'XFWOHVV
$
127(7KLVRYHQLVVKLSSHGDVVHPEOHGIRU2XWVLGH7RS
([KDXVW6HOHFWWKHW\SHRIYHQWLODWLRQUHTXLUHGIRU\RXU
LQVWDOODWLRQDQGSURFHHGWRWKDWVHFWLRQ
2876,'(723(;+$867
9(57,&$/'8&7
%
2876,'(%$&.(;+$867
+25,=217$/'8&7
Adaptor in Place for
Outside Top Exhaust
6HHSDJH
6HHSDJH
&
5(&,5&8/$7,1*
1219(17(''8&7/(66
$&KDUFRDO)LOWHU$FFHVVRU\.LW
LVUHTXLUHGIRUWKHQRQYHQWHG
H[KDXVW6HH\RXU2ZQHU·V
0DQXDOIRUWKHNLWQXPEHU
6HHSDJH
,QVWDOODWLRQ,QVWUXFWLRQV
$ 2876,'(723(;+$8679HUWLFDO'XFW
,167$//$7,2129(59,(:
$$WWDFK0RXQWLQJ3ODWHWR:DOO
$3UHSDUH7RS&DELQHW
$,QVWDOO$GDSWRU
$0RXQW2YHQ
$$GMXVW([KDXVW$GDSWRU
$&RQQHFW'XFWZRUN
77$&+7+(02817,1*3/$7(
$ $
727+(:$//
7RXVHWRJJOHEROWV
B
A
Mounting
Plate
Spacing for Toggles
More Than Wall
Thickness
Toggle Wings
Toggle
Bolt
Wall
C
Bolt End
3ODFHWKHPRXQWLQJSODWHDJDLQVWWKHZDOODQGLQVHUW
WKHWRJJOHZLQJVLQWRWKHKROHVLQWKHZDOOWRPRXQW
WKHSODWH
127(%HIRUHWLJKWHQLQJWRJJOHEROWVDQGZRRGVFUHZ
PDNHVXUHWKHWDEVRQWKHPRXQWLQJSODWHWRXFK
WKHERWWRPRIWKHFDELQHWZKHQSXVKHGIOXVKDJDLQVW
WKHZDOODQGWKDWWKHSODWHLVSURSHUO\FHQWHUHGXQGHU
WKHFDELQHW
D
$WWDFKWKHSODWHWRWKHZDOOXVLQJWRJJOHEROWV$WOHDVW
RQHZRRGVFUHZPXVWEHXVHGWRDWWDFKWKHSODWHWR
DZDOOVWXG5HFRPPHQGHGORFDWLRQVRQWKHPRXQWLQJ
SODWHDUHLQGLFDWHGE\$%&DQG'
5HPRYHWKHWRJJOHZLQJVIURPWKHEROWV
,QVHUWWKHEROWVLQWRWKHPRXQWLQJSODWHWKURXJK
WKHKROHVGHVLJQDWHGWRJRLQWRGU\ZDOODQGUHDWWDFK
WKHWRJJOHZLQJVWRøsRQWRHDFKEROW
&$87,21
%HFDUHIXOWRDYRLGSLQFKLQJ
ILQJHUVEHWZHHQWKHEDFNRIWKHPRXQWLQJSODWHDQG
WKHZDOO
7LJKWHQDOOEROWV3XOOWKHSODWHDZD\IURPWKHZDOO
WRKHOSWLJKWHQWKHEROWV
,QVWDOODWLRQ,QVWUXFWLRQV
6(723&$%,1(77(03/$7()25
$ 8
35(3$5$7,212)723&$%,1(7
$ 028177+(29(1
<RXQHHGWRGULOOKROHVIRUWKHWRSVXSSRUWVFUHZV
DKROHODUJHHQRXJKIRUWKHSRZHUFRUGWRILWWKURXJK
DQGDFXWRXWODUJHHQRXJKIRUWKHH[KDXVWDGDSWRU
&$87,21
7RDYRLGWKHULVNRISHUVRQDO
LQMXU\EDFNLQMXU\RURWKHULQMXULHVGXHWRH[FHVVLYH
ZHLJKWRIWKHPLFURZDYHRYHQRUSURSHUW\GDPDJH
\RXZLOOQHHGWZRSHRSOHWRLQVWDOOWKLVPLFURZDYH
RYHQ
,03257$17'RQRWJULSRUXVHKDQGOHGXULQJ
LQVWDOODWLRQ
:$51,1*
5LVNRI(OHFWULF6KRFN&DQ
FDXVHLQMXU\RUGHDWK,ILQVWDOOLQJXQLWZLWKPHWDO
FRXQWHUWRSVFRYHUWKHHGJHRIWKHSRZHUVXSSO\
FRUGKROHZLWKWKHSRZHUVXSSO\FRUGEXVKLQJ
‡ 5HDGWKHLQVWUXFWLRQVRQWKH723&$%,1(77(03/$7(
‡ 7DSHLWXQGHUQHDWKWKHWRSFDELQHW
‡ 'ULOOWKHKROHVIROORZLQJWKHLQVWUXFWLRQVRQWKH723
&$%,1(77(03/$7(
,03257$17,IILOOHUEORFNVDUHQRWXVHGFDVHGDPDJH
PD\RFFXUIURPRYHUWLJKWHQLQJVFUHZV
&$87,21
:HDUVDIHW\JRJJOHVZKHQ
GULOOLQJKROHVLQWKHFDELQHWERWWRP
127(:KHQPRXQWLQJ
WKHPLFURZDYHRYHQ
WKUHDGSRZHUFRUGWKURXJK
KROHLQERWWRPRIWRS
FDELQHW.HHSLWWLJKW
WKURXJKRXW6WHSV²'R
QRWSLQFKFRUGRUOLIWRYHQ
E\SXOOLQJFRUG
$ $66(0%/($1',167$//$'$3725
Damper
/LIWPLFURZDYHRYHQ
WLOWLWIRUZDUGDQGKRRN
VORWVDWEDFNERWWRP
HGJHRQWRIRXUORZHU
WDEVRIPRXQWLQJSODWH
Exhaust
Adaptor
Blower Plate
Back of
Oven
3ODFHWKHRYHQLQLWVXSULJKWSRVLWLRQZLWKWKHWRS
RIWKHXQLWIDFLQJXS
,QVHUWWKHWDEVRQHDFKVLGHRIWKHGDPSHULQWR
WKHKROHVDWWKHLQVLGHUHDURIWKHDGDSWRU
$WWDFKWKHH[KDXVWDGDSWRUWRWKHEORZHUSODWHZLWK
WKHWZREURQ]HPHWDOVFUHZVSURYLGHG
0DNHVXUHWKDWWKHGDPSHUSLYRWVHDVLO\EHIRUH
PRXQWLQJRYHQ
<RXZLOOQHHGWRPDNHDGMXVWPHQWVWRDVVXUHSURSHU
DOLJQPHQWZLWK\RXUKRXVHH[KDXVWGXFWDIWHUWKH
RYHQLVLQVWDOOHG
5RWDWHIURQWRIRYHQXS
DJDLQVWFDELQHWERWWRP
,QVHUWDVHOIDOLJQLQJVFUHZWKURXJKWRSFHQWHU
FDELQHWKROH7HPSRUDULO\VHFXUHWKHRYHQE\
WXUQLQJWKHVFUHZDWOHDVWWZRIXOOWXUQVDIWHU
WKHWKUHDGVKDYHHQJDJHG,WZLOOEHFRPSOHWHO\
WLJKWHQHGODWHU
,QVWDOODWLRQ,QVWUXFWLRQV
$ $'-8677+((;+$867$'$3725
$ 028177+(29(1FRQWLQXHG
2SHQWKHWRSFDELQHWDQGDGMXVWWKHH[KDXVWDGDSWRU
WRFRQQHFWWRWKHKRXVHGXFW
$WWDFKWKHRYHQWRWKHWRSFDELQHW
,QVHUWVHOIDOLJQLQJVFUHZV
øs[ȓsWKURXJKRXWHU
WRSFDELQHWKROHV7XUQWZRIXOO
WXUQVRQHDFKVFUHZ
Damper
Back of
Oven
$ &211(&7,1*'8&7:25.
House Duct
Cabinet Front
Cabinet Bottom Shelf
Filler Block
Equivalent
to Depth of
Cabinet Recess
This distance
can NOT
exceed 2” to
ensure proper
installation
Self-Aligning Screw
Oven Top
([WHQGWKHKRXVHGXFWGRZQWRFRQQHFWWR
WKHH[KDXVWDGDSWRU
6HDOH[KDXVWGXFWMRLQWVXVLQJGXFWWDSH
7LJKWHQWKHRXWHUWZRVFUHZVWRWKHWRSRIWKHRYHQ
:KLOHWLJKWHQLQJVFUHZVKROGWKHRYHQLQSODFH
DJDLQVWWKHZDOODQGWKHWRSFDELQHW
,QVWDOOJUHDVHILOWHUV6HHWKH2ZQHU·V0DQXDO
SDFNHGZLWKWKHRYHQ
,QVWDOODWLRQ,QVWUXFWLRQV
% 2876,'(%$&.(;+$867+RUL]RQWDO'XFW
,167$//$7,2129(59,(:
%3UHSDUH5HDU:DOO
%$WWDFK0RXQWLQJ3ODWHWR:DOO
%3UHSDUH7RS&DELQHW
%$GMXVW%ORZHU
%0RXQWWKH2YHQ
% $77$&+7+(02817,1*3/$7(
727+(:$//
% 35(3$5,1*7+(5($5:$// )252876,'(%$&.(;+$867
<RXQHHGWRFXWDQRSHQLQJLQWKHUHDUZDOOIRURXWVLGH
H[KDXVW
$WWDFKWKHSODWHWRWKHZDOOXVLQJWRJJOHEROWV$WOHDVW
RQHZRRGVFUHZPXVWEHXVHGWRDWWDFKWKHSODWHWR
DZDOOVWXG
5HPRYHWKHWRJJOHZLQJVIURPWKHEROWV
,QVHUWWKHEROWVLQWRWKHPRXQWLQJSODWHWKURXJK
WKHKROHVGHVLJQDWHGWRJRLQWRGU\ZDOODQGUHDWWDFK
WKHWRJJOHZLQJVWRøsRQWRHDFKEROW
‡ 5HDGWKHLQVWUXFWLRQVRQWKH5($5:$//7(03/$7(
‡ 7DSHLWWRWKHUHDUZDOOOLQLQJXSZLWKWKHKROHV
SUHYLRXVO\GULOOHGIRUKROHV$DQG%LQWKHZDOOSODWH
‡ &XWWKHRSHQLQJIROORZLQJWKHLQVWUXFWLRQVRIWKH
5($5:$//7(03/$7(
,QVWDOODWLRQ,QVWUXFWLRQV
7RXVHWRJJOHEROWV
Mounting
Plate
% $'$37,1*%/2:(5)25
2876,'(%$&.(;+$867
Spacing for Toggles More
Than Wall Thickness
Toggle Wings
Toggle
Bolt
Wall
5HPRYHWKHWKUHHVFUHZVWKDWKROGWKHEORZHU
SODWHWRWKHRYHQ6OLGHEORZHUSODWHIURPXQGHU
LWVUHWDLQLQJIODQJH5HPRYHDQGVDYHWKHVFUHZ
WKDWKROGVEORZHUPRWRUWRRYHQ
Retaining
Flange
Blower Plate
Bolt End
3ODFHWKHPRXQWLQJSODWHDJDLQVWWKHZDOODQGLQVHUW
WKHWRJJOHZLQJVLQWRWKHKROHVLQWKHZDOOWRPRXQW
WKHSODWH
127(%HIRUHWLJKWHQLQJWRJJOHEROWVDQGZRRGVFUHZ
PDNHVXUHWKHWDEVRQWKHPRXQWLQJSODWHWRXFK
WKHERWWRPRIWKHFDELQHWZKHQSXVKHGIOXVKDJDLQVW
WKHZDOODQGWKDWWKHSODWHLVSURSHUO\FHQWHUHGXQGHU
WKHFDELQHW
Blower Motor
Screw
&DUHIXOO\SXOORXWWKHEORZHUXQLW7KHZLUHV
ZLOOH[WHQGIDUHQRXJKWRDOORZ\RXWRDGMXVW
WKHEORZHUXQLW
%()25()DQ%ODGH
2SHQLQJV)DFLQJ8S
&$87,21
%HFDUHIXOWRDYRLGSLQFKLQJ
ILQJHUVEHWZHHQWKHEDFNRIWKHPRXQWLQJ
SODWHDQGWKHZDOO
7LJKWHQDOOEROWV3XOOWKHSODWHDZD\IURPWKHZDOO
WRKHOSWLJKWHQWKHEROWV
End B
End A
5RWDWHEORZHUXQLWFRXQWHUFORFNZLVHƒ
% 86(723&$%,1(77(03/$7(
)2535(3$5$7,212)723
&$%,1(7
Before Rotation
After Rotation
<RXQHHGWRGULOOKROHVIRUWKHWRSVXSSRUWVFUHZVDQG
DKROHODUJHHQRXJKIRUWKHSRZHUFRUGWRILWWKURXJK
Back of
Oven
Back of
Oven
*HQWO\UHPRYHWKHZLUHVIURPWKHJURRYHV
5HURXWHWKHZLUHVWKURXJKJURRYHVRQRWKHUVLGH
RIWKHEORZHUXQLW
Before Rerouting
After Rerouting
Wires Routed Through Right Side
Wires Routed Through Left Side
‡ 5HDGWKHLQVWUXFWLRQVRQWKH723&$%,1(7
7(03/$7(
‡ 7DSHLWXQGHUQHDWKWKHWRSFDELQHW
‡ 'ULOOWKHKROHVIROORZLQJWKHLQVWUXFWLRQVRQWKH
723&$%,1(77(03/$7(
&$87,21
:HDUVDIHW\JRJJOHVZKHQ
GULOOLQJKROHVLQWKHFDELQHWERWWRP
,QVWDOODWLRQ,QVWUXFWLRQV
5ROOWKHEORZHUXQLWƒVRWKDWIDQEODGHRSHQLQJV
DUHIDFLQJRXWWKHEDFNRIWKHRYHQ
5HSODFHWKHEORZHUSODWHLQWKHVDPHSRVLWLRQ
DVEHIRUHZLWKWKHVFUHZV
Blower Plate Screws
Blower Plate
After Rolling
Before Rolling
Back of Oven
Back of
Oven
,QVHUWWKHWDEVRQHDFKVLGHRIWKHGDPSHU
LQWRWKHKROHVDWWKHLQVLGHUHDURIWKHDGDSWRU
Back of
Oven
/RFDWHWKHWZR´NQRFNRXWµSODWHVRQWKHUHDURYHQ
SDQHOQHDUWKHWRSRIWKHRYHQ
8VLQJWLQVQLSVFDUHIXOO\FXWWKHZHEDUHDIURPWKH
WZRKROHVVLGHE\VLGHWKDWVHFXUHWKHNQRFNRXWVWR
WKHRYHQ&XWDOOIRXUZHEVRQERWKUHDUNQRFNRXWV
WKLVZLOODOORZWKHYHQWLODWLRQIDQDLUIORZWRH[KDXVW
RXWWKHUHDURIWKHRYHQ
Exhaust
Adaptor
&$87,21
%HVXUHWRWULPWKHVKDUS
HGJHVIURPWKHRSHQLQJVDIWHUUHPRYLQJWKH
NQRFNRXWSODWHV
$WWDFKWKHH[KDXVWDGDSWRUWRWKHUHDURIWKHRYHQ
E\VOLGLQJLWLQWRWKHJXLGHVDWWKHWRSFHQWHURIWKH
EDFNRIWKHRYHQ
2YHQ5HDU3DQHO
Snip all 4 webs
on each knockout
panel and remove
the metal knockouts
for rear airflow.
Exhaust Adaptor
Slide exhaust
adaptor into
guides on
oven rear.
3ODFHWKHEORZHUXQLWEDFNLQWRWKHRSHQLQJ
$)7(5)DQ%ODGH
2SHQLQJV)DFLQJ
%DFN
Screws
Locking
Tabs
End A
Back of Oven
Guides
3XVKLQVHFXUHO\XQWLOLWLVLQWKHORZHUORFNLQJWDEV
7DNHFDUHWRDVVXUHWKHGDPSHUKLQJHLVLQVWDOOHG
VRWKDWLWLVDWWKHWRSDQGWKDWWKHGDPSHUVZLQJV
IUHHO\
End B
Damper
(hinge side up)
6HFXUHWKHH[KDXVWDGDSWRUWRWKHRYHQZLWK
WKHWZREURQ]HPHWDOVFUHZVSURYLGHG
:$51,1*
5LVNRIHOHFWULFVKRFN
FDQFDXVHLQMXU\RUGHDWK'RQRWSXOORUVWUHWFK
WKHEORZHUXQLWZLULQJPDNHVXUHWKHZLUHVDUH
QRWSLQFKHG
127(7KHEORZHUXQLWH[KDXVWRSHQLQJVVKRXOG
PDWFKH[KDXVWRSHQLQJVRQUHDURIPLFURZDYHRYHQ
,QVWDOODWLRQ,QVWUXFWLRQV
Cabinet Front
% 028177+(29(1
Cabinet Bottom Shelf
Filler Block
Equivalent
to Depth of
Cabinet Recess
&$87,217RDYRLGWKHULVNRISHUVRQDO
This distance
can NOT
exceed 2” to
ensure proper
installation
Self-Aligning Screw
LQMXU\EDFNLQMXU\RURWKHULQMXULHVGXHWRH[FHVVLYH
ZHLJKWRIWKHPLFURZDYHRYHQRUSURSHUW\GDPDJH
\RXZLOOQHHGWZRSHRSOHWRLQVWDOOWKLVPLFURZDYH
RYHQ
Oven Top
$WWDFKWKHRYHQWRWKHWRSFDELQHW
,QVHUWVHOIDOLJQLQJVFUHZV
øs[ȓsWKURXJKRXWHU
WRSFDELQHWKROHV7XUQWZRIXOO
WXUQVRQHDFKVFUHZ
,03257$17'RQRWJULSRUXVHKDQGOHGXULQJ
LQVWDOODWLRQ
:$51,1*
5LVNRI(OHFWULF6KRFN&DQ
FDXVHLQMXU\RUGHDWK,ILQVWDOOLQJXQLWZLWKPHWDO
FRXQWHUWRSVFRYHUWKHHGJHRIWKHSRZHUVXSSO\
FRUGKROHZLWKWKHSRZHUVXSSO\FRUGEXVKLQJ
,03257$17,IILOOHUEORFNVDUHQRWXVHGFDVHGDPDJH
PD\RFFXUIURPRYHUWLJKWHQLQJVFUHZV
127(:KHQPRXQWLQJ
WKHPLFURZDYHRYHQ
WKUHDGSRZHUFRUGWKURXJK
KROHLQERWWRPRIWRS
FDELQHW.HHSLWWLJKW
WKURXJKRXW6WHSV²'R
QRWSLQFKFRUGRUOLIWRYHQ
E\SXOOLQJFRUG
/LIWPLFURZDYHRYHQ
WLOWLWIRUZDUGDQGKRRN
VORWVDWEDFNERWWRP
HGJHRQWRIRXUORZHU
WDEVRIPRXQWLQJSODWH
7LJKWHQWKHRXWHUWZRVFUHZVWRWKHWRSRIWKH
RYHQ:KLOHWLJKWHQLQJVFUHZVKROGWKHRYHQ
LQSODFHDJDLQVWWKHZDOODQGWKHWRSFDELQHW
5RWDWHIURQWRIRYHQXS
DJDLQVWFDELQHWERWWRP
,QVHUWDVHOIDOLJQLQJVFUHZWKURXJKWRSFHQWHU
FDELQHWKROH7HPSRUDULO\VHFXUHWKHRYHQE\
WXUQLQJWKHVFUHZDWOHDVWWZRIXOOWXUQVDIWHU
WKHWKUHDGVKDYHHQJDJHG,WZLOOEHFRPSOHWHO\
WLJKWHQHGODWHU
,QVWDOOJUHDVHILOWHUV6HHWKH2ZQHU·V0DQXDO
SDFNHGZLWKWKHRYHQ
,QVWDOODWLRQ,QVWUXFWLRQV
& 5(&,5&8/$7,1* 1RQ9HQWHG'XFWOHVV
,167$//$7,2129(59,(:
&$WWDFK0RXQWLQJ3ODWHWR:DOO
&3UHSDUH7RS&DELQHW
&$GMXVW%ORZHU
&0RXQWWKH2YHQ
&,QVWDOO&KDUFRDO)LOWHUQRWVXSSOLHG
3ODFHWKHPRXQWLQJSODWHDJDLQVWWKHZDOODQGLQVHUW
WKHWRJJOHZLQJVLQWRWKHKROHVLQWKHZDOOWRPRXQW
WKHSODWH
127(%HIRUHWLJKWHQLQJWRJJOHEROWVDQGZRRGVFUHZ
PDNHVXUHWKHWDEVRQWKHPRXQWLQJSODWHWRXFKWKH
ERWWRPRIWKHFDELQHWZKHQSXVKHGIOXVKDJDLQVWWKH
ZDOODQGWKDWWKHSODWHLVSURSHUO\FHQWHUHGXQGHUWKH
FDELQHW
& $77$&+7+(02817,1*3/$7(
727+(:$//
&$87,21
%HFDUHIXOWRDYRLGSLQFKLQJ
ILQJHUVEHWZHHQWKHEDFNRIWKHPRXQWLQJSODWHDQG
WKHZDOO
7LJKWHQDOOEROWV3XOOWKHSODWHDZD\IURPWKHZDOO
WRKHOSWLJKWHQWKHEROWV
$WWDFKWKHSODWHWRWKHZDOOXVLQJWRJJOHEROWV$WOHDVW
RQHZRRGVFUHZPXVWEHXVHGWRDWWDFKWKHSODWHWR
DZDOOVWXG
5HPRYHWKHWRJJOHZLQJVIURPWKHEROWV
,QVHUWWKHEROWVLQWRWKHPRXQWLQJSODWHWKURXJK
WKHKROHVGHVLJQDWHGWRJRLQWRGU\ZDOODQGUHDWWDFK
WKHWRJJOHZLQJVWRøsRQWRHDFKEROW
& 86(723&$%,1(77(03/$7(
)2535(3$5$7,212)723&$%,1(7
<RXQHHGWRGULOOKROHVIRUWKHWRSVXSSRUWVFUHZVDQG
DKROHODUJHHQRXJKIRUWKHSRZHUFRUGWRILWWKURXJK
7RXVHWRJJOHEROWV
Mounting
Plate
Spacing for Toggles
More Than Wall
Thickness
Toggle Wings
Toggle
Bolt
Wall
‡ 5HDGWKHLQVWUXFWLRQVRQWKH723&$%,1(7
7(03/$7(
‡ 7DSHLWXQGHUQHDWKWKHWRSFDELQHW
‡ 'ULOOWKHKROHVIROORZLQJWKHLQVWUXFWLRQVRQWKH723
&$%,1(77(03/$7(
&$87,21
Bolt End
:HDUVDIHW\JRJJOHVZKHQ
GULOOLQJKROHVLQWKHFDELQHWERWWRP
,QVWDOODWLRQ,QVWUXFWLRQV
& $'$37,1*%/2:(5
)255(&,5&8/$7,21
&DUHIXOO\SXOORXWWKHEORZHUXQLW7KHZLUHV
ZLOOH[WHQGIDUHQRXJKWRDOORZ\RXWRDGMXVW
WKHEORZHUXQLW
127(7KHH[KDXVWDGDSWRUZLWKGDPSHULVQRW
QHHGHGIRUUHFLUFXODWLQJPRGHOV<RXPD\ZDQW
WRVDYHWKHPIRUSRVVLEOHIXWXUHXVH
5HPRYHDQGVDYHVFUHZVWKDWKROGEORZHUSODWH
WRWKHRYHQ
Blower Plate Screws
5ROOWKHEORZHUXQLWƒVRWKDWIDQEODGHRSHQLQJV
DUHIDFLQJWRZDUGWKHIURQWRIWKHRYHQ
%()25()DQ%ODGH
2SHQLQJV)DFLQJ8S
Back of Oven
6OLGHWKHEORZHUSODWHIURPXQGHULWVUHWDLQLQJ
IODQJHDQGOLIWLWRII5HPRYHDQGVDYHVFUHZWKDW
KROGVWKHEORZHUPRWRUWRRYHQ
Retaining
Flange
Roll
Blower Plate
Blower Motor
Screw
$)7(5)DQ%ODGH
2SHQLQJV)DFLQJ
)RUZDUG
127(0DNHVXUHZLUHVUHPDLQURXWHGLQWKHJURRYHV
RIWKHPRWRUIUDPH
,QVWDOODWLRQ,QVWUXFWLRQV
& $'$37,1*%/2:(5)25
5(&,5&8/$7,21FRQWLQXHG
& 028177+(29(1
3ODFHWKHEORZHUXQLWEDFNLQWRWKHRSHQLQJ
:$51,1*
5LVNRIHOHFWULFVKRFN
FDQFDXVHLQMXU\RUGHDWK'RQRWSXOORUVWUHWFK
WKHEORZHUXQLWZLULQJ0DNHVXUHWKHZLUHGDUH
QRWSLQFKHG
&$87,21
7RDYRLGWKHULVNRISHUVRQDO
LQMXU\EDFNLQMXU\RURWKHULQMXULHVGXHWRH[FHVVLYH
ZHLJKWRIWKHPLFURZDYHRYHQRUSURSHUW\GDPDJH
\RXZLOOQHHGWZRSHRSOHWRLQVWDOOWKLVPLFURZDYH
RYHQ
6HFXUHEORZHUXQLWWRRYHQZLWKWKHVFUHZV
UHPRYHGLQ6WHS,QVHUWWKHVFUHZLQERWWRPULJKW
VFUHZKROHRQWKHEDFNRIWKHRYHQ
,03257$17'RQRWJULSRUXVHKDQGOHGXULQJ
LQVWDOODWLRQ
:$51,1*
5HSODFHEORZHUSODWHZLWKWKHVFUHZVUHPRYHGLQ
6WHS
5LVNRI(OHFWULF6KRFN&DQ
FDXVHLQMXU\RUGHDWK,ILQVWDOOLQJXQLWZLWKPHWDO
FRXQWHUWRSVFRYHUWKHHGJHRIWKHSRZHUVXSSO\
FRUGKROHZLWKWKHSRZHUVXSSO\FRUGEXVKLQJ
Blower Plate Screws
,03257$17,IILOOHUEORFNVDUHQRWXVHGFDVHGDPDJH
PD\RFFXUIURPRYHUWLJKWHQLQJVFUHZV
Back of Oven
Blower Motor
Screw
127(:KHQPRXQWLQJ
WKHPLFURZDYHRYHQ
WKUHDGSRZHUFRUGWKURXJK
KROHLQERWWRPRIWRS
FDELQHW.HHSLWWLJKW
WKURXJKRXW6WHSV²'R
QRWSLQFKFRUGRUOLIWRYHQ
E\SXOOLQJFRUG
5RWDWHIURQWRIRYHQXS
DJDLQVWFDELQHWERWWRP
/LIWPLFURZDYHRYHQ
WLOWLWIRUZDUGDQGKRRN
VORWVDWEDFNERWWRP
HGJHRQWRIRXUORZHU
WDEVRIPRXQWLQJSODWH
,QVWDOODWLRQ,QVWUXFWLRQV
& ,167$//,1*7+(&+$5&2$/
),/7(5
& 028177+(29(1FRQWLQXHG
,QVHUWDVHOIDOLJQLQJVFUHZWKURXJKWRSFHQWHU
FDELQHWKROH7HPSRUDULO\VHFXUHWKHRYHQE\
WXUQLQJWKHVFUHZDWOHDVWWZRIXOOWXUQVDIWHU
WKHWKUHDGVKDYHHQJDJHG,WZLOOEHFRPSOHWHO\
WLJKWHQHGODWHU
5HPRYHVFUHZVRQWRSRIRYHQMXVWDERYH
WKHJULOOHSDQHOXVLQJD3KLOOLSVVFUHZGULYHU
2SHQWKHGRRU
5HPRYHWKHJULOOH
Cabinet Front
Screws
Cabinet Bottom Shelf
Filler Block
Equivalent
to Depth of
Cabinet Recess
Grille
This distance
can NOT
exceed 2” to
ensure proper
installation
Self-Aligning Screw
Oven Top
,QVHUWWKHILOWHULQWRWKHRYHQDVVKRZQXQWLOLWILWV
VTXDUHO\LQWRSODFH,WZLOOUHVWDWDQDQJOHEHKLQG
WKHIURQWORZHUWDEV:KHQSURSHUO\LQVWDOOHG
WKHZLUHPHVKRIWKHILOWHUVKRXOGEHYLVLEOH
IURPWKHIURQW
,QVHUWVHOIDOLJQLQJVFUHZV
øs[ȓµWKURXJKRXWHU
WRSFDELQHWKROHV7XUQWZRIXOO
WXUQVRQHDFKVFUHZ
Front lower tabs
Charcoal filter
7LJKWHQWKHRXWHUWZRVFUHZVWRWKHWRSRIWKH
RYHQ:KLOHWLJKWHQLQJVFUHZVKROGWKHRYHQ
LQSODFHDJDLQVWWKHZDOODQGWKHWRSFDELQHW
Charcoal filter installed
5HSODFHWKHJULOOHDQGWKHWRSVFUHZV
&ORVHWKHGRRUDQGUHSODFHOHIWVLGHVFUHZ
,QVWDOOJUHDVHILOWHUV6HHWKH2ZQHU·V0DQXDO
SDFNHGZLWKWKHRYHQ
,QVWDOODWLRQ,QVWUXFWLRQV
%()25(<2886(<28529(1
0DNHVXUHWKHRYHQKDVEHHQLQVWDOOHG
DFFRUGLQJWRLQVWUXFWLRQV
5HPRYHDOOSDFNLQJPDWHULDOIURPWKHRYHQ
,QVWDOOWXUQWDEOHDQGZKHHOHGULQJLQFDYLW\
5HSODFHKRXVHIXVHRUWXUQEUHDNHUEDFNRQ
90RGHOV3OXJSRZHUFRUGLQWR
DGHGLFDWHGWRDPSHOHFWULFDORXWOHW
Ensure proper
ground exists
before use.
:KHUHDVWDQGDUGWZRSURQJZDOOUHFHSWDFOH
LVHQFRXQWHUHGLWLVYHU\LPSRUWDQWWRKDYHLW
UHSODFHGZLWKDSURSHUO\JURXQGHGWKUHHSURQJ
ZDOOUHFHSWDFOHLQVWDOOHGE\DTXDOLILHG
HOHFWULFLDQ
5HDGWKH2ZQHU·V0DQXDO
.((3,167$//$7,21,16758&7,216
)257+(/2&$/,163(&725·686(
0)/
*(
3ULQWHGLQ.RUHD
,QVWUXFFLRQHV
GHLQVWDODFLyQ
+RUQRSDUDFRORFDU
HQFLPDGHODHVWXID
390
&90
¢3UHJXQWDV"/ODPH*(&$5(6RYLVLWHQXHVWUDSiJLQDHQODUHGHQ*($SSOLDQFHVFRP
$17(6'((03(=$5
1RWDSDUDHOFRQVXPLGRU²*XDUGHHVWDV
LQVWUXFFLRQHVSDUDIXWXUDUHIHUHQFLD
‡ 1LYHOGHGHVWUH]DV²/DLQVWDODFLyQGHHVWHDSDUDWR
UHTXLHUHGHGHVWUH]DVEiVLFDVGHPHFiQLFD\HOHFWULFLGDG
‡ /DLQVWDODFLyQDSURSLDGDHVUHVSRQVDELOLGDG
GHOLQVWDODGRU
‡ /DIDOODGHOSURGXFWRGHELGRDXQDLQVWDODFLyQ
LQDSURSLDGDQRHVWiFXELHUWDSRUODJDUDQWtD
/HDHVWDVLQVWUXFFLRQHVFRPSOHWD\FXLGDGRVDPHQWH
‡
‡
‡
,03257$17(²
*XDUGHHVWDV
LQVWUXFFLRQHVSDUDHOXVRGHOLQVSHFWRUORFDO
,03257$17(²
&XPSODFRQWRGRVORV
FyGLJRV\RUGHQDQ]DVJXEHUQDPHQWDOHV
‡ 1RWDSDUDHOLQVWDODGRU²$VHJ~UHVHGHGHMDU
HVWDVLQVWUXFFLRQHVFRQHOFRQVXPLGRU
/($&8,'$'26$0(17(
*8$5'((67$6,16758&&,21(6
,QVWUXFFLRQHVGHLQVWDODFLyQ
& 5HFLUFXODFLyQ ²
&217(1,'2
&yPRDGKHULUODSODFDGH
PRQWDMHDODSDUHG
,QVWUXFFLRQHVGHVHJXULGDGLPSRUWDQWHV
3UHSDUDFLyQGHOJDELQHWHVXSHULRU
5HTXLVLWRVHOpFWULFRV
,QIRUPDFLyQJHQHUDO
&DPSDQDGHHVFDSH 'DxRV²(QYtR,QVWDODFLyQ
3DUWHVLQFOXLGDV
(VSDFLRGHPRQWDMH
*XtDGHLQVWDODFLyQSDVRSRUSDVR
&yPRFRORFDUHOSODWRGHPRQWDMH ²
&yPRUHPRYHUHOSODWRGHPRQWDMH
&yPRHQFRQWUDUPDGHUDVyOLGD
HQODSDUHG
&yPRGHWHUPLQDUODORFDOL]DFLyQ
GHODVSODFDVGHODSDUHG
&yPRDOLQHDUODSODFDGHODSDUHG
7LSRVGHLQVWDODFLyQ ²
$ (VFDSHVXSHULRUH[WHULRU ²
&yPRDGKHULUODSODFDGH
PRQWDMHDODSDUHG 3UHSDUDFLyQGHOJDELQHWHVXSHULRU (QVDPEODMHHLQVWDODFLyQ
GHODGDSWDGRU &yPRPRQWDUHOKRUQR
&yPRDMXVWDUHODGDSWDGRUGHHVFDSH &yPRFRQHFWDUHOFRQGXFWR % (VFDSHSRVWHULRUH[WHUQR ²
&yPRSUHSDUDUODSDUHGSRVWHULRU
SDUDHOHVFDSHSRVWHULRUH[WHULRU &yPRDGKHULUHOSODWRGH
PRQWDMHDODSDUHG
3UHSDUDFLyQGHOJDELQHWHVXSHULRU &yPRDGDSWDUHOFDOHIDFWRUSDUD
HOHVFDSHSRVWHULRUH[WHULRU
&yPRPRQWDUHOKRUQR &yPRDGDSWDUHOFDOHIDFWRU
SDUDODUHFLUFXODFLyQ
&yPRPRQWDUHOKRUQR
&yPRLQVWDODUHO¿OWURGHFDUERQLOOD
$QWHVGHFRPHQ]DUDXVDUVXKRUQR +HUUDPLHQWDVTXHQHFHVLWDUi
,QVWUXFFLRQHVGHLQVWDODFLyQ
,16758&&,21(6'(6(*85,'$',03257$17(6
(VWHSURGXFWRUHTXLHUHXQWRPDFRUULHQWHHOpFWULFR
GHWUHVSDWDVFRQHFWDGRDWLHUUD(OLQVWDODGRUGHEH
OOHYDUDFDERXQDLQVSHFFLyQGHFRQWLQXLGDGDWLHUUD
HQODFDMDHOpFWULFDDQWHVGHFRPHQ]DUODLQVWDODFLyQ
SDUDDVHJXUDUTXHODFDMDWRPDFRUULHQWHHVWiFRQHFWDGD
DWLHUUDGHPDQHUDDSURSLDGD6LQRORHVWiRVL
HOWRPDFRUULHQWHQRFXPSOHFRQORVUHTXLVLWRV
HOpFWULFRVLQGLFDGRVEDMRODVHFFLyQ5(48,6,726
(/e&75,&26VHGHEHUiUHFXUULUDXQWpFQLFR
FDOLILFDGRSDUDFRUUHJLUFXDOTXLHUGHILFLHQFLD
$'9(57(1&,$
5LHVJRGH'HVFDUJD
(OpFWULFD3XHGHRFDVLRQDUOHVLRQHVRODPXHUWH181&$
EDMRQLQJXQDFLUFXQVWDQFLDFRUWHGHIRUPHRHOLPLQH
QLQJXQDGHODVSXQWDVGHORVFDEOHVGHFRUULHQWH1RXVH
XQSURORQJDGRU6LQRVHFXPSOHFRQHVWRVHSRGUiQ
SURGXFLULQFHQGLRV
35(&$8&,Ï1
3RUUD]RQHVGH
VHJXULGDGODVXSHUILFLHGHPRQWDMHGHEHUiSRGHU
VRSRUWDUODFDUJDGHOJDELQHWHVXPDGRDOSHVR
DJUHJDGRGHHVWHSURGXFWRGHHQWUH\OLEUDV
DGHPiVGHFDUJDVDGLFLRQDOHVHQHOKRUQRGHKDVWD
OLEUDVRXQSHVRWRWDOGHHQWUH\OLEUDV
35(&$8&,Ï1
3DUDVHJXULGDGSHUVRQDO
UHPXHYDHOIXVLEOHGHODFDVD
RDEUDHOLQWHUUXSWRUGHFLUFXLWRDQWHV
GHFRPHQ]DUODLQVWDODFLyQ
SDUDHYLWDUGHVFDUJDVHOpFWULFDV
VHYHUDVRIDWDOHV
35(&$8&,Ï1
3RUUD]RQHVGH
VHJXULGDGHVWHSURGXFWRQRVHSXHGHLQVWDODUHQ
DUUHJORVGHJDELQHWHWDOHVFRPRXQDLVODRSHQtQVXOD6H
GHEHPRQWDU7$172DXQJDELQHWHVXSHULRU&202D
XQDSDUHG
$'9(57(1&,$
35(&$8&,Ï1
5LHVJRGH'HVFDUJD
(OpFWULFD3XHGHRFDVLRQDUOHVLRQHVRODPXHUWH(67(
(/(&752'20e67,&26('(%(&21(&7$5$7,(55$'(
)250$&255(&7$DILQGHHYLWDUGHVFDUJDVVHYHUDVR
PRUWDOHV
$ILQGHHYLWDUHOULHVJR
GHOHVLyQSHUVRQDOOHVLyQHQODHVSDOGDXRWUDVOHVLRQHV
GHELGRDSHVRH[FHVLYRGHOKRUQRGHPLFURRQGDVR
GDxRVVREUHHOSURGXFWRGHEHUiFRQWDUFRQODD\XGDGH
GRVSHUVRQDVSDUDLQVWDODUHVWHKRUQRGHPLFURRQGDV
0RGHORVGH9
$VHJ~UHVHGH
FRQWDUFRQXQD
FRQH[LyQD
WLHUUDDGHFXDGD
DQWHVGHXVDU
5(48,6,726(/e&75,&26
(OFDEOHGHFRUULHQWHGHHVWH
HOHFWURGRPpVWLFRFRQWLHQH
XQHQFKXIHGHSDWDV
FRQH[LyQDWLHUUDTXHVH
FRQHFWDDXQWRPDFRUULHQWH
GHSDUHGHVWiQGDUGH
FDEOHVFRQH[LyQDWLHUUD
SDUDPLQLPL]DUODSRVLELOLGDG
GHULHVJRVGHGHVFDUJDV
HOpFWULFDVSRUSDUWHGHO
PLVPR
0RGHORVGH9
/DFODVLILFDFLyQGHOSURGXFWRHVGHYDWLRV&$$&
KHUW]DPSHULRV\NLORYDWLRV(VWHSURGXFWR
GHEHHVWDUFRQHFWDGRDXQFLUFXLWRGHVXPLQLVWURGHO
YROWDMH\IUHFXHQFLDDSURSLDGRV(OWDPDxRGHODODPEUH
GHEHFRQIRUPDUVHDORVUHTXLVLWRVGHO1DWLRQDO(OHFWULF
&RGHRDOFyGLJRORFDOHQHIHFWRSDUDHVWHtQGLFH
GHNLORYDWLRV(OFDEOHHOpFWULFRGHDOLPHQWDFLyQ\HO
LQWHUUXSWRUGHEHUiQOOHYDUVHDXQWRPDFRUULHQWH~QLFR
FRQHFWDGRDWLHUUDGHDDPSHULRV/DFDMDGHO
WRPDFRUULHQWHGHEHUiHVWDUORFDOL]DGDHQHOJDELQHWH
HQFLPDGHOKRUQR/DFDMDGHOWRPDFRUULHQWHGHEH
VHULQVWDODGDSRUXQHOHFWULFLVWDFDOLILFDGR\GHEH
FRQIRUPDUVHDO1DWLRQDO(OHFWULFDO&RGHRDOFyGLJR
ORFDOHQHIHFWR
,QVWUXFFLRQHVGHLQVWDODFLyQ
&$03$1$'((6&$3(
127$/HDODVVLJXLHQWHVGRVSiJLQDVVRODPHQWHVLSODQHDYHQWLODUHOHVFDSHKDFLDHOH[WHULRU
6LSRUHOFRQWUDULRSODQHDUHFLUFXODUHODLUHGHYXHOWDKDFLDHOVDOyQFRQWLQ~HHQODSiJLQD
(6&$3(683(5,25(;7(512(-(03/262/$0(17(
/DVLJXLHQWHWDEODGHVFULEHXQHMHPSORGHXQDSRVLEOH
LQVWDODFLyQGHUHGGHFRQGXFWRV
3$57(6'(/&21'8&72
/21*,78'
(48,9$/(17(
[
1Ò0(52
86$'2 SLHV [
SLHV [
[
7DSDGHOWHFKR &RQGXFWRUHFWRGH
SLHVUHGRQGRGHs
$GDSWDGRUGHWUDQVLFLyQ SLHV GHUHFWiQJXORDUHGRQGR
/21*,78'
(48,9$/(17(
SLHV SLHV SLHV SLHV
/DORQJLWXGGHODVSDUWHVGHORVFRQGXFWRVHTXLYDOHQWHVHVWiEDVDGDHQSUXHEDVUHDOHV\
UHÀHMDQORVUHTXLVLWRVSDUDORJUDUXQDEXHQDYHQWLODFLyQFRQFXDOTXLHUFDPSDQDGHHVFDSH
/RQJLWXGWRWDO
,03257$17(6LVHXVDXQDGDSWDGRUGHWUDQVLFLyQGHUHFWiQJXORDUHGRQGRODVHVTXLQDVGHOIRQGR
GHOUHJXODGRUGHWLURVGHEHUiQFRUWDUVHSDUDTXHHQFDMHQXVDQGRODVWLMHUDVGHFRUWHSDUDSHUPLWLU
HOPRYLPLHQWROLEUHGHOUHJXODGRUGHWLURV
(6&$3(3267(5,25(;7(512(-(03/262/$0(17(
/DVLJXLHQWHWDEODGHVFULEHXQHMHPSORGHXQDSRVLEOH
LQVWDODFLyQGHUHGGHFRQGXFWRV
3$57(6'(/&21'8&72
7DSDGHSDUHG &RQGXFWRUHFWRGH
SLHVUHFWDQJXODUGH
øs[s
/21*,78'
(48,9$/(17(
[
1Ò0(52
86$'2 SLHV [
SLHV [
/21*,78'
(48,9$/(17(
SLHV
SLHV &RGRGHƒ
SLHV [
/DORQJLWXGGHODVSDUWHVGHORVFRQGXFWRVHTXLYDOHQWHVHVWiEDVDGDHQSUXHEDVUHDOHV\
UHÀHMDQORVUHTXLVLWRVSDUDORJUDUXQDEXHQDYHQWLODFLyQFRQFXDOTXLHUFDPSDQD
GHHVFDSH
/RQJLWXGWRWDO SLHV SLHV
127$3DUDHOHVFDSHSRVWHULRUVHGHEHWHQHUFXLGDGRDODOLQHDUHOHVFDSHHQWUHORVHVSDFLRVGHORVSRVWHVGHYLJDGHODSDUHGRODSDUHGGHEHUtDVHU
SUHSDUDGDHQHOPRPHQWRGHVXFRQVWUXFFLyQGHMDQGRVX¿FLHQWHHVSDFLRHQWUHORVSRVWHVGHYLJDGHODSDUHGSDUDDFRPRGDUHOHVFDSH
,QVWUXFFLRQHVGHLQVWDODFLyQ
/RQJLWXGPi[LPDGHOFRQGXFWR
127$6LXVWHGQHFHVLWDLQVWDODUFRQGXFWRVWHQJDSHQGLHQWH
TXHODORQJLWXGWRWDOGHOFRQGXFWRUHFWDQJXODUGHøs[s
RHOFRQGXFWRUHGRQGRGHsGHGLiPHWURQRGHEH
VREUHSDVDUSLHVHTXLYDOHQWHV
/DYHQWLODFLyQH[WHUQDUHTXLHUHXQ&21'8&72'(&$03$1$
'((6&$3(/HDORVLJXLHQWHFXLGDGRVDPHQWH
127$(VLPSRUWDQWHTXHODYHQWLODFLyQVHDLQVWDODGDXVDQGR
ODUXWDPiVGLUHFWD\FRQODPHQRUFDQWLGDGGHFRGRVSRVLEOH
(VWRDVHJXUDODYHQWLODFLyQGHOHVFDSH\D\XGDDSUHYHQLU
EORTXHRV7DPELpQFHUFLyUHVHGHTXHHOUHJXODGRUGHWLUR
SHQGHOLEUHPHQWH\QDGDEORTXHDORVFRQGXFWRV
3DUDORJUDUXQPRYLPLHQWRVDWLVIDFWRULRGHODLUHOD
ORQJLWXGWRWDOGHOFRQGXFWRUHFWDQJXODUGHøs[s
RHOFRQGXFWRUHGRQGRGHsGHGLiPHWURQRGHEH
VREUHSDVDUSLHVHTXLYDOHQWHV
/RVFRGRVWUDQVLFLRQHVSDUHGHV\WDSDV
GHWHFKRHWFSUHVHQWDQUHVLVWHQFLDDGLFLRQDODOÀXMR
GHDLUH\VRQHTXLYDOHQWHVDXQDVHFFLyQGHFRQGXFWR
UHFWRHOFXDOHVPiVODUJRTXHVXWDPDxRItVLFRUHDO
&XDQGRFDOFXOHODORQJLWXGWRWDOGHOFRQGXFWRDJUHJXH
ODVORQJLWXGHVHTXLYDOHQWHVGHWRGDVODVWUDQVLFLRQHV
\DGDSWDGRUHVPiVODORQJLWXGGHWRGDVODVVHFFLRQHV
GHFRQGXFWRUHFWDV/DWDEODPiVDGHODQWHPXHVWUD
FyPRSXHGHFDOFXODUODORQJLWXGDSUR[LPDGDGHODUHG
GHFRQGXFWRVXVDQGRSLHVDSUR[LPDGRVGHORQJLWXGHV
HTXLYDOHQWHVGHDOJXQRVFRQGXFWRVWtSLFRV
&RQH[LRQHVGHHVFDSH
/DFDPSDQDGHHVFDSHKDVLGRGLVHxDGDSDUDHQFDMDUFRQ
XQFRQGXFWRUHFWDQJXODUGHøs[sHVWiQGDU
6LXQFRQGXFWRUHGRQGRHVQHFHVDULRVHGHEHXVDU
XQDGDSWDGRUGHWUDQVLFLyQGHUHFWDQJXODUDUHGRQGR
1RXVHXQFRQGXFWRPHQRUGHµGHGLiPHWUR
/21*,78'
(48,9$/(17(
[
1Ò0(52
86$'2 /21*,78'
(48,9$/(17(
SLHV [
SLHV
SLHV [
SLHV
SLHV [
SLHV
SLHV [
SLHV
SLHV [
SLHV
SLHV [
SLHV
SLHV [
SLHV
[
SLHV
3$57(6'(&21'8&72
$GDSWDGRUGHWUDQVLFLyQGH
UHFWiQJXORDUHGRQGR
7DSDGHSDUHG &RGRGHƒ
&RGRGHƒ
&RGRGHƒ
&RGRGHƒ
7DSDGHWHFKR &RQGXFWRUHFWRGHsUHGRQGR
RUHFWDQJXODUGHøs[s
SLHV ,03257$17(6LVHXVDXQDGDSWDGRUGHWUDQVLFLyQGH
UHFWiQJXORDUHGRQGRODVHVTXLQDVGHOIRQGRGHOUHJXODGRU
GHWLURVGHEHUiQVHUFRUWDGDVSDUDTXHHQFDMHQXVDQGR
ODVWLMHUDVGHFRUWHSDUDSHUPLWLUHOPRYLPLHQWROLEUHGHO
UHJXODGRUGHWLURV
/DORQJLWXGGHODVSDUWHVGHFRQGXFWRVHTXLYDOHQWHVHVWiEDVDGD
HQSUXHEDVUHDOHV\UHÀHMDQORVUHTXLVLWRVSDUDORJUDUXQDEXHQD
YHQWLODFLyQFRQFXDOTXLHUFDPSDQDGHHVFDSH
,QVWUXFFLRQHVGHLQVWDODFLyQ
3$57(6,1&/8,'$6
'$f26²(19Ë2
,167$/$&,Ï1
3$57(6$',&,21$/(6
‡6LODXQLGDGVHGDxDGXUDQWHHOHQYtRGHYXHOYD
ODXQLGDGDODOPDFpQGRQGHODDGTXLULySDUD
VXUHSDUDFLyQRUHHPSOD]R
‡6LHOFOLHQWHGDxDODXQLGDGODUHSDUDFLyQ
RHOUHHPSOD]RHVUHVSRQVDELOLGDGGHOFOLHQWH
‡6LHOLQVWDODGRUGDxDODXQLGDGVLQRHVHOFOLHQWH
ODUHSDUDFLyQRUHHPSOD]RVHGHEHKDFHUSRUPHGLR
GHXQDUUHJORHQWUHHOFOLHQWH\HOLQVWDODGRU
3$57(
3$48(7('((/(0(1726
&$17,'$'
7RUQLOORVGHPDGHUD
øs[s
7RUQLOORVEDVFXODQWHV \WXHUFDVGHPDULSRVD
øs[s
7RUQLOORVGHPiTXLQD DXWRDOLQHDEOHV
øs[øs
$UDQGHODDLVODQWHGH QLOyQSDUDJDELQHWHV
PHWiOLFRV
7RUQLOORVSDUDPHWDO
øs[øs
3ODQWLOODSDUD
HOJDELQHWH
VXSHULRU
3ODQWLOODSDUD
ODSDUHG SRVWHULRU ,QVWUXFFLRQHV
GHLQVWDODFLyQ
)LOWURVGH JUDVD
HPSDFDGRV
SRUVHSDUDGR
$GDSWDGRU
GHOHVFDSH
5HJXODGRU GHWLUR
3$57(6,1&/8,'$6
3$57(
&$17,'$'
QHJUR
GHEURQFH
8VWHGHQFRQWUDUiORVHOHPHQWRVGHLQVWDODFLyQHQ
XQSDTXHWHMXQWRFRQODXQLGDG,QVSHFFLRQHSDUD
FHUFLRUDUVHGHTXHWLHQHWRGDVODVSDUWHV
127$6HLQFOX\HQDOJXQDVSDUWHVDGLFLRQDOHV
≤
≤
≤
,QVWUXFFLRQHVGHLQVWDODFLyQ
+(55$0,(17$648(1(&(6,7$5È
'HVWRUQLOODGRUHVGH
HVWUHOOD\
7LMHUDVSDUDFRUWDUODWyQ
SDUDFRUWDUHOUHJXODGRU
GHWLURVLHVQHFHVDULR
5HJODUHFWD\FLQWD
PpWULFD
/iSL]
7LMHUDVSDUDFRUWDUOD
SODQWLOODVLHVQHFHVDULR
7DODGURHOpFWULFRFRQEURFDV
GHøsøsøs\øs
*XDQWHV
'HWHFWRUGH
SRVWHVGHYLJDR
6LHUUDGHVDEOHDJXMHURRGH
RMRGHFHUUDGXUD
*DIDVGHVHJXULGDG
1LYHO
(VFXDGUDGH
FDUSLQWHUR
RSFLRQDO
%ORTXHVGHUHOOHQRR
SHGD]RVGHPDGHUDVLVRQ
QHFHVDULRVSDUDUHOOHQDU
HOJDELQHWHXVDGRV
VRODPHQWHHQODLQVWDODFLyQ
GHJDELQHWHVDSR\DGRV
XQPDUWLOOR
RSFLRQDO
&LQWDGHFRQGXFWRVRFLQWD
DGKHVLYDSURWHFWRUD
(63$&,2'(0217$-(
sPD[
øs
127$6
s
s
sRPiV
GHVGHHO
SLVRKDVWD
ODSDUWH
VXSHULRU
GHOKRUQR
s
PLQ
(OH[WUHPRGHO ‡(OHVSDFLRHQWUHORVJDELQHWHVGHEHVHUGHs
IRQGRGHOJDELQHWH GHDQFKR\GHEHHVWDUOLEUHGHREVWUXFFLRQHV
QHFHVLWDHVWDUD ‡6LHOHVSDFLRHQWUHORVJDELQHWHVHVPD\RUGH
sRPiVDSDUWLU sXQ´)LOOHU3DQHO.LWµSRGUtDVHUQHFHVDULRSDUD
GHODVXSHU¿FLHGH UHOOHQDUODVEUHFKDVHQWUHHOKRUQR\ORVJDELQHWHV
ODHVWXID
6X0DQXDOGHO3URSLHWDULRFRQWLHQHHOQ~PHURGH
3URWHFWRUSRVWHULRU
GHVDOSLFDGXUDV
NLWSDUDVXPRGHOR
‡(VWHKRUQRHVSDUDVHULQVWDODGRSRUHQFLPDGH
HVWXIDVKDVWDsGHDQFKR
‡6LXVWHGVHGLVSRQHDYHQWLODUVXKRUQRKDFLDHO
H[WHULRUYHUOD6HFFLyQGH&DPSDQDGH(VFDSH
SDUDODSUHSDUDFLyQGHOFRQGXFWRGHHVFDSH
‡&XDQGRVHLQVWDOHHOKRUQRGHEDMRGHJDELQHWHV
GHIRQGRVOLVRV\SODQRVWHQJDFXLGDGRGHVHJXLU
FXLGDGRVDPHQWHODVLQVWUXFFLRQHVHQODSODQWLOOD
GHOJDELQHWHVXSHULRUSDUDHOHVSDFLRGHWROHUDQFLD
GHOFDEOHHOpFWULFR
‡/DSURIXQGLGDGGHOJDELQHWHSRUHQFLPD\DO
FRVWDGRGHODXQLGDGHVGHµ
‡3DUDPRGHORVFRQKR\RVGHYHQWLODFLyQVXSHULRUHV
1RSHUPLWDTXHHOJDELQHWHXRWURVREMHWRV
EORTXHHQHOÀXMRGHDLUHGHODYHQWLODFLyQ
‡(OSURGXFWRQRGHEHLQVWDODUVHVREUHQLQJXQD
HVWXIDRFRFLQDFRQXQDFRPELQDFLyQVXSHULRU
D%78
,QVWUXFFLRQHVGHLQVWDODFLyQ
&Ï02&2/2&$5(/3/$72'(0217$-(
$ &Ï025(029(5(/+2512
'(/(0%$/$-(&Ï025(029(5
(/3/$72'(0217$-(
% &Ï02(1&2175$5/263267(6
'(9,*$(1/$3$5('
5HPXHYDODFDMDTXHFRQWLHQHODVLQVWUXFFLRQHV
GHLQVWDODFLyQORV¿OWURVHODGDSWDGRUGHHVFDSH
HOUHJXODGRUGHWLUR\ODSHTXHxDEROVDFRQORV
HOHPHQWRVGHLQVWDODFLyQ1RUHPXHYDODHVSXPD
GHSROLHVWLUHQRTXHSURWHJHHOIUHQWHGHOKRUQR
3RVWHVGHYLJD
HQODSDUHG
3OLHJXHKDFLDDWUiVODVDODVGHODFDMD/XHJR
FXLGDGRVDPHQWHUXHGHHOKRUQRKDVWDTXHTXHGH
DSR\DGRVREUHODSDUWHVXSHULRU(OKRUQRGHEHUi
GHVFDQVDUVREUHODHVSXPDGHSROLHVWLUHQR
&HQWUR
&DMD
(QFXHQWUHORVSRVWHVXVDQGRXQRGHORV
PpWRGRVVLJXLHQWHV
$8VHXQGHWHFWRUGHSRVWHV²XQGLVSRVLWLYR
PDJQpWLFRTXHORFDOL]DFODYRV
2
%8VHXQPDUWLOORSDUDJROSHDUOLJHUDPHQWHDWUDYpV
GHODVXSHU¿FLHGHPRQWDMHKDVWDHQFRQWUDUXQ
VRQLGRVyOLGR(VWRLQGLFDUiTXHKD\XQSRVWHGH
YLJDHQHVHOXJDU
'HVSXpVGHORFDOL]DUHOSRVWHRORVSRVWHVGHYLJD
HQFXHQWUHHOFHQWURPHGLDQWHHODQiOLVLVGHODSDUHG
XVDQGRXQFODYRSHTXHxRSDUDGDUVHFXHQWDGH
GyQGHHVWiQORVERUGHVGHOSRVWH/XHJRFRORTXH
XQDPDUFDHQHOFHQWURGHORVERUGHV(OFHQWURGH
FXDOTXLHUSRVWHDG\DFHQWHGHEHUiVHUHQWUHsys
GHVGHHVWDPDUFD
7UDFHXQDOtQHDKDFLDDEDMRLQGLFDQGRHOFHQWUR
GHOSRVWH
,03257$17((OKRUQRGHPLFURRQGDVVHGHEHUi
FRQHFWDUDSRUORPHQRVXQPRQWDMHGHSDUHG
3ROLHVWLUHQR
7LUHGHODFDMDKDFLDDUULED\UHWtUHODGHOKRUQR
(OSODWRGHPRQWDMHHVWiSHJDGRDODSDUWHSRVWHULRU
GHOKRUQR5HPXHYDORVGRVWRUQLOORVTXHORVRVWLHQHQ
SHJDGRDOKRUQR(OSODWRVHUiXVDGRFRPRODSODQWLOOD
GHODSDUHGSRVWHULRU\SDUDPRQWDUHOKRUQRDOD
SDUHG
3DUHHOKRUQR5HPXHYD\GHVFDUWHGHPDQHUD
DSURSLDGDODVEROVDVSOiVWLFDV\HOSROLHVWLUHQR
$EUDODSXHUWDGHOKRUQR\UHPXHYDHOSDTXHWHGH
HVSXPDGHSROLHVWLUHQRGHOLQWHULRU5HPXHYDOD
FLQWDDGKHVLYDTXHFXEUHHODURJLUDWRULR
,QVWUXFFLRQHVGHLQVWDODFLyQ
&
&Ï02'(7(50,1$5/$/2&$/,=$&,Ï1'(/3/$72'(0217$-('(%$-2
'(68*$%,1(7(
3RVLFLyQGHOSODWR²GHEDMRGHJDELQHWHV
GHIRQGRDSR\DGRHQXQPDUFR
3RVLFLyQGHOSODWR²GHEDMRGHJDELQHWHV
GHIRQGRSODQR
/DVRUHMLOODVGHOSODWR
GHPRQWDMHWRFDQHO
IRQGRGHOJDELQHWH
/DVRUHMLOODVGHO
SODWRGHPRQWDMH
WRFDQHOPDUFR
SRVWHULRU
sKDVWDODHVWXID
3RUORPHQRVsKDVWDs
3RVLFLyQGHOSODWR²GHEDMRGHJDELQHWHV
GHIRQGRDSR\DGRFRQIUHQWHVDOLHQWH
6XVJDELQHWHVSRGUtDQWHQHUPDUFRVGHGHFRUDFLyQ
TXHLQWHU¿HUDQFRQODLQVWDODFLyQGHOKRUQR5HPXHYD
ORVPDUFRVGHFRUDWLYRVSDUDLQVWDODUHOKRUQR
DSURSLDGDPHQWH\SDUDKDFHUTXHTXHGHQLYHODGR
3ODWRGHPRQWDMH
FRQRUHMLOODVSRU
GHEDMRGHOIRQGR
(/+2512'(%(48('$51,9(/$'2
GHOJDELQHWHDOD
8VHXQQLYHOSDUDFHUFLRUDUVHGHTXHHOIRQGR
PLVPDGLVWDQFLD
TXHODSURIXQGLGDG GHOJDELQHWHHVWiQLYHODGR
GHOVDOLHQWH
6LORVJDELQHWHVWLHQHQXQVDOLHQWHIURQWDOVRODPHQWH
VLQPDUFRSRVWHULRURODWHUDOLQVWDOHHOSODWRGHPRQWDMH
DODPLVPDGLVWDQFLDGHODSURIXQGLGDGGHOVDOLHQWH
(VWHPDQWHQGUiHOKRUQRQLYHODGR
0LGDODSURIXQGLGDGLQWHUQDGHOIUHQWHGHOVDOLHQWH
7UDFHXQDOtQHDKRUL]RQWDOHQODSDUHGSRVWHULRU
DXQDGLVWDQFLDGHEDMRGHOIRQGRGHOJDELQHWHLJXDO
DODSURIXQGLGDGLQWHUQDGHOIUHQWHVDOLHQWH
3DUDHVWHWLSRGHLQVWDODFLyQFRQVDOLHQWHIURQWDO
VRODPHQWHDOLQHHODVRUHMLOODVGHPRQWDMHFRQODOtQHD
KRUL]RQWDOVLQWRFDUHOIRQGRGHOJDELQHWHFRPR
VHGHVFULELyHQHO3DVR'
sKDVWDODHVWXID
,QVWUXFFLRQHVGHLQVWDODFLyQ
' &Ï02$/,1($5(/3/$72'(0217$-(62%5(/$3$5('
$JXMHUR%
7UDFHXQDOtQHD
YHUWLFDOHQOD
SDUHGDSDUWLUGHO
FHQWURGHOJDELQHWH
VXSHULRU
$JXMHUR$
$JXMHUR&
$JXMHUR'
$UHD(
35(&$8&,Ï1
8VHJXDQWHVGHSURWHFFLyQ
SDUDHYLWDUFRUWDGXUDVHQVXV
GHGRVFRQORVH[WUHPRV¿ORVRV
7UDFHXQDOtQHDYHUWLFDOHQODSDUHGHQHOFHQWUR
GHOHVSDFLRGHsGHDQFKR
8VHHOSODWRGHPRQWDMHFRPRODSODQWLOODSDUDODSDUHG
SRVWHULRU&RORTXHHOSODWRGHPRQWDMHHQODSDUHG
FHUFLRUiQGRVHGHTXHODVRUHMLOODVVHHQFXHQWUDQWRFDQGR
HOIRQGRGHOJDELQHWHRODOtQHDPDUFDGDHQHO3DVR&
SDUDORVJDELQHWHVFRQVDOLHQWHVIURQWDOHV$OLQHH
ODPXHVFD\OtQHDGHOFHQWURHQHOSODWRGHPRQWDMH
FRQODOtQHDGHFHQWURHQODSDUHG
0LHQWUDVVRVWLHQHHOSODWRGHPRQWDMHFRQXQDPDQR
WUDFHFtUFXORVHQODSDUHGHQORVDJXMHURV$%&\'
YHUODLOXVWUDFLyQDQWHULRUODSODFDUHDOHVWiPDUFDGD
FRQÀHFKDV'HEHQXVDUVHFXDWURDJXMHURVSDUD
HOPRQWDMH
127$/RVDJXMHURV&\'YDQHQHOLQWHULRUGHOiUHD(
6LQLHO&QLHO'HVWiQHQXQSRVWHGHYLJDHQFXHQWUH
XQSRVWHHQDOJ~QRWUROXJDUHQHOiUHD(\PDUTXH
XQTXLQWRFtUFXORSDUDDOLQHDUVHFRQHOSRVWH
(VLPSRUWDQWHXVDUSRUORPHQRVXQWRUQLOORGHPDGHUD
PRQWDGR¿UPHPHQWHHQXQSRVWHSDUDDSR\DUHOSHVR
GHOKRUQR
$SDUWHHOSODWRGHPRQWDMH
$'9(57(1&,$
5LHVJRGHGHVFDUJD
HOpFWULFD3XHGHSURYRFDUOHVLRQHVRODPXHUWH7HQJD
FXLGDGRGHQRSHUIRUDUHOFDEOHDGRHOpFWULFRXELFDGR
GHQWURGHODVSDUHGHVRJDELQHWHV
3HUIRUHDJXMHURVHQORVFtUFXORV6LKD\XQSRVWHGH
YLJDSHUIRUHXQDJXMHURGHsSDUDORVWRUQLOORVGH
PDGHUD3DUDORVDJXMHURVTXHQRTXHGDURQDOLQHDGRV
FRQHOSRVWHGHYLJDSHUIRUHXQDJXMHURGHsSDUD
ORVWRUQLOORVEDVFXODQWHV
127$72'$9Ë$120217((/3/$72
,QVWUXFFLRQHVGHLQVWDODFLyQ
7,326'(,167$/$&,Ï1(VFRMD$%R&
(VWHKRUQRHVWiGLVHxDGRSDUDDGDSWDUVHDORVVLJXLHQWHV
WUHVWLSRVGHYHQWLODFLyQ
$(VFDSHVXSHULRUH[WHULRU&RQGXFWRYHUWLFDO
%(VFDSHSRVWHULRUH[WHULRU&RQGXFWRKRUL]RQWDO
&5HFLUFXODFLyQ6LQFRQGXFWRGHYHQWLODFLyQ
$
127$(VWHKRUQRHVHQYLDGR\DHQVDPEODGRSDUDXQHVFDSH
VXSHULRUH[WHULRU6HOHFFLRQHHOWLSRGHYHQWLODFLyQUHTXHULGR
SDUDVXLQVWDODFLyQ\SURFHGDDWDOVHFFLyQ
(6&$3(683(5,25(;7(5,25
&21'8&729(57,&$/
%
(6&$3(3267(5,25(;7(5,25
&21'8&72+25,=217$/
(ODGDSWDGRUHVWi
HQVXOXJDUSDUD
HOHVFDSHVXSHULRU
H[WHULRU
9HUSiJLQD
9HUSiJLQD
&
5(&,5&8/$&,Ï1
6,1&21'8&72'(9(17,/$&,Ï1
8Q.LWGHDFFHVRULRVGH¿OWUR
GHFDUERQLOODHVQHFHVDULR
SDUDHOVLVWHPDVLQYHQWLODFLyQ
&RQVXOWHVX0DQXDOGHO
3URSLHWDULRSDUDREWHQHU
HOQ~PHURGHONLW
9HUSiJLQD
,QVWUXFFLRQHVGHLQVWDODFLyQ
$ (6&$3(683(5,25(;7(5,25&RQGXFWRYHUWLFDO
3(563(&7,9$*(1(5$/
'(/$,167$/$&,Ï1
$&RPRDGKHULUHOSODWRGHPRQWDMH
DODSDUHG
$3UHSDUHHOJDELQHWHVXSHULRU
$,QVWDOHHODGDSWDGRU
$0RQWHHOKRUQR
$$MXVWHHODGDSWDGRU
GHHVFDSH
$&RQHFWHHOFRQGXFWR
Ï02$'+(5,5/$3/$&$
$ &
'(0217$-($/$3$5('
3DUDXVDUORVWRUQLOORVEDVFXODQWHV
%
$
3ODWRGH
PRQWDMH
(VSDFLDGRUHVSDUDORV
EDVFXODQWHVPD\RUHV
TXHHODQFKRGHODSDUHG
$ODVGHPDULSRVD
7RUQLOORGH
PDULSRVD
3DUHG
&
'
([WUHPRGHOWRUQLOOR
&RORTXHHOSODWRGHPRQWDMHFRQWUDODSDUHGHLQVHUWH
ODVDODVGHPDULSRVDHQORVDJXMHURVGHODSDUHGSDUD
PRQWDUHOSODWR
127$$QWHVGHDSUHWDUORVWRUQLOORVEDVFXODQWHV
\ORVWRUQLOORVGHPDGHUDFHUFLyUHVHGHTXHODVRUHMLOODV
HQHOSODWRGHPRQWDMHWRTXHQHOIRQGRGHOJDELQHWH
FXDQGRVRQHPSXMDGDVFRQWUDODSDUHG\GHTXHHOSODWR
HVWpFHQWUDGRDSURSLDGDPHQWHGHEDMRGHOJDELQHWH
3HJXHHOSODWRDODSDUHGXVDQGRORVWRUQLOORV
EDVFXODQWHV3RUORPHQRVXQWRUQLOORGHPDGHUDGHEH
VHUXVDGRSDUDSHJDUHOSODWRDOSRVWHGHODSDUHG/DV
XELFDFLRQHVUHFRPHQGDGDVVREUHODSODFDGHPRQWDMH
VHLQGLFDQHQ$%&\'
5HPXHYDODVPDULSRVDVGHOEDVFXODQWHGHORV
WRUQLOORV
,QVHUWHORVWRUQLOORVHQHOSODWRGHPRQWDMHDWUDYpV
GHORVDJXMHURVGLVHxDGRVSDUDVHULQVHUWDGRVHQ
ODSDUHGGHPDPSRVWHUtDVHFD\SHJXHRWUDYH]
ODVPDULSRVDVGHøsHQFDGDWRUQLOOR
35(&$8&,Ï1
7HQJDFXLGDGRGHHYLWDU
SHOOL]FDUVXVGHGRVHQWUHODSDUWHSRVWHULRUGHOSODWR
GHPRQWDMH\ODSDUHG
$SULHWHWRGRVORVWRUQLOORV7LUHGHOSODWR
HQGLUHFFLyQRSXHVWDDODSDUHGSDUDD\XGDU
DDSUHWDUORVWRUQLOORV
,QVWUXFFLRQHVGHLQVWDODFLyQ
6(/$3/$17,//$'(/*$%,1(7(
$ 8
683(5,253$5$/$35(3$5$&,Ï1
'(/*$%,1(7(683(5,25
$ &Ï020217$5(/+2512
'HEHUiSHUIRUDUDJXMHURVSDUDORVWRUQLOORVGHDSR\R
VXSHULRUHVXQDJXMHURVX¿FLHQWHPHQWHJUDQGHSDUDTXH
HOFDEOHHOpFWULFRTXHSD\XQUHFRUWHORVX¿FLHQWHPHQWH
JUDQGHFRPRSDUDTXHHODGDSWDGRUGHHVFDSHSXHGD
VHULQWURGXFLGR
35(&$8&,Ï1
$¿QGHHYLWDUHO
ULHVJRGHOHVLyQSHUVRQDOOHVLyQHQODHVSDOGDX
RWUDVOHVLRQHVGHELGRDSHVRH[FHVLYRGHOKRUQR
GHPLFURRQGDVRGDxRVVREUHHOSURGXFWR
GHEHUiFRQWDUFRQODD\XGDGHGRVSHUVRQDV
SDUDLQVWDODUHVWHKRUQRGHPLFURRQGDV
,03257$17(1RWRPHQLXVHODPDQLMDGXUDQWHOD
LQVWDODFLyQ
$'9(57(1&,$
5LHVJRGH
'HVFDUJD(OpFWULFD3XHGHRFDVLRQDUOHVLRQHVROD
PXHUWHVLLQVWDODODXQLGDGFRQHQFLPHURVGHPHWDO
FXEUDHODJXMHURGHOH[WUHPRGHOFDEOHGHVXPLQLVWUR
GHFRUULHQWHFRQDLVODQWHSDUDHOFDEOHGHOVXPLQLVWUR
GHFRUULHQWH
‡ /HDODVLQVWUXFFLRQHVVREUHOD3/$17,//$
'(/*$%,1(7(683(5,25
‡ 3pJXHORGHEDMRGHOJDELQHWHVXSHULRU
‡ 7DODGUHORVDJXMHURVVLJXLHQGRODVLQVWUXFFLRQHV
HQOD3/$17,//$'(/*$%,1(7(683(5,25
,03257$17(6LQRVHXVDQEORTXHDGRUHVGH¿OWUR
VHSRGUiQSURGXFLUGDxRVHQODFDMDGHELGRDODMXVWH
H[FHVLYRGHORVWRUQLOORV
35(&$8&,Ï1
8VHJDIDVGHVHJXULGDG
FXDQGRSHUIRUHORVDJXMHURVHQHOIRQGRGHOJDELQHWH
127$&XDQGRVHHQFXHQWUH
PRQWDQGRHOKRUQRHQURVTXH
HOFDEOHHOpFWULFRDWUDYpV
GHODJXMHURHQHOIRQGR
GHOJDELQHWHVXSHULRU
0DQWpQJDORWHQVRDWUDYpVGH
ORV3DVRVGHO²1RSHOOL]TXH /HYDQWHHOKRUQRLQFOtQHOR
HOFDEOHQLWLUHGHOKRUQRSRU
KDFLDDGHODQWH\HQJDQFKH
HOFDEOH
ODVUDQXUDVHQHOH[WUHPR
LQIHULRUSRVWHULRUHQGRV
RUHMLOODVLQIHULRUHVGHOSODWR
GHPRQWDMH
16$0%/$-((,167$/$&,Ï1
$ (
'(/$'$37$'25
5HJXODGRUGH
WLUR
$GDSWDGRU
GHHVFDSH
3ODWRGHO
FDOHIDFWRU
3DUWH
SRVWHULRU
GHOKRUQR
&RORTXHHOKRUQRHQVXSRVLFLyQYHUWLFDOFRQODSDUWH
VXSHULRUKDFLDDUULED
,QVHUWHODVRUHMLOODVHQFDGDODGRGHOUHJXODGRUGHWLUR
HQORVDJXMHURVHQHOLQWHULRUSRVWHULRUGHODGDSWDGRU
3HJXHHODGDSWDGRUGHHVFDSHDOSODWRFDOHIDFWRUFRQ
ORVGRVWRUQLOORVGHEURQFHTXHOHSURSRUFLRQDPRV
&HUFLyUHVHGHTXHHOUHJXODGRUGHWLURJLUD
IiFLOPHQWHDQWHVGHPRQWDUHOKRUQR
'HEHUiKDFHUDMXVWHVSDUDDVHJXUDUVHGHTXHH[LVWH
DOLQHDFLyQDSURSLDGDFRQHOVLVWHPDGHFRQGXFWRV
GHVXFDVDGHVSXpVGHODLQVWDODFLyQGHOKRUQR
*LUHHOIUHQWHGHOKRUQRFRQWUD
HOIRQGRGHOJDELQHWH
,QVHUWHXQWRUQLOORGHDXWRDOLQHDFLyQDWUDYpVGHO
DJXMHURFHQWUDOVXSHULRUGHOJDELQHWH$VHJXUHHOKRUQR
WHPSRUDOPHQWHJLUDQGRHOWRUQLOORSRUORPHQRVGRV
YXHOWDVFRPSOHWDVGHVSXpVGHTXHODVURVFDVKD\DQ
DJDUUDGR/XHJRTXHGDUiQWRWDOPHQWHDSUHWDGDV
,QVWUXFFLRQHVGHLQVWDODFLyQ
$ &Ï020217$5(/+2512
$ &Ï02$-867$5(/$'$37$'25
'((6&$3(
FRQWLQXDFLyQ
3HJXHHOKRUQRDODSDUWHVXSHULRUGHOJDELQHWH
$EUDHOJDELQHWHVXSHULRU\DMXVWHHODGDSWDGRU
GHHVFDSHSDUDFRQHFWDUORDOFRQGXFWRGHODFDVD
,QVHUWHWRUQLOORVøs[ȓs
5HJXODGRUGHWLUR
DXWRDOLQHDEOHVDWUDYpVGHORVDJXMHURV
H[WHULRUHVVXSHULRUHVGHOKRUQR*LUH
GRVYXHOWDVFRPSOHWDVHQFDGDWRUQLOOR
3DUWH
SRVWHULRU
GHOKRUQR
$ &Ï02&21(&7$5(/&21'8&72
&RQGXFWRGHODFDVD
$SULHWHHOWRUQLOORGHOFHQWUR
FRPSOHWDPHQWH
)UHQWHGHOJDELQHWH
(VWDQWHGHOIRQGRGHOJDELQHWH
%ORTXHGHUHOOHQR
(TXLYDOHQWHD
ODSURIXQGLGDG
GHOUHWURFHVR
GHOJDELQHWH
(VWDGLVWDQFLD12
SXHGHVXSHUDUODV
µSDUDDVHJXUDU
XQDLQVWDODFLyQ
DGHFXDGD
7RUQLOORDXWRDOLQHDEOH
([WLHQGDHOFRQGXFWRGHODFDVDKDFLDDEDMRSDUD
FRQHFWDUORFRQHODGDSWDGRUGHHVFDSH
6HOOHODVMXQWDVGHOFRQGXFWRGHHVFDSHXVDQGR
FLQWDDGKHVLYDGHFRQGXFWRV
3DUWHVXSHULRUGHOKRUQR
$SULHWHORVGRVWRUQLOORVH[WHULRUHVKDFLDODSDUWH
GHDUULEDGHOKRUQR0LHQWUDVDSULHWDORVWRUQLOORV
PDQWHQJDHOKRUQRHQVXOXJDUFRQWUDODSDUHG
\HOJDELQHWHVXSHULRU
,QVWDOHORV¿OWURVGHJUDVD9HUHO0DQXDOGHO3URSLHWDULRTXH
YLHQHFRQHOKRUQR
,QVWUXFFLRQHVGHLQVWDODFLyQ
% (6&$3(3267(5,25(;7(512&RQGXFWRKRUL]RQWDO
3(563(&7,9$*(1(5$/
'(/$,167$/$&,Ï1
%3UHSDUHODSDUHGSRVWHULRU
%3HJXHHOSODWRGHPRQWDMH
DODSDUHG
%3UHSDUHHOJDELQHWHVXSHULRU
%$MXVWHHOFDOHIDFWRU
%0RQWHHOKRUQR
% &Ï02$'+(5,5(/3/$72
'(0217$-($/$3$5('
Ï0235(3$5$5/$3$5('
% &
3267(5,253$5$(/(6&$3(
3267(5,25(;7(5,25
1HFHVLWDFRUWDUXQDDEHUWXUDHQODSDUHGSRVWHULRUSDUD
HOHVFDSHH[WHULRU
3HJXHHOSODWRDODSDUHGXVDQGRORVWRUQLOORVEDVFXODQWHV
3RUORPHQRVXQWRUQLOORGHPDGHUDGHEHVHUXVDGRSDUD
SHJDUHOSODWRDOSRVWHGHYLJDGHODSDUHG
5HPXHYDODVPDULSRVDVGHORVWRUQLOORV
,QVHUWHORVWRUQLOORVHQHOSODWRGHPRQWDMHDWUDYpV
GHORVDJXMHURVGLVHxDGRVSDUDFRORFDUVHFRQWUD
ODSDUHGGHPDPSRVWHUtDVHFD\SHJXHRWUDYH]
ODVPDULSRVDVGHøsDFDGDWRUQLOOR
‡ /HDODVLQVWUXFFLRQHVHQOD3/$17,//$3$5$
/$3$5('3267(5,25
‡ 3pJXHODFRQFLQWDDGKHVLYDDODSDUHGSRVWHULRU
DOLQHiQGRODFRQORVDJXMHURVSUHYLDPHQWHSHUIRUDGRV
SDUDORVDJXMHURV$\%HQHOSODWRGHODSDUHG
‡ &RUWHODDSHUWXUDVLJXLHQGRODVLQVWUXFFLRQHV
GHOD3/$17,//$3$5$/$3$5('3267(5,25
,QVWUXFFLRQHVGHLQVWDODFLyQ
3DUDXVDUORVWRUQLOORVEDVFXODQWHV
3ODWRGH
PRQWDMH
Ï02$'$37$5(/&$/()$&725
% &
3$5$(/(6&$3(3267(5,25(;7(5,25
(VSDFLDGRUHVSDUDORVEDVFXODQWHV
PD\RUHVTXHHODQFKRGHODSDUHG
$ODVGHPDULSRVD
7RUQLOORGH
PDULSRVD
3DUHG
5HPXHYD\JXDUGHORVWRUQLOORVTXHVRVWLHQHQ
HOSODWRGHOFDOHIDFWRUHQHOKRUQR'HVOLFHHOSODWR
GHOFDOHIDFWRUGHDEDMRGHVXUHERUGHGHUHWHQFLyQ
5HPXHYD\JXDUGHORVWRUQLOORVTXHVRVWLHQHQHOPRWRU
GHOFDOHIDFWRUHQHOKRUQR
5HERUGHGH
UHWHQFLyQ
([WUHPRGHOWRUQLOOR
&RORTXHHOSODWRGHPRQWDMHFRQWUDODSDUHG
HLQVHUWHODVDODVGHPDULSRVDHQORVDJXMHURV
GHODSDUHGSDUDPRQWDUHOSODWR
127$$QWHVGHDSUHWDUORVWRUQLOORVEDVFXODQWHV
\HOWRUQLOORGHPDGHUDFHUFLyUHVHGHTXHODVRUHMLOODV
HQHOSODWRGHPRQWDMHWRTXHQHOIRQGRGHOJDELQHWH
FXDQGRVHHPSXMHQFRQWUDODSDUHG\GHTXHHOSODWR
HVWpFHQWUDGRDSURSLDGDPHQWHGHEDMRGHOJDELQHWH
3ODWR
FDOHIDFWRU
7RUQLOORGHOPRWRU
GHOFDOHIDFWRU
&XLGDGRVDPHQWHWLUHGHOFDOHIDFWRU/RVDODPEUHV
VHH[WHQGHUiQORVX¿FLHQWHFRPRSDUDSHUPLWLUOH
TXHXVWHGDMXVWHODXQLGDGGHOFDOHIDFWRU
35(&$8&,Ï17HQJDFXLGDGRGHHYLWDU
$17(6/$6$%(5785$6'(
/$3$/(7$'(/9(17,/$'25
(67È125,(17$'$6
+$&,$$55,%$
SHOOL]FDUVXVGHGRVHQWUHODSDUWHSRVWHULRUGHOSODWR
GHPRQWDMH\ODSDUHG
$SULHWHWRGRVORVWRUQLOORV7LUHGHOSODWRHQGLUHFFLyQ
RSXHVWDDODSDUHGSDUDD\XGDUDDSUHWDUORVWRUQLOORV
([WUHPR%
([WUHPR$
6(/$3/$17,//$'(/*$%,1(7(
% 8
683(5,253$5$35(3$5$5
(/*$%,1(7(683(5,25
5RWHODXQLGDGƒHQVHQWLGRFRQWUDULR
DODVDJXMDVGHOUHORM
$QWHVGHODURWDFLyQ
'HVSXpVGHODURWDFLyQ
1HFHVLWDSHUIRUDUDJXMHURVSDUDORVWRUQLOORVGHDSR\R
VXSHULRUHV\XQDJXMHURVX¿FLHQWHPHQWHJUDQGHSDUD
TXHHOFDEOHHOpFWULFRTXHSD
3DUWHSRVWHULRU
GHOKRUQR
3DUWHSRVWHULRU
GHOKRUQR
6XDYHPHQWHUHPXHYDORVDODPEUHVGHODVUDQXUDV
5HGLULMDORVDODPEUHVDWUDYpVGHODVUDQXUDV
HQHORWURODGRGHODXQLGDGGHOFDOHIDFWRU
‡ /HDODVLQVWUXFFLRQHVVREUHOD3/$17,//$
'(/*$%,1(7(683(5,25
‡ 3pJXHODGHEDMRGHOJDELQHWHVXSHULRU
‡ 7DODGUHORVDJXMHURVVLJXLHQGRODVLQVWUXFFLRQHV
HQOD3/$17,//$'(/*$%,1(7(683(5,25
35(&$8&,Ï1
8VHJDIDVGHVHJXULGDG
FXDQGRSHUIRUHORVDJXMHURVHQHOIRQGRGHOJDELQHWH
$QWHVGHUHGLULJLUORV
'HVSXpVGHUHGLULJLUORV
$ODPEUHVGLULJLGRVDWUDYpV
GHOODGRGHUHFKR
$ODPEUHVGLULJLGRVDWUDYpV
GHOODGRL]TXLHUGR
,QVWUXFFLRQHVGHLQVWDODFLyQ
5XHGHODXQLGDGGHOFDOHIDFWRUžGHIRUPDWDO
TXHODVDEHUWXUDVGHODSDOHWDGHOYHQWLODGRUHVWpQ
RULHQWDGDVKDFLDODSDUWHSRVWHULRUGHOKRUQR
$QWHVGHODURWDFLyQ
&RORTXHHOSODWRFDOHIDFWRUHQODPLVPD
SRVLFLyQFRPRHVWDEDDQWHVFRQORVWRUQLOORV
7RUQLOORVGHOSODWRFDOHIDFWRU
3ODWRFDOHIDFWRU
'HVSXpV
GHODURWDFLyQ
3DUWH
SRVWHULRU
GHOKRUQR
3DUWH
SRVWHULRU
GHOKRUQR
,QVHUWHODVRUHMLOODVHQFDGDODGRGHOUHJXODGRU
GHWLURHQORVDJXMHURVHQHOODGRLQWHULRU
SRVWHULRUGHODGDSWDGRU
3DUWH
SRVWHULRU
GHOKRUQR
/RFDOLFHORVGRVSODWRVUHPRYLEOHVHQHOSDQHO
SRVWHULRUGHOKRUQRFHUFDGHODSDUWHVXSHULRU
GHOKRUQR
8VDQGRWLMHUDVFXLGDGRVDPHQWHFRUWHHOiUHD
GHWHODUDxDGHORVGRVDJXMHURVODGRDODGR
TXHDVHJXUDQORVSODWRVUHPRYLEOHVDOKRUQR
&RUWHODVFXDWURWHODUDxDVHQDPERVSODWRV
UHPRYLEOHVSRVWHULRUHVHVWRSHUPLWLUiTXHHO
ÀXMRGHDLUHGHOYHQWLODGRUHVFDSHKDFLDODSDUWH
SRVWHULRUGHOKRUQR
$GDSWDGRU
GHHVFDSH
3HJXHHODGDSWDGRUGHHVFDSHDODSDUWHSRVWHULRU
GHOKRUQRGHVOL]iQGRORHQODVJXtDVHQODSDUWH
VXSHULRUFHQWUDOGHODSDUWHSRVWHULRUGHOKRUQR
35(&$8&,Ï1
&HUFLyUHVHGH
UHFRUWDUORVH[WUHPRV¿ORVRVGHODVDEHUWXUDV
GHVSXpVGHUHPRYHUORVSODWRV
3DUWHSRVWHULRUGHOKRUQR
&RUWHFRQWLMHUDVODV
FXDWURWHODUDxDVGH
FDGDSDQHOUHPRYLEOH
\UHPXHYDORVGLVFRV
UHPRYLEOHVGHPHWDO
SDUDSHUPLWLUHOÀXMR
GHDLUHSRVWHULRU
3DUWH
SRVWHULRU
GHOKRUQR
2UHMLOODV
GHFLHUUH
7RUQLOORV
(PSXMH¿UPHPHQWHKDVWDTXHHVWpHQODVRUHMLOODV
GHFLHUUHLQIHULRUHV7DQJDFXLGDGRGHDVHJXUDUVH
GHTXHODELVDJUDGHOUHJXODGRUGHWLURHVWp
LQVWDODGDGHIRUPDTXHHVWpHQODSDUWHVXSHULRU
\TXHHOUHJXODGRUGHWLURJLUHOLEUHPHQWH
'(638(6/$6$%(5785$6'(/$3$/(7$'(/
9(17,/$'25(67È125,(17$'$6+$&,$$75È6
([WUHPR$
$VHJXUHHODGDSWDGRUGHHVFDSHDOKRUQR
FRQORVGRVWRUQLOORVPHWiOLFRVGHEURQFH
TXHSURSRUFLRQDPRV
([WUHPR%
$'9(57(1&,$
([LVWHULHVJRGH
GHVFDUJDVHOpFWULFDVTXHSXHGHQRFDVLRQDU
OHVLRQHVRODPXHUWH1RHPSXMHQLH[WLHQGDHO
FDEOHDGRGHODXQLGDGGHYHQWLODFLyQ$VHJ~UHVH
GHTXHORVFDEOHVQRSRVHDQFRUWHV
127$/DVDEHUWXUDVGHODVDOLGDGHODXQLGDGGH
YHQWLODFLyQGHEHQFRLQFLGLUFRQODVDEHUWXUDVGH
VDOLGDGHODSDUWHWUDVHUDGHOKRUQRGHPLFURRQGDV
'HVOLFHHO
DGDSWDGRUGH
HVFDSHHQODV
JXtDVGHOD
SDUWHSRVWHULRU
GHOKRUQR
*XtDV
&RORTXHODXQLGDGGHOFDOHIDFWRUGHQXHYR
HQODDEHUWXUD
5HJXODGRUGHWLUR
ELVDJUDKDFLD
DUULED
$GDSWDGRU
GHHVFDSH
,QVWUXFFLRQHVGHLQVWDODFLyQ
% &Ï020217$5(/+2512
)UHQWHGHOJDELQHWH
(VWDQWHGHOIRQGRGHOJDELQHWH
%ORTXHGHUHOOHQR
(TXLYDOHQWHD
ODSURIXQGLGDG
GHOUHWURFHVR
GHOJDELQHWH
35(&$8&,Ï1
$¿QGHHYLWDUHO
ULHVJRGHOHVLyQSHUVRQDOOHVLyQHQODHVSDOGDX
RWUDVOHVLRQHVGHELGRDSHVRH[FHVLYRGHOKRUQR
GHPLFURRQGDVRGDxRVVREUHHOSURGXFWR
GHEHUiFRQWDUFRQODD\XGDGHGRVSHUVRQDV
SDUDLQVWDODUHVWHKRUQRGHPLFURRQGDV
(VWDGLVWDQFLD12
SXHGHVXSHUDUODV
µSDUDDVHJXUDU
XQDLQVWDODFLyQ
DGHFXDGD
7RUQLOORDXWRDOLQHDEOH
3DUWHVXSHULRUGHOKRUQR
,03257$17(1RWRPHQLXVHODPDQLMDGXUDQWHOD
LQVWDODFLyQ
3HJXHHOKRUQRDODSDUWHVXSHULRUGHOJDELQHWH
$'9(57(1&,$
5LHVJRGH
'HVFDUJD(OpFWULFD3XHGHRFDVLRQDUOHVLRQHVROD
PXHUWHVLLQVWDODODXQLGDGFRQHQFLPHURVGHPHWDO
FXEUDHODJXMHURGHOH[WUHPRGHOFDEOHGHVXPLQLVWUR
GHFRUULHQWHFRQDLVODQWHSDUDHOFDEOHGHOVXPLQLVWUR
GHFRUULHQWH
,QVHUWHWRUQLOORVøs[ȓs
DXWRDOLQHDEOHVDWUDYpVGHORVDJXMHURV
H[WHULRUHVGHOKRUQR*LUHGRVYXHOWDV
FRPSOHWDVHQFDGDWRUQLOOR
,03257$17(6LQRVHXVDQEORTXHDGRUHVGH¿OWUR
VHSRGUiQSURGXFLUGDxRVHQODFDMDGHELGRDODMXVWH
H[FHVLYRGHORVWRUQLOORV
127$&XDQGRVHHQFXHQWUH
PRQWDQGRHOKRUQRHQURVTXH
HOFDEOHHOpFWULFRDWUDYpV
GHODJXMHURHQHOIRQGR
GHOJDELQHWHVXSHULRU
0DQWpQJDORWHQVRDWUDYpVGH
ORV3DVRVGHO²1RSHOOL]TXH /HYDQWHHOKRUQRLQFOtQHOR
HOFDEOHQLWLUHGHOKRUQRSRU
KDFLDDGHODQWH\HQJDQFKH
HOFDEOH
ODVUDQXUDVHQHOH[WUHPR
LQIHULRUSRVWHULRUHQGRV
RUHMLOODVLQIHULRUHVGHOSODWR
GHPRQWDMH
$SULHWHHOWRUQLOORGHO
FHQWURFRPSOHWDPHQWH
$SULHWHORVGRVWRUQLOORVH[WHULRUHVKDFLDODSDUWH
GHDUULEDGHOKRUQR0LHQWUDVDSULHWDORVWRUQLOORV
PDQWHQJDHOKRUQRHQVXOXJDUFRQWUDODSDUHG
\HOJDELQHWHVXSHULRU
*LUHHOIUHQWHGHOKRUQRFRQWUD
HOIRQGRGHOJDELQHWH
,QVHUWHXQWRUQLOORGHDXWRDOLQHDFLyQDWUDYpVGHO
DJXMHURFHQWUDOVXSHULRUGHOJDELQHWH$VHJXUHHOKRUQR
WHPSRUDOPHQWHJLUDQGRHOWRUQLOORSRUORPHQRVGRV
YXHOWDVFRPSOHWDVGHVSXpVGHTXHODVURVFDVKD\DQ
DJDUUDGR/XHJRTXHGDUiQWRWDOPHQWHDSUHWDGDV
,QVWDOHORV¿OWURVGHJUDVD9HUHO0DQXDO
GHO3URSLHWDULRTXHYLHQHFRQHOKRUQR
,QVWUXFFLRQHVGHLQVWDODFLyQ
& 5(&,5&8/$&,Ï16LQFRQGXFWRGHYHQWLODFLyQ
3(563(&7,9$*(1(5$/
'(/$,167$/$&,Ï1
&3HJXHHOSODWRGHPRQWDMH
DODSDUHG
&3UHSDUHHOJDELQHWHVXSHULRU
&$MXVWHHOFDOHIDFWRU
&0RQWHHOKRUQR
&,QVWDOHHO¿OWURGHFDUERQLOOD
1RVXPLQLVWUDGR
&RORTXHHOSODWRGHPRQWDMHFRQWUDODSDUHGHLQVHUWH
ODVDODVGHPDULSRVDHQORVDJXMHURVGHODSDUHGSDUD
PRQWDUHOSODWR
127$$QWHVGHDSUHWDUORVWRUQLOORVEDVFXODQWHV
\ORVWRUQLOORVGHPDGHUDFHUFLyUHVHGHTXHODVRUHMLOODV
HQHOSODWRGHPRQWDMHWRTXHQHOIRQGRGHOJDELQHWH
FXDQGRVRQHPSXMDGDVFRQWUDODSDUHG\GHTXHHOSODWR
HVWpFHQWUDGRDSURSLDGDPHQWHGHEDMRGHOJDELQHWH
& &Ï02$'+(5,5/$3/$&$
'(0217$-($/$3$5('
35(&$8&,Ï1
7HQJDFXLGDGRGHHYLWDU
SHOOL]FDUVXVGHGRVHQWUHODSDUWHSRVWHULRUGHOSODWR
GHPRQWDMH\ODSDUHG
$SULHWHWRGRVORVWRUQLOORV7LUHGHOSODWRHQGLUHFFLyQ
RSXHVWDDODSDUHGSDUDD\XGDUDDSUHWDUORVWRUQLOORV
3HJXHHOSODWRDODSDUHGXVDQGRORVWRUQLOORVEDVFXODQWHV
3RUORPHQRVXQWRUQLOORGHPDGHUDGHEHVHUXVDGRSDUD
SHJDUHOSODWRDOSRVWHGHODSDUHG
5HPXHYDODVPDULSRVDVGHOEDVFXODQWHGH
ORVWRUQLOORV
,QVHUWHORVWRUQLOORVHQHOSODWRGHPRQWDMHDWUDYpV
GHORVDJXMHURVGLVHxDGRVSDUDVHULQVHUWDGRV
HQODSDUHGGHPDPSRVWHUtDVHFD\SHJXHRWUD
YH]ODVPDULSRVDVGHøsHQFDGDWRUQLOOR
& 8
6(/$3/$17,//$'(/
*$%,1(7(683(5,253$5$/$
35(3$5$&,Ï1'(/*$%,1(7(683(5,25
'HEHUiSHUIRUDUDJXMHURVSDUDORVWRUQLOORVGHDSR\R
VXSHULRUHV\XQDJXMHURVX¿FLHQWHPHQWHJUDQGHSDUD
TXHHOFDEOHHOpFWULFRTXHSD
3DUDXVDUORVWRUQLOORVEDVFXODQWHV
(VSDFLDGRUHVSDUDORVEDVFXODQWHV
PD\RUHVTXHHODQFKRGHODSDUHG
3ODWRGH
PRQWDMH
$ODVGHPDULSRVD
7RUQLOORGH
PDULSRVD
3DUHG
‡ /HDODVLQVWUXFFLRQHVVREUHOD3/$17,//$
'(/*$%,1(7(683(5,25
‡ 3pJXHODGHEDMRGHOJDELQHWHVXSHULRU
‡ 7DODGUHXQDJXMHURVLJXLHQGRODVLQVWUXFFLRQHV
HQOD3/$17,//$'(/*$%,1(7(683(5,25
([WUHPRGHOWRUQLOOR
35(&$8&,Ï1
8VHJDIDVGH
VHJXULGDGFXDQGRSHUIRUHORVDJXMHURVHQHOIRQGR
GHOJDELQHWH
,QVWUXFFLRQHVGHLQVWDODFLyQ
& &
Ï02$'$37$5(/&$/()$&725
3$5$/$5(&,5&8/$&,Ï1
&XLGDGRVDPHQWHWLUHGHOFDOHIDFWRU/RVDODPEUHV
VHH[WHQGHUiQORVX¿FLHQWHSDUDSHUPLWLUOHTXH
XVWHGDMXVWHODXQLGDGGHOFDOHIDFWRU
127$(ODGDSWDGRUGHHVFDSHFRQFDOHIDFWRU
QRHVQHFHVDULRSDUDORVPRGHORVGHUHFLUFXODFLyQ
4XL]iVGHVHHJXDUGDUORVSDUDSRVLEOHVXVRVIXWXURV
5HPXHYD\JXDUGHORVWRUQLOORVTXHVRVWLHQHQ
HOSODWRGHOFDOHIDFWRUHQHOKRUQR
7RUQLOORVGHOSODWRGHO
FDOHIDFWRU
5XHGHODXQLGDGGHOFDOHIDFWRUžGHIRUPDWDO
TXHODVDEHUWXUDVGHODSDOHWDGHOYHQWLODGRUHVWpQ
RULHQWDGDVKDFLDHOIUHQWHGHOPLFURRQGDV
3DUWHSRVWHULRU
GHOKRUQR
$17(6/$6$%(5785$6'(/$3$/(7$'(/
9(17,/$'25(67È125,(17$'$6+$&,$$55,%$
'HVOLFHHOSODWRFDOHIDFWRUSRUGHEDMRGHVXUHERUGH
GHUHWHQFLyQ5HPXHYD\JXDUGHORVWRUQLOORVTXH
VRVWLHQHQHOPRWRUGHOFDOHIDFWRUDOKRUQR
5HERUGHGH
UHWHQFLyQ
3ODWR
FDOHIDFWRU
5XHGH
7RUQLOORGHOPRWRU
GHOFDOHIDFWRU
'(638e6/$6$%(5785$6'(/$3$/(7$'(/9(17,/$'25
(67È125,(17$'$6+$&,$$'(/$17(
127$&HUFLyUHVHGHTXHORVDODPEUHVSHUPDQHFHQ
HQFDPLQDGRVHQODVUDQXUDVGHOPDUFRGHOPRWRU
,QVWUXFFLRQHVGHLQVWDODFLyQ
Ï02$'$37$5(/&$/()$&725
& &
3$5$/$5(&,5&8/$&,Ï1
& &Ï020217$5(/+2512
FRQWLQXDFLyQ
&RORTXHODXQLGDGGHOFDOHIDFWRUGHQXHYRHQOD
DEHUWXUD
$'9(57(1&,$
35(&$8&,Ï1
([LVWHULHVJRGH
GHVFDUJDVHOpFWULFDVTXHSXHGHQRFDVLRQDUOHVLRQHVR
ODPXHUWH1RHPSXMHQLH[WLHQGDHOFDEOHDGRGHOD
XQLGDGGHYHQWLODFLyQ$VHJ~UHVHGHTXHORVFDEOHVQR
SRVHDQFRUWHV
$¿QGHHYLWDUHO
ULHVJRGHOHVLyQSHUVRQDOOHVLyQHQODHVSDOGDX
RWUDVOHVLRQHVGHELGRDSHVRH[FHVLYRGHOKRUQR
GHPLFURRQGDVRGDxRVVREUHHOSURGXFWR
GHEHUiFRQWDUFRQODD\XGDGHGRVSHUVRQDV
SDUDLQVWDODUHVWHKRUQRGHPLFURRQGDV
,03257$17(1RWRPHQLXVHODPDQLMDGXUDQWHOD
LQVWDODFLyQ
$'9(57(1&,$
5LHVJRGH
'HVFDUJD(OpFWULFD3XHGHRFDVLRQDUOHVLRQHVROD
PXHUWHVLLQVWDODODXQLGDGFRQHQFLPHURVGHPHWDO
FXEUDHODJXMHURGHOH[WUHPRGHOFDEOHGHVXPLQLVWUR
GHFRUULHQWHFRQDLVODQWHSDUDHOFDEOHGHOVXPLQLVWUR
GHFRUULHQWH
$VHJXUHODXQLGDGGHYHQWLODFLyQDOKRUQRFRQORV
WRUQLOORVUHWLUDGRVHQHO3DVR,QVHUWHHOWRUQLOORHQHO
DJXMHURGHOWRUQLOORLQIHULRUGHUHFKRHQODSDUWHWUDVHUD
GHOKRUQR
5HHPSODFHHOSODWRFDOHIDFWRUFRQORVWRUQLOORV
UHPRYLGRVHQHO3DVR
,03257$17(6LQRVHXVDQEORTXHDGRUHVGH¿OWUR
VHSRGUiQSURGXFLUGDxRVHQODFDMDGHELGRDODMXVWH
H[FHVLYRGHORVWRUQLOORV
127$&XDQGRVHHQFXHQWUH
PRQWDQGRHOKRUQRHQURVTXH
HOFDEOHHOpFWULFRDWUDYpV
GHODJXMHURHQHOIRQGR
GHOJDELQHWHVXSHULRU
0DQWpQJDORWHQVRDWUDYpVGH
ORV3DVRVGHO²1RSHOOL]TXH /HYDQWHHOKRUQRLQFOtQHOR
HOFDEOHQLWLUHGHOKRUQRSRU
KDFLDDGHODQWH\HQJDQFKH
HOFDEOH
ODVUDQXUDVHQHOH[WUHPR
LQIHULRUSRVWHULRUHQGRV
RUHMLOODVLQIHULRUHVGHOSODWR
GHPRQWDMH
7RUQLOORVGHO
SODWRFDOHIDFWRU
3DUWHSRVWHULRU
GHOKRUQR
7RUQLOORGHOPRWRU
GHOFDOHIDFWRU
*LUHHOIUHQWHGHOKRUQRFRQWUD
HOIRQGRGHOJDELQHWH
,QVHUWHXQWRUQLOORGHDXWRDOLQHDFLyQDWUDYpVGHO
DJXMHURFHQWUDOVXSHULRUGHOJDELQHWH$VHJXUHHOKRUQR
WHPSRUDOPHQWHJLUDQGRHOWRUQLOORSRUORPHQRVGRV
YXHOWDVFRPSOHWDVGHVSXpVGHTXHODVURVFDVKD\DQ
DJDUUDGR/XHJRTXHGDUiQWRWDOPHQWHDSUHWDGDV
,QVWUXFFLRQHVGHLQVWDODFLyQ
& &Ï02,167$/$5(/),/752
'(&$5%21,//$
& &Ï020217$5(/+2512
FRQWLQXDFLyQ
,QVHUWHXQWRUQLOORGHDXWRDOLQHDFLyQDWUDYpVGHO
DJXMHURFHQWUDOVXSHULRUGHOJDELQHWH$VHJXUHHOKRUQR
WHPSRUDOPHQWHJLUDQGRHOWRUQLOORSRUORPHQRVGRV
YXHOWDVFRPSOHWDVGHVSXpVGHTXHODVURVFDVKD\DQ
DJDUUDGR/XHJRTXHGDUiQWRWDOPHQWHDSUHWDGDV
5HPXHYDORVWRUQLOORVHQODSDUWHVXSHULRU
GHOKRUQRMXVWRHQFLPDGHODUHMLOODXVDQGR
XQGHVWRUQLOODGRUGHHVWUHOOD
$EUDODSXHUWD
5HPXHYDODUHMLOOD
)UHQWHGHOJDELQHWH
(VWDQWHGHOIRQGRGHOJDELQHWH
7RUQLOORV
%ORTXHGHUHOOHQR
(TXLYDOHQWHD
ODSURIXQGLGDG
GHOUHWURFHVR
GHOJDELQHWH
5HMLOOD
(VWDGLVWDQFLD12
SXHGHVXSHUDUODVµ
SDUDDVHJXUDUXQD
LQVWDODFLyQDGHFXDGD
7RUQLOORDXWRDOLQHDEOH
3DUWHVXSHULRUGHOKRUQR
,QVHUWHWRUQLOORVøs[ȓs
DXWRDOLQHDEOHVDWUDYpVGHORVDJXMHURV
H[WHULRUHVVXSHULRUHVGHOJDELQHWH*LUH
GRVYXHOWDVFRPSOHWDVHQFDGDWRUQLOOR
,QVHUWHHO¿OWURHQKRUQRFRPRVHPXHVWUDKDVWD
TXHVHDMXVWHFRUUHFWDPHQWHHQVXOXJDU'HVFDQVDUi
HQXQiQJXORGHWUiVGHODVRUHMLOODVLQIHULRUHV
IURQWDOHV&XDQGRHVWiLQVWDODGRFRUUHFWDPHQWH
ODPDOODGHO¿OWURGHEHUtDHVWDUYLVLEOHGHVGHHOIUHQWH
2UHMLOODVLQIHULRUHV
IURQWDOHV
)LOWURGHFDUEyQ
$SULHWHHOWRUQLOORGHO
FHQWURFRPSOHWDPHQWH
$SULHWHORVGRVWRUQLOORVH[WHULRUHVKDFLDODSDUWH
GHDUULEDGHOKRUQR0LHQWUDVDSULHWDORVWRUQLOORV
PDQWHQJDHOKRUQRHQVXOXJDUFRQWUDODSDUHG
\HOJDELQHWHVXSHULRU
)LOWURGHFDUEyQLQVWDODGR
5HPSODFHODUHMLOOD\ORVGRVWRUQLOORVVXSHULRUHV
&LHUUHODSXHUWD\YXHOYDDFRORFDUHOWRUQLOOR
GHOODGRL]TXLHUGR
,QVWDOHORV¿OWURVGHJUDVD9HUHO0DQXDO
GHO3URSLHWDULRTXHYLHQHFRQHOKRUQR
,QVWUXFFLRQHVGHLQVWDODFLyQ
$17(6'(&20(1=$5$86$568+2512
&HUFLyUHVHGHTXHHOKRUQRKDVLGRLQVWDODGR
GHDFXHUGRFRQODVLQVWUXFFLRQHV
/HDHO0DQXDOGHO3URSLHWDULR
5HPXHYDWRGRVORVPDWHULDOHVGHHPEDODMH
GHOKRUQR
*8$5'((67$6,16758&&,21(63$5$(/862
'(/,163(&725/2&$/
,QVWDOHHODURURWDWRULR\FRQUXHGDVHQODFDYLGDG
5HHPSODFHHOIXVLEOHGHODFDVDRHQFLHQGD
GHQXHYRHOLQWHUUXSWRU
0RGHORVGH9(QFKXIHHOFDEOHHOpFWULFRHQ
XQWRPDFRUULHQWHH[FOXVLYRGH
DDPSHULRV
$VHJ~UHVHGH
TXHH[LVWHXQD
FRQH[LyQDWLHUUD
DSURSLDGDDQWHV
GHOXVR
'RQGHKD\DXQWRPDFRUULHQWHGHSDUHGHVWiQGDU
GHGRVHVSLJDVUHVXOWDPX\LPSRUWDQWHFDPELDUOR
SRUXQWRPDFRUULHQWHGHSDUHGGHWUHVHVSLJDV
FRQDGHFXDGDFRQH[LyQDWLHUUDLQVWDODGRSRU
XQHOHFWULFLVWDFDOL¿FDGR
0)/
*(
3ULQWHGLQ.RUHD
,PSUHVRHQ&RUHD
PVM1790DR/SR
Over-the-Range Microwave Oven
GE Profile™ 1.7 Cu. Ft. Capacity Over-the-Range
Microwave
Dimensions
(in inches)Oven
Dimensions and Installation Information (in inches)
Note: Requires 120V grounded outlet. Electrical receptacle must be
located in cabinet above Spacemaker microwave oven. No additional
wiring, venting or cabinet rebuilding necessary in many cases. Complete
detailed, easy-to-follow installation instructions and convenient full-size
templates are packed with the Spacemaker microwave oven.
66" MIN.
Mounting
height
from floor
Important Information: When installing the Spacemaker microwave
oven over a range, allow minimum of 2” from bottom of Spacemaker
microwave oven to top of range backguard to allow for removal
of light covers.
Ventilation Options: The Spacemaker microwave ovens and
Spacemaker convection/microwave ovens are designed for
adaptation to the following three types of ventilation:
•Outside exhaust (Vertical – as shown)
•Outside exhaust (horizontal)
•Recirculating (non-vented ductless – see Filter Kit drawing,
order JX81D
Installation Information: This information is not intended to be used for
installing unit described. Before installing, consult installation instructions
packed with product/kit for current dimensional data.
30" MIN.
width required
Exhaust outlet
connects to
3-1/4" X 10" duct
13"
MAX.
12"
MIN.
15-3/8
24-1/2
16-7/16
16-7/16
(Rear)
(without
obstruction)
29-15/16
Minimum distance from
door hinge side to adjacent
wall should equal 1/2-inch.
For answers to your Monogram,® GE Profile™ or
GE® appliance questions, visit our website at
ge.com or call GE Answer Center® service,
800.626.2000.
Listed by
Underwriters
Laboratories
Specification Revised 12/11
240273
PVM1790DR/SR
GE Profile™ 1.7 Cu. Ft. Capacity Over-the-Range Microwave Oven
Optional Accessories (Available at additional cost)
Hood Exhaust Duct: Outside ventilation requires a HOOD EXHAUST DUCT. Read the
following carefully.
Exhaust Connection: The hood exhaust has been designed to mate with a standard
3-1/4" x 10" rectangular duct. If a round duct is required, a rectangular-to-round
transition adaptor must be used. Do not use less than a 6" diameter duct.
Rear Exhaust: If a rear or horizontal exhaust is to be used, care should be taken to
align exhaust with space between studs, or wall should be prepared at the time it
is constructed by leaving enough space between the wall studs to accommodate
exhaust.
Maximum Duct Length: For satisfactory air movement, the total duct length of 3-1/4"
x 10" rectangular or 6" diameter round duct should not exceed 140 equivalent feet.
Filler Panel Kits
JX40/41
When replacing a 36" or
42" range hood, this kit fills
in the additional width to
provide a custom built-in
appearance.
For installation between ­
cabinets only; not for
end-of-cabinet installation.
Each kit ­contains two
3"-wide filler panels.
Filter Kits
JX81D–Recirculating
Charcoal Filter Kit
To be used when
the Spacemaker
microwave oven
cannot be vented
to the outside.
ELBOWS, TRANSITIONS, WALL AND ROOF CAPS: etc., present additional resistance to
airflow and are equivalent to a section of straight duct which is longer than their
actual physical size. When calculating the total duct length, add the equivalent length
of all transitions and adaptors plus the lengths of all straight duct sections. The chart
below shows the approximate feet of equivalent length of some typical ducts.
Duct
Equivalent Feet
A.Rectangular-To-round
Transition Adaptor
5 ft.
B. Wall Cap
40 ft.
C. 90° Elbow
10 ft.
D.45° Elbow
5 ft.
E. 90° Elbow
25 ft.
F. 45° Elbow
5 ft.
G.Roof Cap
24 ft.
Listed by
Underwriters
Laboratories
Specification Revised 12/11
240273
PVM1790DR/SR
GE Profile™ 1.7 Cu. Ft. Capacity Over-the-Range Microwave Oven
Features and Benefits
• 1.7 cu. ft. capacity, 1000 microwave watts (IEC test procedure) and
1550 convection watts
• Convection cooking - Choose this setting when baking or browning
is desired
• Fast Bake - Enjoy oven-quality results up to 25% faster than
conventional cooking
MICROWAVE
POPCORN
CONVECTION
BEVERAGE
ADD 30
START
PAUSE
• Sensor cooking controls - Automatically adjusts time and power for
delicious cooking results
REHEAT
WARM
SEC
CLEAR
OFF
POWER
LEVEL
CLOCK
AM/PM
SETTINGS
VENT FAN
TIMER
ON/OFF
SURFACE
LIGHT
• Warming oven - Warming oven mode keeps foods warm until served
• Auto Recipe™ Conversion - Just set the controls according to the recipe
and the oven automatically converts standard recipe temperatures to
proper convection settings
PVM1790SR
• Stainless steel interior - Stainless steel interior is both stylish and easy
to clean
• Model PVM1790DRWW – White • Model PVM1790DRCC – Bisque
•Model PVM1790DRBB – Black
• Model PVM1790SRSS – Stainless steel
Specification Revised 12/11
240273
*(3URILOH
&RQYHFWLRQ0LFURZDYH2YHQ
*($SSOLDQFHVFRP
6DIHW\,QVWUXFWLRQV ²
2SHUDWLQJ,QVWUXFWLRQV
%DNH)HDWXUHV
%HVW0HWKRGRI&RRNLQJ&KDUW &KDQJLQJ3RZHU/HYHO &RRNLQJ2SWLRQV &RRNZDUH7LSV )DVW%DNH)HDWXUH )HDWXUHVRI<RXU2YHQ 0LFURZDYH7HUPV 2WKHU)HDWXUHV ²
$XWR5HFLSHŒ&RQYHUVLRQ $XWRPDWLF)DQ $XWR1LWH/LJKW %DNH7HPS$GMXVW %HHSHU9ROXPH &RQWURO/RFN2XW &OHDU2II &ORFN &RRNLQJ&RPSOHWH5HPLQGHU 'LVSOD\/DQJXDJH 'LVSOD\212)) 'LVSOD\6SHHG +HOS 0HDVXUHV 0RUH7LPH0HVVDJH 5HVXPH 6WDUW3DXVH 6XUIDFH/LJKW 7LPHU 7XUQWDEOH2Q2II 9HQW)DQ 5RDVW)HDWXUHV 0LFURZDYH6HQVRU)HDWXUHV ²
0LFURZDYH7LPHDQG$XWR
)HDWXUHV ²
:DUP)HDWXUH &DUHDQG&OHDQLQJ
&KDUFRDO)LOWHUV ,QVLGH 2XWVLGH
5HSODFLQJWKH/LJKW%XOEV 6WDLQOHVV6WHHO 9HQW)LOWHUV 2ZQHU·V
0DQXDO
390
&90
7URXEOHVKRRWLQJ7LSV 7KLQJV7KDW$UH1RUPDO
:LWK<RXU0LFURZDYH2YHQ &RQVXPHU6XSSRUW
&RQVXPHU6XSSRUW %DFN&RYHU
2SWLRQDO.LWV :DUUDQW\ :ULWHWKHPRGHODQGVHULDOQXPEHUVKHUH
0RGHO BBBBBBBBBBBBBBBBBBBBBBBBBB
6HULDO BBBBBBBBBBBBBBBBBBBBBBBBBB
<RXFDQILQGWKHPRQDODEHOZKHQWKH
GRRULVRSHQ
0)/*(
,03257$176$)(7<,16758&7,216
5($'$//,16758&7,216%()25(86,1*
:KHQXVLQJHOHFWULFDODSSOLDQFHVEDVLFVDIHW\SUHFDXWLRQVVKRXOGEHIROORZHGLQFOXGLQJWKHIROORZLQJ
:$51,1*7RUHGXFHWKHULVNRIEXUQVHOHFWULFVKRFNILUHLQMXU\WRSHUVRQVRUH[SRVXUHWRH[FHVVLYH
PLFURZDYHHQHUJ\
35(&$87,21672$92,'3266,%/((;32685(
72(;&(66,9(0,&52:$9((1(5*<
D 'R1RW$WWHPSW WRRSHUDWHWKLVRYHQZLWKWKH
GRRURSHQVLQFHRSHQGRRURSHUDWLRQFDQUHVXOW
LQKDUPIXOH[SRVXUHWRPLFURZDYHHQHUJ\,W
LVLPSRUWDQWQRWWRGHIHDWRUWDPSHUZLWKWKH
VDIHW\LQWHUORFNV
E 'R1RW3ODFH DQ\REMHFWEHWZHHQWKHRYHQIURQW
IDFHDQGWKHGRRURUDOORZVRLORUFOHDQHUUHVLGXH
WRDFFXPXODWHRQVHDOLQJVXUIDFHV
F 'R1RW2SHUDWH WKHRYHQLILWLVGDPDJHG
,WLVSDUWLFXODUO\LPSRUWDQWWKDWWKHRYHQGRRU
FORVHSURSHUO\DQGWKDWWKHUHLVQRGDPDJHWR
WKH
GRRUEHQW
KLQJHVDQGODWFKHVEURNHQRUORRVHQHG
GRRUVHDOVDQGVHDOLQJVXUIDFHV
G 7KH2YHQ6KRXOG1RW EHDGMXVWHGRUUHSDLUHG
E\DQ\RQHH[FHSWSURSHUO\TXDOLILHGVHUYLFH
SHUVRQQHO
„
5HDGDOOLQVWUXFWLRQVEHIRUHXVLQJ
WKLVDSSOLDQFH:KHQXVLQJHOHFWULFDODSSOLDQFHVEDVLF
VDIHW\SUHFDXWLRQVVKRXOGEHIROORZHGLQFOXGLQJWKH
IROORZLQJ
„ 5HDGDQGIROORZWKHVSHFLILFSUHFDXWLRQVLQWKH3UHFDXWLRQV
WR$YRLG3RVVLEOH([SRVXUHWR([FHVVLYH0LFURZDYH(QHUJ\
VHFWLRQDERYH
„ 7KLVDSSOLDQFHPXVWEHJURXQGHG&RQQHFWRQO\WRDSURSHUO\
JURXQGHGRXWOHW6HHWKH*URXQGLQJ,QVWUXFWLRQVVHFWLRQRQ
SDJH
„ 7KLVPLFURZDYHRYHQLV8/OLVWHGIRULQVWDOODWLRQRYHUERWK
JDVOHVVWKDQ%78DQGHOHFWULFUDQJHV
„ 7KLVRYHUWKHUDQJHRYHQLVGHVLJQHGIRUXVHRYHUUDQJHVQR
ZLGHUWKDQs,WPD\EHLQVWDOOHGRYHUERWKJDVDQGHOHFWULF
FRRNLQJHTXLSPHQW
„ 'RQRWRSHUDWHWKLVDSSOLDQFHLILWKDVDGDPDJHGSRZHU
FRUGRUSOXJLILWLVQRWZRUNLQJSURSHUO\RULILWKDVEHHQ
GDPDJHGRUGURSSHG,IWKHSRZHUFRUGLVGDPDJHGLWPXVW
EHUHSODFHGE\*HQHUDO(OHFWULF6HUYLFHRUDQDXWKRUL]HG
VHUYLFHDJHQWXVLQJDSRZHUFRUGDYDLODEOHIURP*HQHUDO
(OHFWULF
„ ,QVWDOORUORFDWHWKLVDSSOLDQFHRQO\LQDFFRUGDQFHZLWKWKH
SURYLGHGLQVWDOODWLRQLQVWUXFWLRQV
„ 7RUHGXFHWKHULVNRIILUHLQWKHRYHQFDYLW\
³ 'RQRWRYHUFRRNIRRG&DUHIXOO\DWWHQGDSSOLDQFHZKHQ
SDSHUSODVWLFRURWKHUFRPEXVWLEOHPDWHULDOVDUHSODFHG
LQVLGHWKHRYHQZKLOHFRRNLQJ
³ 5HPRYHZLUHWZLVWWLHVDQGPHWDOKDQGOHVIURPSDSHURU
SODVWLFFRQWDLQHUVEHIRUHSODFLQJWKHPLQWKHRYHQ
³ 'RQRWXVHWKHRYHQIRUVWRUDJHSXUSRVHV'RQRWOHDYH
SDSHUSURGXFWVFRRNLQJXWHQVLOVRUIRRGLQWKHRYHQZKHQ
QRWLQXVH
³ 'RQRWSRSSRSFRUQLQ\RXUPLFURZDYHRYHQXQOHVVLQD
VSHFLDOPLFURZDYHSRSFRUQDFFHVVRU\RUXQOHVV\RXXVH
SRSFRUQODEHOHGIRUXVHLQPLFURZDYHRYHQV
³ ,IPDWHULDOVLQVLGHWKHRYHQLJQLWHNHHSWKHRYHQGRRUFORVHG
WXUQWKHRYHQRIIDQGGLVFRQQHFWWKHSRZHUFRUGRUVKXW
RIISRZHUDWWKHIXVHRUFLUFXLWEUHDNHUSDQHO,IWKHGRRULV
RSHQHGWKHILUHPD\VSUHDG
³ 'RQRWXVHWKH6HQVRU)HDWXUHVWZLFHLQVXFFHVVLRQ
RQWKHVDPHIRRGSRUWLRQ,IIRRGLVXQGHUFRRNHGDIWHUWKH
ILUVWFRXQWGRZQXVH&22.%<7,0(IRUDGGLWLRQDOFRRNLQJ
WLPH
³ 'RQRWXVHWKHRYHQWRGU\QHZVSDSHU
6$9(7+(6(,16758&7,216
*($SSOLDQFHVFRP
,03257$176$)(7<,16758&7,216
„ :KHQXVLQJWKH%DNH5RDVWRU)DVW%DNHIXQFWLRQV
ERWKWKHRXWVLGHDQGLQVLGHRIWKHRYHQZLOOEHFRPH
KRW$OZD\VXVHKRWSDGVWRUHPRYHFRQWDLQHUVRIIRRG
DQGDFFHVVRULHVVXFKDVWKHRYHQVKHOI
„ 7KHUPRPHWHU³'RQRWXVHUHJXODUFRRNLQJRURYHQ
WKHUPRPHWHUVZKHQFRRNLQJE\PLFURZDYHRUXVLQJ
WKH)DVW%DNHPRGH7KHPHWDODQGPHUFXU\LQWKHVH
WKHUPRPHWHUVFRXOGFDXVHDUFLQJDQGSRVVLEOHGDPDJH
WRWKHRYHQ'RQRWXVHDWKHUPRPHWHULQIRRG\RXDUH
PLFURZDYLQJXQOHVVWKHWKHUPRPHWHULVGHVLJQHGRU
UHFRPPHQGHGIRUXVHLQWKHPLFURZDYHRYHQ
„ 'RQRWFOHDQZLWKPHWDOVFRXULQJSDGV3LHFHVFDQEXUQRII
WKHSDGDQGWRXFKHOHFWULFDOSDUWVLQYROYLQJULVNRIHOHFWULF
VKRFN
„ 'RQRWVWRUHDQ\PDWHULDOVRWKHUWKDQRXUUHFRPPHQGHG
DFFHVVRULHVLQWKLVRYHQZKHQQRWLQXVH
„ 'RQRWVWRUHWKLVDSSOLDQFHRXWGRRUV'RQRWXVHWKLVSURGXFW
QHDUZDWHU³IRUH[DPSOHLQDZHWEDVHPHQW
QHDUDVZLPPLQJSRROQHDUDVLQNRULQVLPLODUORFDWLRQV
„ .HHSSRZHUFRUGDZD\IURPKHDWHGVXUIDFHV
„ 'RQRWLPPHUVHSRZHUFRUGRUSOXJLQZDWHU
„ 'RQRWEORFNRUFRYHUDQ\RSHQLQJVRQWKHDSSOLDQFH
„ 7KLVPLFURZDYHLVQRWDSSURYHGRUWHVWHGIRUPDULQHXVH
„ 8VHWKLVDSSOLDQFHRQO\IRULWVLQWHQGHGXVHDVGHVFULEHGLQ
WKLVPDQXDO
„ 'RQRWXVHFRUURVLYHFKHPLFDOVRUYDSRUVLQWKLVDSSOLDQFH
„ 7KLVPLFURZDYHRYHQLVVSHFLILFDOO\GHVLJQHGWRKHDWGU\RU
FRRNIRRGDQGLVQRWLQWHQGHGIRUODERUDWRU\RULQGXVWULDOXVH
„ 6RPHSURGXFWVVXFKDVZKROHHJJVDQGVHDOHGFRQWDLQHUV³
IRUH[DPSOHFORVHGMDUV³DUHDEOHWRH[SORGHDQGVKRXOG
QRWEHKHDWHGLQWKLVPLFURZDYHRYHQ6XFKXVHRIWKH
PLFURZDYHRYHQFRXOGUHVXOW
LQLQMXU\
„ ,WLVLPSRUWDQWWRNHHSWKHDUHDFOHDQZKHUHWKHGRRU
VHDOVDJDLQVWWKHPLFURZDYH8VHRQO\PLOGQRQDEUDVLYH
GHWHUJHQWVDSSOLHGZLWKDFOHDQVSRQJHRUVRIWFORWK5LQVH
ZHOO
„ 7KLVDSSOLDQFHPXVWRQO\EHVHUYLFHGE\TXDOLILHGVHUYLFH
SHUVRQQHO&RQWDFWQHDUHVWDXWKRUL]HGVHUYLFHIDFLOLW\IRU
H[DPLQDWLRQUHSDLURUDGMXVWPHQW
„ $VZLWKDQ\DSSOLDQFHFORVHVXSHUYLVLRQLVQHFHVVDU\ZKHQ
XVHGE\FKLOGUHQ
„ 'RQRWVWRUHDQ\WKLQJGLUHFWO\RQWRSRIWKHPLFURZDYHRYHQ
VXUIDFHZKHQWKHPLFURZDYHRYHQLVLQRSHUDWLRQ
„ 'RQRWPRXQWWKLVDSSOLDQFHRYHUDVLQN
„ 'RQRWOHWWKHFRUGKDQGRYHUHGJHRIFRXQWHU
„ 'RQRWXVHSDSHUSURGXFWVLQRYHQZKHQDSSOLDQFHLV
RSHUDWHGLQDQ\FRRNLQJPRGHH[FHSWPLFURZDYHRQO\
:$51,1*
$5&,1*
,I\RXVHHDUFLQJSUHVVWKH&/($52))EXWWRQDQGFRUUHFWWKHSUREOHP
$UFLQJLVWKHPLFURZDYHWHUPIRUVSDUNVLQWKHRYHQ
$UFLQJLVFDXVHGE\
„ )RLOQRWPROGHGWRIRRGXSWXUQHGHGJHVDFW
OLNHDQWHQQDV
„ 7KHPHWDOVKHOIQRWLQVWDOOHGFRUUHFWO\VRLW
WRXFKHVWKHPLFURZDYHZDOO
„ 0HWDOVXFKDVWZLVWWLHVSRXOWU\SLQVRUJROG
ULPPHGGLVKHVLQWKHPLFURZDYH
„ 0HWDORUIRLOWRXFKLQJWKHVLGHRIWKHRYHQ
„ 5HF\FOHGSDSHUWRZHOVFRQWDLQLQJVPDOOPHWDO
SLHFHVEHLQJXVHGLQWKHPLFURZDYH
„ 7XUQWDEOHULQJVXSSRUWQRWLQVWDOOHGFRUUHFWO\
6$9(7+(6(,16758&7,216
,03257$176$)(7<,16758&7,216
5($'$//,16758&7,216%()25(86,1*
:$51,1*
)22'6
„ 'RQRWSRSSRSFRUQLQ\RXUPLFURZDYHRYHQXQOHVV
LQDVSHFLDOPLFURZDYHSRSFRUQDFFHVVRU\
RUXQOHVV\RXXVHSRSFRUQODEHOHGIRUXVHLQ
PLFURZDYHRYHQV
„ 'RQRWERLOHJJVLQDPLFURZDYHRYHQ3UHVVXUHZLOO
EXLOGXSLQVLGHHJJ\RONDQGZLOOFDXVHLWWREXUVW
SRVVLEO\UHVXOWLQJLQLQMXU\
„ 2SHUDWLQJWKHPLFURZDYHZLWKQRIRRGLQVLGHIRU
PRUHWKDQDPLQXWHRUWZRPD\FDXVHGDPDJH
WRWKHRYHQDQGFRXOGVWDUWDILUH,WLQFUHDVHVWKH
KHDWDURXQGWKHPDJQHWURQDQGFDQVKRUWHQ
WKHOLIHRIWKHRYHQ
„ )RRGVFRRNHGLQOLTXLGVVXFKDVSDVWDPD\
WHQGWRERLOPRUHUDSLGO\WKDQIRRGVFRQWDLQLQJOHVV
PRLVWXUH6KRXOGWKLVRFFXUUHIHUWRWKH
&DUHDQGFOHDQLQJRIWKHPLFURZDYHRYHQVHFWLRQ
IRULQVWUXFWLRQVRQKRZWRFOHDQWKHLQVLGHRI
WKHRYHQ
„ $YRLGKHDWLQJEDE\IRRGLQJODVVMDUVHYHQZLWK
WKHOLGRII0DNHVXUHDOOLQIDQWIRRGLVWKRURXJKO\
FRRNHG6WLUIRRGWRGLVWULEXWHWKHKHDWHYHQO\
%HFDUHIXOWRSUHYHQWVFDOGLQJZKHQZDUPLQJ
IRUPXOD7KHFRQWDLQHUPD\IHHOFRROHUWKDQWKH
IRUPXODUHDOO\LV$OZD\VWHVWWKHIRUPXODEHIRUH
IHHGLQJWKHEDE\
„ )RRGVZLWKXQEURNHQRXWHU´VNLQµVXFKDVSRWDWRHV
„ 'RQ·WGHIURVWIUR]HQEHYHUDJHVLQQDUURZQHFNHG
KRWGRJVVDXVDJHVWRPDWRHVDSSOHVFKLFNHQOLYHUV
ERWWOHVHVSHFLDOO\FDUERQDWHGEHYHUDJHV(YHQLIWKH
DQGRWKHUJLEOHWVDQGHJJ\RONVVKRXOGEHSLHUFHGWR
FRQWDLQHULVRSHQHGSUHVVXUHFDQEXLOGXS7KLVFDQ
DOORZVWHDPWRHVFDSH
FDXVHWKHFRQWDLQHUWREXUVWSRVVLEO\UHVXOWLQJLQ
GXULQJFRRNLQJ
LQMXU\
„ 683(5+($7(':$7(5
„ +RWIRRGVDQGVWHDPFDQFDXVHEXUQV%HFDUHIXO
/LTXLGVVXFKDVZDWHUFRIIHHRUWHDDUHDEOHWR
ZKHQRSHQLQJDQ\FRQWDLQHUVRIKRWIRRGLQFOXGLQJ
EHRYHUKHDWHGEH\RQGWKHERLOLQJSRLQWZLWKRXW
SRSFRUQEDJVFRRNLQJSRXFKHVDQGER[HV7R
DSSHDULQJWREHERLOLQJ9LVLEOHEXEEOLQJRUERLOLQJ
SUHYHQWSRVVLEOHLQMXU\GLUHFWVWHDPDZD\IURP
ZKHQWKHFRQWDLQHULVUHPRYHGIURPWKHPLFURZDYH
KDQGVDQGIDFH
RYHQLVQRWDOZD\VSUHVHQW7+,6&28/'5(68/7,1
9(5<+27/,48,'668''(1/<%2,/,1*29(5:+(1 „ 'RQRWRYHUFRRNSRWDWRHV7KH\FRXOGGHK\GUDWH
DQGFDWFKILUHFDXVLQJGDPDJHWR\RXURYHQ
7+(&217$,1(5,6',6785%('25$6322125
27+(587(16,/,6,16(57(',1727+(/,48,'
„ &RRNPHDWDQGSRXOWU\WKRURXJKO\³PHDWWRDW
7RUHGXFHWKHULVNRILQMXU\WRSHUVRQV
³ 'RQRWRYHUKHDWWKHOLTXLG
³ 6WLUWKHOLTXLGERWKEHIRUHDQGKDOIZD\WKURXJK
KHDWLQJLW
OHDVWDQ,17(51$/WHPSHUDWXUHRIƒ)DQGSRXOWU\
WRDWOHDVWDQ,17(51$/WHPSHUDWXUHRIƒ)
&RRNLQJWRWKHVHWHPSHUDWXUHVXVXDOO\SURWHFWV
DJDLQVWIRRGERUQHLOOQHVV
³ 'RQRWXVHVWUDLJKWVLGHGFRQWDLQHUVZLWKQDUURZ
QHFNV
³ $IWHUKHDWLQJDOORZWKHFRQWDLQHUWRVWDQGLQWKH
PLFURZDYHRYHQIRUDVKRUWWLPHEHIRUHUHPRYLQJ
WKHFRQWDLQHU
³ 8VHH[WUHPHFDUHZKHQLQVHUWLQJDVSRRQRURWKHU
XWHQVLOLQWRWKHFRQWDLQHU
6$9(7+(6(,16758&7,216
*($SSOLDQFHVFRP
0,&52:$9(6$)(&22.:$5(
'RQRWRSHUDWHWKHRYHQLQWKHPLFURZDYHPRGHZLWKRXWWKHWXUQWDEOHDQGWKHWXUQWDEOHVXSSRUW
VHDWHGDQGLQSODFH7KHWXUQWDEOHPXVWEHXQUHVWULFWHGVRLWFDQURWDWH
0DNHVXUHDOOFRRNZDUHXVHGLQ\RXUPLFURZDYHRYHQLVVXLWDEOHIRUPLFURZDYLQJ0RVWJODVVFDVVHUROHV
FRRNLQJGLVKHVPHDVXULQJFXSVFXVWDUGFXSVSRWWHU\RUFKLQDGLQQHUZDUHZKLFKGRHVQRWKDYHPHWDOOLF
WULPRUJOD]HZLWKDPHWDOOLFVKHHQFDQEHXVHG6RPHFRRNZDUHLVODEHOHG´VXLWDEOHIRUPLFURZDYLQJµ
„ ,I\RXDUHQRWVXUHLIDGLVK
LVPLFURZDYHVDIH
XVHWKLVWHVW3ODFHLQWKH
RYHQERWKWKHGLVK\RX
DUHWHVWLQJDQGDJODVV
PHDVXULQJFXSILOOHGZLWK
+RZWRWHVWIRUD
FXSRIZDWHU³VHWWKH
PLFURZDYHVDIHGLVK
PHDVXULQJFXSHLWKHU
LQRUQH[WWRWKHGLVK0LFURZDYH²VHFRQGV
DWKLJK,IWKHGLVKKHDWVLWVKRXOGQRWEHXVHGIRU
PLFURZDYLQJ
,IWKHGLVKUHPDLQVFRRODQGRQO\WKHZDWHULQ
WKHFXSKHDWVWKHQWKHGLVKLVPLFURZDYHVDIH
„ 2YHUVL]HGIRRGRURYHUVL]HGPHWDOFRRNZDUHVKRXOG
QRWEHXVHGLQDPLFURZDYHFRQYHFWLRQRYHQ
EHFDXVHWKH\LQFUHDVHWKHULVNRIHOHFWULFVKRFNDQG
FRXOGFDXVHDILUH
„ 6RPHWLPHVWKHRYHQIORRUWXUQWDEOHDQGZDOOV
FDQEHFRPHWRRKRWWRWRXFK%HFDUHIXOWRXFKLQJ
WKHIORRUWXUQWDEOHDQGZDOOVGXULQJDQGDIWHU
FRRNLQJ
„ ,I\RXXVHDPHDWWKHUPRPHWHUZKLOHPLFURZDYLQJ
RUXVLQJWKH)$67%$.(PRGH
PDNHVXUHLWLVVDIHIRUXVHLQPLFURZDYHRYHQV
„ 'RQRWXVHUHF\FOHGSDSHUSURGXFWV5HF\FOHGSDSHU
WRZHOVQDSNLQVDQGZD[HGSDSHUFDQFRQWDLQPHWDO
IOHFNVZKLFKPD\FDXVHDUFLQJ
RULJQLWH3DSHUSURGXFWVFRQWDLQLQJQ\ORQRUQ\ORQ
ILODPHQWVVKRXOGEHDYRLGHGDVWKH\
PD\DOVRLJQLWH
„ 6RPHVW\URIRDPWUD\VOLNHWKRVHWKDWPHDW
LVSDFNDJHGRQKDYHDWKLQVWULSRIPHWDOHPEHGGHG
LQWKHERWWRP:KHQPLFURZDYHG
WKHPHWDOFDQEXUQWKHIORRURIWKHRYHQRU
LJQLWHDSDSHUWRZHO
„ 8VHRIWKHVKHOIDFFHVVRU\
³5HPRYHWKHVKHOIIURPWKHRYHQZKHQ
QRWLQXVH
³8VHSRWKROGHUVZKHQKDQGOLQJWKHVKHOIDQG
FRRNZDUH7KH\PD\EHKRW
³%HVXUHWKDWWKHVKHOILVSRVLWLRQHGSURSHUO\LQVLGH
WKHRYHQWRSUHYHQWSURGXFWGDPDJH
³'RQRWFRYHUWKHVKHOIRUDQ\SDUWRIWKHRYHQZLWK
PHWDOIRLO7KLVZLOOFDXVHRYHUKHDWLQJRI
WKHPLFURZDYHFRQYHFWLRQRYHQ
„ 'RQRWXVH\RXUPLFURZDYHFRQYHFWLRQRYHQ
WRGU\QHZVSDSHUV
„ 1RWDOOSODVWLFZUDSLVVXLWDEOHIRUXVHLQPLFURZDYH
RYHQV&KHFNWKHSDFNDJHIRU
SURSHUXVH
„ 3DSHUWRZHOVZD[HGSDSHUDQGSODVWLF
ZUDSFDQEHXVHGWRFRYHUGLVKHVLQRUGHUWRUHWDLQ
PRLVWXUHDQGSUHYHQWVSDWWHULQJZKLOHPLFURZDYLQJ
%HVXUHWRYHQWSODVWLFZUDSVRVWHDPFDQHVFDSH
„ 'RQRWXVHSDSHUSURGXFWVZKHQWKHPLFURZDYH
FRQYHFWLRQRYHQLVRSHUDWHGLQWKH%$.(52$67RU
)$67%$.(PRGH
„ &RRNZDUHPD\EHFRPHKRWEHFDXVHRIKHDW
WUDQVIHUUHGIURPWKHKHDWHGIRRG3RWKROGHUV
PD\EHQHHGHGWRKDQGOHWKHFRRNZDUH
„ :KHQPLFURZDYLQJ´ERLODEOHµFRRNLQJSRXFKHV
DQGWLJKWO\FORVHGSODVWLFEDJVWKH\VKRXOGEHVOLW
SLHUFHGRUYHQWHGDVGLUHFWHGE\SDFNDJH,IWKH\
DUHQRWSODVWLFFRXOGEXUVWGXULQJRULPPHGLDWHO\
DIWHUFRRNLQJSRVVLEO\UHVXOWLQJLQLQMXU\$OVRSODVWLF
VWRUDJHFRQWDLQHUVVKRXOGEHDWOHDVWSDUWLDOO\
XQFRYHUHGEHFDXVHWKH\IRUPDWLJKWVHDO:KHQ
FRRNLQJZLWKFRQWDLQHUVWLJKWO\FRYHUHGZLWKSODVWLF
ZUDSUHPRYHFRYHULQJFDUHIXOO\DQGGLUHFWVWHDP
DZD\IURPKDQGVDQGIDFH
„ 8VHIRLORQO\DVGLUHFWHGLQWKLVPDQXDO:KHQXVLQJ
IRLOLQWKHPLFURZDYHRYHQNHHSWKHIRLODWOHDVWµ
DZD\IURPWKHVLGHVRIWKHRYHQ
„ 3ODVWLFFRRNZDUH³3ODVWLFFRRNZDUHGHVLJQHGIRU
PLFURZDYHFRRNLQJLVYHU\XVHIXOEXWVKRXOGEH
XVHGFDUHIXOO\(YHQPLFURZDYHVDIHSODVWLFPD\
QRWEHDVWROHUDQWRIRYHUFRRNLQJFRQGLWLRQVDV
DUHJODVVRUFHUDPLFPDWHULDOVDQGPD\VRIWHQRU
FKDULIVXEMHFWHGWRVKRUWSHULRGVRIRYHUFRRNLQJ
,QORQJHUH[SRVXUHVWRRYHUFRRNLQJWKHIRRGDQG
FRRNZDUHFRXOGLJQLWH
)ROORZWKHVHJXLGHOLQHV
8VHPLFURZDYHVDIHSODVWLFVRQO\DQGXVH
WKHPLQVWULFWFRPSOLDQFHZLWKWKHFRRNZDUH
PDQXIDFWXUHU·VUHFRPPHQGDWLRQV
'RQRWPLFURZDYHHPSW\FRQWDLQHUV
'RQRWSHUPLWFKLOGUHQWRXVHSODVWLFFRRNZDUH
ZLWKRXWFRPSOHWHVXSHUYLVLRQ
6$9(7+(6(,16758&7,216
,03257$176$)(7<,1)250$7,21
5($'$//,16758&7,216%()25(86,1*
:$51,1*
*5281',1*,16758&7,216
:$51,1*,PSURSHUXVHRIWKHJURXQGLQJSOXJFDQUHVXOWLQDULVNRIHOHFWULFVKRFN
(QVXUHSURSHUJURXQG
H[LVWVEHIRUHXVH
7KLVDSSOLDQFHPXVWEH
JURXQGHG,QWKHHYHQWRI
DQHOHFWULFDOVKRUWFLUFXLW
JURXQGLQJUHGXFHVWKHULVNRI
HOHFWULFVKRFNE\SURYLGLQJDQ
HVFDSHZLUH
IRUWKHHOHFWULFFXUUHQW
7KLVDSSOLDQFHLVHTXLSSHGZLWKDSRZHUFRUGKDYLQJD
JURXQGLQJZLUHZLWKDJURXQGLQJSOXJ7KHSOXJPXVW
EHSOXJJHGLQWRDQRXWOHWWKDWLVSURSHUO\LQVWDOOHGDQG
JURXQGHG
'RQRWXQGHUDQ\FLUFXPVWDQFHVFXWRUUHPRYHWKHWKLUG
JURXQGSURQJIURPWKHSRZHUFRUG
'RQRWXVHDQDGDSWHUSOXJZLWKWKLVDSSOLDQFH
'RQRWXVHDQH[WHQVLRQFRUGZLWKWKLVDSSOLDQFH
,IWKHSRZHUFRUGLVWRRVKRUWKDYHDTXDOLILHGHOHFWULFLDQ
RUVHUYLFHWHFKQLFLDQLQVWDOODQRXWOHW
QHDUWKHDSSOLDQFH
)RUEHVWRSHUDWLRQSOXJWKLVDSSOLDQFHLQWRLWV
RZQHOHFWULFDORXWOHWWRSUHYHQWIOLFNHULQJRIOLJKWV
EORZLQJRIIXVHRUWULSSLQJRIFLUFXLWEUHDNHU
&RQVXOWDTXDOLILHGHOHFWULFLDQRUVHUYLFHWHFKQLFLDQ
LIWKHJURXQGLQJLQVWUXFWLRQVDUHQRWFRPSOHWHO\
XQGHUVWRRGRULIGRXEWH[LVWVDVWRZKHWKHUWKH
DSSOLDQFHLVSURSHUO\JURXQGHG
,IWKHRXWOHWLVDVWDQGDUGSURQJZDOORXWOHWLWLV\RXU
SHUVRQDOUHVSRQVLELOLW\DQGREOLJDWLRQWRKDYHLWUHSODFHG
ZLWKDSURSHUO\JURXQGHGSURQJZDOORXWOHW
7+(9(17)$1
7KHIDQZLOORSHUDWHDXWRPDWLFDOO\XQGHUFHUWDLQ
FRQGLWLRQVVHH$XWRPDWLF)DQIHDWXUH7DNHFDUH
WRSUHYHQWWKHVWDUWLQJDQGVSUHDGLQJRIDFFLGHQWDO
FRRNLQJILUHVZKLOHWKHYHQWIDQLVLQXVH
„ &OHDQWKHXQGHUVLGHRIWKHPLFURZDYHRIWHQ
'RQRWDOORZJUHDVHWREXLOGXSRQWKHPLFURZDYHRU
WKHIDQILOWHUV
„ ,QWKHHYHQWRIDJUHDVHILUHRQWKHVXUIDFHXQLWVEHORZ
WKHPLFURZDYHRYHQVPRWKHUDIODPLQJ
SDQRQWKHVXUIDFHXQLWE\FRYHULQJWKHSDQ
FRPSOHWHO\ZLWKDOLGDFRRNLHVKHHWRUDIODWWUD\
„ 8VHFDUHZKHQFOHDQLQJWKHYHQWIDQILOWHUV&RUURVLYH
FOHDQLQJDJHQWVVXFKDVO\HEDVHG
RYHQFOHDQHUVPD\GDPDJHWKHILOWHUV
„ :KHQSUHSDULQJIODPLQJIRRGVXQGHUWKHPLFURZDYH
WXUQWKHIDQRQ
„ 1HYHUOHDYHVXUIDFHXQLWVEHQHDWK\RXUPLFURZDYH
RYHQXQDWWHQGHGDWKLJKKHDWVHWWLQJV%RLORYHUV
FDXVHVPRNLQJDQGJUHDV\VSLOORYHUVWKDWPD\LJQLWH
DQGVSUHDGLIWKHPLFURZDYHYHQWIDQLVRSHUDWLQJ7R
PLQLPL]HDXWRPDWLFIDQRSHUDWLRQXVHDGHTXDWHVL]HG
FRRNZDUHDQGXVHKLJKKHDWRQVXUIDFHXQLWVRQO\
ZKHQQHFHVVDU\
3$&(0$.(56
0RVWSDFHPDNHUVDUHVKLHOGHGIURPLQWHUIHUHQFHIURPHOHFWURQLFSURGXFWVLQFOXGLQJPLFURZDYHV+RZHYHU
SDWLHQWVZLWKSDFHPDNHUVPD\ZLVKWRFRQVXOWWKHLUSK\VLFLDQVLIWKH\KDYHFRQFHUQV
5($'$1')2//2:7+,66$)(7<,1)250$7,21&$5()8//<
6$9(7+(6(,16758&7,216
2SWLRQDONLWV
*($SSOLDQFHVFRP
$YDLODEOHDWH[WUDFRVWIURP\RXU*(VXSSOLHU
)LOOHU3DQHO.LWV
)LOWHU.LWV
„
-;:+³:KLWH
„ -;³%ODFN
„
-;'³5HFLUFXODWLQJ&KDUFRDO)LOWHU.LW
:KHQUHSODFLQJDUDQJHKRRGILOOHUSDQHONLWVILOOLQWKH
DGGLWLRQDOZLGWKWRSURYLGHDFXVWRP
EXLOWLQDSSHDUDQFH
)RULQVWDOODWLRQEHWZHHQFDELQHWVRQO\QRWIRU
HQGRIFDELQHWLQVWDOODWLRQ(DFKNLWFRQWDLQV
WZRZLGHILOOHUSDQHOV
-;'
)LOWHUNLWVDUHXVHGZKHQ
WKHRYHQFDQQRWEH
YHQWHGWRWKHRXWVLGH
$YDLODEOHDWH[WUDFRVW
IURP\RXU*(VXSSOLHU
6HHWKHEDFNFRYHUIRU
RUGHULQJE\SKRQHRU
DW*($SSOLDQFHVFRP
-;-;
$ERXWWKHIHDWXUHVRI\RXURYHQ
7KURXJKRXWWKLVPDQXDOIHDWXUHVDQGDSSHDUDQFHPD\YDU\IURP\RXUPRGHO
)HDWXUHVRIWKH2YHQ
'RRU+DQGOH
'RRU/DWFKHV
5HPRYDEOH7XUQWDEOH'RQRWRSHUDWHWKHRYHQ
LQWKHPLFURZDYHPRGHZLWKRXWWKHWXUQWDEOH
DQGWXUQWDEOHVXSSRUWVHDWHGDQGLQSODFH
:LQGRZZLWK0HWDO6KLHOG6FUHHQDOORZV
FRRNLQJWREHYLHZHGZKLOHNHHSLQJPLFURZDYHV
FRQILQHGLQWKHRYHQ
5HPRYDEOH7XUQWDEOH6XSSRUW'RQRWRSHUDWH
WKHRYHQLQWKHPLFURZDYHPRGHZLWKRXWWKH
WXUQWDEOHDQGWXUQWDEOHVXSSRUWVHDWHGDQGLQ
SODFH
&RQWURO3DQHODQG6HOHFWRU'LDO
6KHOYHV8VHZLWK&219(&7,21%$.(
&219(&7,2152$67RU&20%,1$7,21)$67
%$.('RQRWXVHZKHQPLFURZDYHFRRNLQJ
)RUEHVWUHVXOWVXVHRQHVKHOILQWKHORZHU
SRVLWLRQDQGOHDYHDWOHDVWDLQFKJDSEHWZHHQ
WKHFRRNLQJGLVKDQGWKHVLGHVRIWKHRYHQ)RU
WZROHYHO%DNLQJRU)DVW%DNLQJXVHERWKVKHOYHV
$ERXWWKHFRRNLQJDQGZDUPLQJIHDWXUHVRI\RXU
PLFURZDYHFRQYHFWLRQRYHQ
*($SSOLDQFHVFRP
<RXFDQFRRNE\0LFURZDYH&RQYHFWLRQ%DNH&RQYHFWLRQ5RDVWRU&RPELQDWLRQ)DVW%DNH.HHSKRWFRRNHGIRRGVDW
VHUYLQJWHPSHUDWXUHZLWKWKH:DUPIHDWXUH
POPCORN
REHEAT
BEVERAGE
AUTO
COOK
TIME
COOK
POWER
DEFROST
MICRO
EXPRESS
CONVECTION
BAKE
OS
RN T ELECT
TU
CONVECTION
ROAST
'LDO6HOHFWRU
'LDO6HOHFWRU
COMBI
FAST BAKE
PR
CLEAR
OFF
HELP
WARM
OPTIONS
CLOCK
TIMER
AM/PM
390
ESS TO E NTE
R
START
PAUSE
TURNTABLE
ON/OFF
VENT
FAN
SURFACE
LIGHT
&90
&RRNLQJ&RQWUROV
0LFURZDYH&RRNLQJ7LPHDQG$XWR)HDWXUHV
3UHVV
7XUQDQGSXVKGLDOWRHQWHU
7,0(&22.
$PRXQWRIFRRNLQJWLPH
3UHVVRQFH7LPH&RRN,WRPLFURZDYH
DQ\WLPHEHWZHHQVHFRQGVDQGPLQXWHV
3UHVVWZLFH7LPH&RRN,,WRFKDQJHSRZHU
OHYHOVDXWRPDWLFDOO\GXULQJFRRNLQJ
0,&52(;35(66FRRN$GGVHF 6WDUWVLPPHGLDWHO\
'()5267
3UHVVRQFH)DVW
)RRGZHLJKWXSWRRQHSRXQG
3UHVVWZLFH$XWR
)RRGZHLJKWXSWRVL[SRXQGV
3UHVVWKUHHWLPHV7LPH
$PRXQWRIGHIURVWLQJWLPH
%(9(5$*(
6WDUWVLPPHGLDWHO\
3UHVVRQFH²R]
3UHVVWZLFH²R]
3UHVVWKUHHWLPHV²R]
32:(5OHYHO
3RZHUOHYHO²
6HQVRU)HDWXUHV
3UHVV
323&251
5(+($7
3UHVVRQFHSODWH
3UHVVWZLFHSDVWD
3UHVVWKUHHWLPHVøWRFXS
3UHVVIRXUWLPHVWRFXSV
$872&22.
7XUQDQGSXVKGLDOWRHQWHU 2SWLRQ
6WDUWVLPPHGLDWHO\
PRUHOHVVWLPH
6WDUWVLPPHGLDWHO\
PRUHOHVVWLPH
)RRGW\SH
PRUHOHVVWLPH
&RQYHFWLRQ%DNLQJRU&RQYHFWLRQ5RDVWLQJ
3UHVV
&219(&7,21%$.(RU
&219(&7,2152$67
7XUQDQGSXVKGLDOWRHQWHU
2YHQWHPSHUDWXUHDQGFRRNWLPH
&RPELQDWLRQ)DVW%DNLQJ
3UHVV
&20%,1$7,21)$67%$.(
7XUQDQGSXVKGLDOWRHQWHU
2YHQWHPSHUDWXUHDQGFRRNWLPH
:DUPLQJ
3UHVV
:$50
7XUQDQGSXVKGLDOWRHQWHU
2YHQWHPSHUDWXUHDQGZDUPWLPH
$YDLODEOHFRRNLQJRSWLRQV
0LFURZDYH&RRNLQJ
<RXURYHQXVHVPLFURZDYHHQHUJ\WRFRRNE\DVHWWLPHRUZHLJKWRUDXWRPDWLFDOO\E\VHQVRU
6HQVRUPLFURZDYHZRUNVE\GHWHFWLQJWKHLQFUHDVLQJKXPLGLW\UHOHDVHGGXULQJFRRNLQJ7KHRYHQ
DXWRPDWLFDOO\DGMXVWVWKHFRRNLQJWLPHWRYDULRXVW\SHVDQGDPRXQWVRIIRRG
'RQRWXVHWKHVKHOYHVZKHQ
PLFURZDYHFRRNLQJ
&RRNLQJ0HWKRG
+HDW6RXUFH
+HDW&RQGXFWLRQ
%HQHILWV
0LFURZDYHHQHUJ\
LVGLVWULEXWHGHYHQO\
WKURXJKRXWWKHRYHQ
IRUWKRURXJKIDVW
FRRNLQJRIIRRG
0LFURZDYHHQHUJ\
+HDWSURGXFHG
ZLWKLQIRRGE\
LQVWDQWHQHUJ\
SHQHWUDWLRQ
)DVWKLJKHIILFLHQF\
FRRNLQJ2YHQDQG
VXUURXQGLQJVGR
QRWJHWKRW
(DV\FOHDQXS
&RQYHFWLRQ%DNLQJDQG&RQYHFWLRQ5RDVWLQJ
'XULQJEDNLQJRUURDVWLQJDKHDWLQJHOHPHQWLVXVHGWRUDLVHWKHWHPSHUDWXUHRIWKHDLULQVLGHWKH
RYHQ$Q\RYHQWHPSHUDWXUHIURPƒ)WRƒ)PD\EHSURJUDPPHG$IDQJHQWO\FLUFXODWHVWKLV
KHDWHGDLUWKURXJKRXWWKHRYHQRYHUDQGDURXQGWKHIRRGSURGXFLQJJROGHQEURZQH[WHULRUVDQG
ULFKPRLVWLQWHULRUV7KLVFLUFXODWLRQRIKHDWHGDLULVFDOOHGFRQYHFWLRQ
%HFDXVHWKHKHDWHGDLULVNHSWFRQVWDQWO\PRYLQJQRWSHUPLWWLQJDOD\HURIFRROHUDLUWRGHYHORS
DURXQGWKHIRRGVRPHIRRGVFRRNIDVWHUWKDQLQUHJXODURYHQFRRNLQJ
$OZD\VXVHWKHVKHOIZKHQEDNLQJ
)RUEHVWUHVXOWVXVHRQHVKHOILQ
WKHORZHUSRVLWLRQ)RUWZROHYHO
FRRNLQJRQO\XVHERWKVKHOYHV
&RRNLQJ0HWKRG
+HDW6RXUFH
+HDW&RQGXFWLRQ
%HQHILWV
+RWDLUFLUFXODWHV
DURXQGIRRGWR
SURGXFHEURZQHG
H[WHULRUVDQGVHDOLQ
MXLFHV
&LUFXODWLQJKHDWHG
DLU
&RQYHFWLRQ
+HDWFRQGXFWHG
IURPRXWVLGHRIIRRG
WRLQVLGH
$LGVLQEURZQLQJ
DQGVHDOVLQIODYRU
&RRNVVRPHIRRGV
IDVWHUWKDQUHJXODU
RYHQV
&RPELQDWLRQ)DVW%DNLQJ
<RXURYHQDOVRRIIHUVWKHRSWLRQRI&RPELQDWLRQ)DVW%DNHXVLQJPLFURZDYHHQHUJ\DORQJZLWK
FRQYHFWLRQFRRNLQJ<RXFRRNZLWKVSHHGDQGDFFXUDF\ZKLOHEURZQLQJDQGFULVSLQJWRSHUIHFWLRQ
$OZD\VXVHWKHVKHOIZLWK)DVW
%DNH)RUEHVWUHVXOWVXVHRQH
VKHOILQWKHORZHUSRVLWLRQ)RU
WZROHYHOFRRNLQJRQO\XVHERWK
VKHOYHV
&RRNLQJ0HWKRG
+HDW6RXUFH
+HDW&RQGXFWLRQ
%HQHILWV
0LFURZDYHHQHUJ\
DQGFRQYHFWLRQ
KHDWFRPELQHWR
FRRNIRRGVXSWR
IDVWHUWKDQ
UHJXODURYHQV
ZKLOHEURZQLQJDQG
VHDOLQJLQMXLFHV
0LFURZDYHHQHUJ\
DQGFLUFXODWLQJ
KHDWHGDLU
)RRGKHDWVIURP
LQVWDQWHQHUJ\IURP
SHQHWUDWLRQDQG
KHDWFRQGXFWHGIURP
RXWVLGHRIIRRG
6KRUWHQHG
FRRNLQJWLPHIURP
PLFURZDYHHQHUJ\
SOXVEURZQLQJ
DQGFULVSLQJIURP
FRQYHFWLRQKHDW
:DUPLQJ
7KHZDUPLQJIHDWXUHZLOONHHSKRWFRRNHGIRRGVDWVHUYLQJWHPSHUDWXUH$OZD\VVWDUWZLWKKRW
IRRG8VHFRRNZDUHDQGXWHQVLOVWKDWFDQZLWKVWDQGWHPSHUDWXUHVXSWRƒ)
$OZD\VXVHWKHVKHOIZKHQ
ZDUPLQJ
&RRNLQJ0HWKRG
+HDW6RXUFH
+HDW&RQGXFWLRQ
%HQHILWV
:DUPDLUFLUFXODWHV
DURXQGIRRGWRNHHS
SUHYLRXVO\FRRNHG
IRRGZDUP
&LUFXODWLQJKHDWHG
DLU&RQYHFWLRQ
:DUPWKFRQGXFWHG
IURPRXWVLGHRIIRRG
WRLQVLGH
.HHSVKRWFRRNHG
IRRGVDWVHUYLQJ
WHPSHUDWXUH
$ERXWWKHWLPHDQGDXWRPLFURZDYHIHDWXUHV
*($SSOLDQFHVFRP
8VLQJWKH'LDO
<RXFDQPDNHVHOHFWLRQVRQWKHRYHQE\
WXUQLQJWKHGLDODQGSUHVVLQJLWWRHQWHU
WKHVHOHFWLRQ
3UHVVLQJWKHGLDOFDQDOVREHXVHGLQSODFH
RIWKH67$573$86(EXWWRQIRUTXLFNHU
SURJUDPPLQJRIWKHRYHQ
7LPH&RRN'RQRWXVHWKHVKHOYHVZKHQ
PLFURZDYHFRRNLQJ
7LPH&RRN,
7LPH&RRN,,
$OORZV\RXWRPLFURZDYHIRUDQ\WLPHEHWZHHQ
VHFRQGVDQGPLQXWHV
/HWV\RXFKDQJHSRZHUOHYHOVDXWRPDWLFDOO\
GXULQJFRRNLQJ+HUH·VKRZWRGRLW
3RZHUOHYHO+LJKLVDXWRPDWLFDOO\VHW
EXW\RXPD\FKDQJHLWIRUPRUHIOH[LELOLW\
3UHVVWKH7,0(&22.EXWWRQ
7XUQWKHGLDOWRVHWWKHILUVWFRRNWLPHDQG
SUHVVWKHGLDOWRHQWHU
3UHVVWKH7,0(&22.EXWWRQ
7XUQWKHGLDOWRVHWWKHFRRNWLPHDQGSUHVV &KDQJHWKHSRZHUOHYHOLI\RXGRQ·WZDQW
WKHGLDOWRHQWHU
IXOOSRZHU3UHVV32:(57XUQWKHGLDOWR
VHOHFW3UHVVWKHGLDOWRHQWHU
&KDQJHSRZHUOHYHOLI\RXGRQ·WZDQWIXOO
3UHVVWKH7,0(&22.EXWWRQDJDLQ
7XUQWKHGLDOWRVHWWKHVHFRQGFRRNWLPH
SRZHU3UHVV32:(57XUQWKHGLDOWR
VHOHFW3UHVVWKHGLDOWRHQWHU
3UHVVWKHGLDORUWKH67$573$86(EXWWRQ
DQGSUHVVWKHGLDOWRHQWHU
WRVWDUWFRRNLQJ
&KDQJHWKHSRZHUOHYHOLI\RXGRQ·WZDQW
<RXPD\RSHQWKHGRRUGXULQJ7LPH&RRN
WRFKHFNWKHIRRG&ORVHWKHGRRUDQGSUHVVWKH
GLDORU67$573$86(WRUHVXPHFRRNLQJ
IXOOSRZHU3UHVV32:(57XUQWKHGLDOWR
VHOHFW3UHVVWKHGLDOWRHQWHU
3UHVVWKHGLDORUWKH67$573$86(EXWWRQ
127(<RXPD\FKDQJHWKHFRRNWLPHDWDQ\
WLPHGXULQJFRRNLQJE\WXUQLQJWKHGLDO<RX
PD\DOVRFKDQJHWKHSRZHUOHYHOE\SUHVVLQJ
WKH32:(5EXWWRQ
WRVWDUWFRRNLQJ
$WWKHHQGRI7LPH&RRN,7LPH&RRN,,FRXQWV
GRZQ
127(<RXPD\FKDQJHWKHFRRNWLPHDWDQ\
WLPHGXULQJFRRNLQJE\WXUQLQJWKHGLDO<RX
PD\DOVRFKDQJHWKHSRZHUOHYHOE\SUHVVLQJ
WKH32:(5EXWWRQ
0LFUR([SUHVV&RRN
7KLVLVDTXLFNZD\WRVHWDQGVWDUWFRRNLQJ
LQVHFRQGEORFNVHDFKWLPHWKH0,&52
(;35(66EXWWRQLVSUHVVHG7KHFRRNWLPH
PD\EHFKDQJHGE\WXUQLQJWKHGLDODWDQ\
WLPHGXULQJFRRNLQJ
7KHSRZHUOHYHOZLOODXWRPDWLFDOO\EHVHW
DWDQGWKHRYHQZLOOVWDUWLPPHGLDWHO\
7KHSRZHUOHYHOFDQEHFKDQJHGDVWLPHLV
FRXQWLQJGRZQ3UHVVWKH32:(5EXWWRQ
WXUQWKHGLDODQGSUHVVWRHQWHU
$ERXWWKHWLPHDQGDXWRPLFURZDYHIHDWXUHV
)DVW'HIURVW'RQRWXVHWKHVKHOYHVZKHQ
PLFURZDYHFRRNLQJ
)DVW'HIURVWDXWRPDWLFDOO\VHWVWKH
GHIURVWLQJWLPHVDQGSRZHUOHYHOVWRJLYHHYHQ
GHIURVWLQJUHVXOWVIRUPHDWVSRXOWU\DQGILVK
ZHLJKLQJXSWRRQHSRXQG
&RQYHUVLRQ*XLGH
„5HPRYHPHDWIURPSDFNDJHDQGSODFHRQ
PLFURZDYHVDIHGLVK
3UHVVWKH'()5267EXWWRQRQFH
7XUQWKHGLDOWRWKHIRRGZHLJKW
XVLQJWKH&RQYHUVLRQ*XLGHDWULJKW
)RUH[DPSOHGLDOIRUSRXQGV
R]3UHVVWKHGLDOWRHQWHU
3UHVVWKH67$573$86(EXWWRQWRVWDUW
GHIURVWLQJ
7XUQWKHIRRGRYHULIWKHRYHQVLJQDOV7851
)22'29(5
,IWKHZHLJKWRIIRRGLVVWDWHGLQSRXQGVDQG
RXQFHVWKHRXQFHVPXVWEHFRQYHUWHGWR
WHQWKVRIDSRXQG
:HLJKWRI)RRG
(QWHU)RRG:HLJKW
LQ2XQFHV
WHQWKVRIDSRXQG
²
²
²
²
²
²
„5HPRYHGHIURVWHGPHDWRUVKLHOGZDUP
DUHDVZLWKVPDOOSLHFHVRIIRLO
„$IWHUGHIURVWLQJPRVWPHDWVQHHGWRVWDQG
PLQXWHVWRFRPSOHWHGHIURVWLQJ
$XWR'HIURVW'RQRWXVHWKHVKHOYHVZKHQ
PLFURZDYHFRRNLQJ
8VH$XWR'HIURVWIRUPHDWSRXOWU\DQGILVK
ZHLJKLQJXSWRVL[SRXQGV8VH7LPH'HIURVW
IRUPRVWRWKHUIUR]HQIRRGV
&RQYHUVLRQ*XLGH
$XWR'HIURVWDXWRPDWLFDOO\VHWVWKHGHIURVWLQJ
WLPHVDQGSRZHUOHYHOVWRJLYHHYHQGHIURVWLQJ
UHVXOWVIRUPHDWVSRXOWU\DQGILVK
„5HPRYHPHDWIURPSDFNDJHDQGSODFH
RQPLFURZDYHVDIHGLVK
3UHVVWKH'()5267EXWWRQWZLFH
7XUQWKHGLDOWRWKHIRRGZHLJKW
XVLQJWKH&RQYHUVLRQ*XLGHDWULJKW
)RUH[DPSOHGLDOIRUSRXQGV
SRXQGR]3UHVVWKHGLDOWRHQWHU
3UHVVWKH67$573$86(EXWWRQWRVWDUW
GHIURVWLQJ
7XUQWKHIRRGRYHULIWKHRYHQVLJQDOV7851
)22'29(5
„5HPRYHGHIURVWHGPHDWRUVKLHOGZDUP
DUHDVZLWKVPDOOSLHFHVRIIRLO
„$IWHUGHIURVWLQJPRVWPHDWVQHHGWRVWDQG
PLQXWHVWRFRPSOHWHGHIURVWLQJ/DUJHURDVWV
VKRXOGVWDQGIRUDERXW
PLQXWHV
,IWKHZHLJKWRIIRRGLVVWDWHGLQSRXQGVDQG
RXQFHVWKHRXQFHVPXVWEHFRQYHUWHGWR
WHQWKVRIDSRXQG
:HLJKWRI)RRG
(QWHU)RRG:HLJKW
LQ2XQFHV
WHQWKVRIDSRXQG
²
²
²
²
²
²
*($SSOLDQFHVFRP
7LPH'HIURVW'RQRWXVHWKHVKHOYHVZKHQ
8VH7LPH'HIURVWWRGHIURVWIRUDVHOHFWHG
OHQJWKRIWLPH
'HIURVWLQJ7LSV
PLFURZDYHFRRNLQJ
3UHVVWKH'()5267EXWWRQWKUHHWLPHV
7XUQWKHGLDOWRVHOHFWWKHWLPH\RXZDQW
3UHVVWKHGLDOWRHQWHU
3UHVVWKH67$573$86(EXWWRQWRVWDUW
GHIURVWLQJ
7XUQWKHIRRGRYHULIWKHRYHQVLJQDOV7851
)22'29(5
<RXPD\FKDQJHWKHGHIURVWWLPHDWDQ\WLPH
GXULQJGHIURVWLQJE\WXUQLQJWKHGLDO
„)RRGVIUR]HQLQSDSHURUSODVWLFFDQEH
GHIURVWHGLQWKHSDFNDJH&ORVHGSDFNDJHV
VKRXOGEHVOLWSLHUFHGRUYHQWHG$)7(5
IRRGKDVSDUWLDOO\GHIURVWHG3ODVWLFVWRUDJH
FRQWDLQHUVVKRXOGEHSDUWLDOO\XQFRYHUHG
„)DPLO\VL]HSUHSDFNDJHGIUR]HQGLQQHUVFDQ
EHGHIURVWHGDQGPLFURZDYHG,IWKHIRRGLVLQ
DIRLOFRQWDLQHUWUDQVIHULWWR
DPLFURZDYHVDIHGLVK
„)RRGVWKDWVSRLOHDVLO\VKRXOGQRWEHDOORZHG
WRVLWRXWIRUPRUHWKDQRQHKRXUDIWHU
GHIURVWLQJ5RRPWHPSHUDWXUHSURPRWHVWKH
JURZWKRIKDUPIXOEDFWHULD
3RZHUOHYHOLVDXWRPDWLFDOO\VHWDWEXWFDQEH
FKDQJHG<RXFDQGHIURVWVPDOOLWHPVTXLFNO\E\
UDLVLQJWKHSRZHUOHYHODIWHUHQWHULQJWKHWLPH
„)RUPRUHHYHQGHIURVWLQJRIODUJHUIRRGV
3RZHUOHYHOFXWVWKHWRWDOGHIURVWLQJWLPHLQ
VXFKDVURDVWVXVH$XWR'HIURVW%HVXUH
DERXWKDOISRZHUOHYHOFXWVWKHWRWDOWLPH
ODUJHPHDWVDUHFRPSOHWHO\GHIURVWHGEHIRUH
WRDSSUR[LPDWHO\+RZHYHUIRRGZLOOQHHG
FRRNLQJ
PRUHIUHTXHQWDWWHQWLRQWKDQXVXDO
„:KHQGHIURVWHGIRRGVKRXOGEHFRRO
$GXOOWKXPSLQJQRLVHPD\EHKHDUGGXULQJ
EXWVRIWHQHGLQDOODUHDV,IVWLOOVOLJKWO\LF\
GHIURVWLQJ7KLVLVQRUPDOZKHQRYHQLVQRW
UHWXUQWRWKHPLFURZDYHYHU\EULHIO\RU
RSHUDWLQJDW+LJKSRZHU
OHWLWVWDQGDIHZPLQXWHV
BEVERAGE
%HYHUDJH'RQRWXVHWKHVKHOYHVZKHQ
7KH%(9(5$*(IHDWXUHKHDWVEHYHUDJHVIURP
WRRXQFHV
'ULQNVKHDWHGZLWKWKH%HYHUDJHIHDWXUHPD\EH
YHU\KRW5HPRYHWKHFRQWDLQHUZLWKFDUH
PLFURZDYHFRRNLQJ
3UHVVRQFHIRU²R]
3UHVVWZLFHIRU²R]
3UHVVWKUHHWLPHVIRU²R]
$ERXWFKDQJLQJWKHSRZHUOHYHO
7KHSRZHUOHYHOPD\EHHQWHUHGRUFKDQJHG
LPPHGLDWHO\DIWHUHQWHULQJWKHWLPHIRU7LPH
&RRN7LPH'HIURVWRU([SUHVV&RRN7KH
SRZHUOHYHOPD\DOVREHFKDQJHGGXULQJWLPH
FRXQWGRZQ
)LUVWIROORZGLUHFWLRQVIRU7LPH&RRN7LPH
'HIURVWRU([SUHVV&RRN
3UHVVWKH32:(5EXWWRQ
7XUQWKHGLDOFORFNZLVHWRLQFUHDVHDQG
FRXQWHUFORFNZLVHWRGHFUHDVHWKHSRZHU
OHYHO3UHVVWKHGLDOWRHQWHU
3UHVVWKH67$573$86(EXWWRQWRVWDUW
FRRNLQJ
9DULDEOHSRZHUOHYHOVDGGIOH[LELOLW\WR
PLFURZDYHFRRNLQJ7KHSRZHUOHYHOVRQWKH
PLFURZDYHRYHQFDQEHFRPSDUHGWRWKH
VXUIDFHXQLWVRQDUDQJH(DFKSRZHUOHYHOJLYHV
\RXPLFURZDYHHQHUJ\DFHUWDLQSHUFHQWRIWKH
WLPH3RZHUOHYHOLVPLFURZDYHHQHUJ\
RIWKHWLPH3RZHUOHYHOLVHQHUJ\RIWKH
WLPH0RVWFRRNLQJZLOOEHGRQHRQ+LJKSRZHU
OHYHOZKLFKJLYHV\RXSRZHU3RZHU
OHYHOZLOOFRRNIDVWHUEXWIRRGPD\QHHG
PRUHIUHTXHQWVWLUULQJURWDWLQJRUWXUQLQJRYHU
$ORZHUVHWWLQJZLOOFRRNPRUHHYHQO\DQGQHHG
OHVVVWLUULQJRUURWDWLQJRIWKHIRRG6RPHIRRGV
PD\KDYHEHWWHUIODYRUWH[WXUHRUDSSHDUDQFH
LIRQHRIWKHORZHUVHWWLQJVLVXVHG8VHDORZHU
SRZHUOHYHOZKHQFRRNLQJIRRGVWKDWKDYH
DWHQGHQF\WRERLORYHUVXFKDVVFDOORSHG
SRWDWRHV
5HVWSHULRGVZKHQWKHPLFURZDYHHQHUJ\
F\FOHVRIIJLYHWLPHIRUWKHIRRGWR´HTXDOL]Hµ
RUWUDQVIHUKHDWWRWKHLQVLGHRIWKHIRRG$Q
H[DPSOHRIWKLVLVVKRZQZLWKSRZHUOHYHO³
WKHGHIURVWF\FOH,IPLFURZDYHHQHUJ\GLGQRW
F\FOHRIIWKHRXWVLGHRIWKHIRRGZRXOGFRRN
EHIRUHWKHLQVLGHZDVGHIURVWHG
+HUHDUHVRPHH[DPSOHVRIXVHVIRUYDULRXV
SRZHUOHYHOV
+LJK)LVKEDFRQYHJHWDEOHVKHDWLQJ
OLTXLGV
0HG+LJK*HQWOHFRRNLQJRIPHDWDQG
SRXOWU\EDNLQJFDVVHUROHVDQGUHKHDWLQJ
0HGLXP6ORZFRRNLQJDQGWHQGHUL]LQJIRU
VWHZVDQGOHVVWHQGHUFXWVRIPHDW
/RZRU'HIURVWLQJVLPPHULQJGHOLFDWH
VDXFHV
:DUP.HHSLQJIRRGZDUPVRIWHQLQJEXWWHU
0LFURZDYHWHUPV
7HUP
'HILQLWLRQ
$UFLQJ
&RYHULQJ
$UFLQJLVWKHPLFURZDYHWHUPIRUVSDUNVLQWKHRYHQ$UFLQJLVFDXVHGE\
„ WKHPHWDOVKHOIEHLQJLQVWDOOHGLQFRUUHFWO\DQGWRXFKLQJWKHPLFURZDYHZDOOV
„ PHWDORUIRLOWRXFKLQJWKHVLGHRIWKHRYHQ
„ IRLOWKDWLVQRWPROGHGWRIRRGXSWXUQHGHGJHVDFWOLNHDQWHQQDV
„ PHWDOVXFKDVWZLVWWLHVSRXOWU\SLQVJROGULPPHGGLVKHV
„ UHF\FOHGSDSHUWRZHOVFRQWDLQLQJVPDOOPHWDOSLHFHV
„ WKHWXUQWDEOHULQJVXSSRUWEHLQJLQVWDOOHGLQFRUUHFWO\
&RYHUVKROGLQPRLVWXUHDOORZIRUPRUHHYHQKHDWLQJDQGUHGXFHFRRNLQJWLPH9HQWLQJSODVWLFZUDSRU
FRYHULQJZLWKZD[SDSHUDOORZVH[FHVVVWHDPWRHVFDSH
6KLHOGLQJ
,QDUHJXODURYHQ\RXVKLHOGFKLFNHQEUHDVWVRUEDNHGIRRGVWRSUHYHQWRYHUEURZQLQJ:KHQPLFURZDYLQJ
\RXXVHVPDOOVWULSVRIIRLOWRVKLHOGWKLQSDUWVVXFKDVWKHWLSVRIZLQJVDQGOHJVRQSRXOWU\ZKLFKZRXOG
FRRNEHIRUHODUJHUSDUWV
6WDQGLQJ7LPH :KHQ\RXFRRNZLWKUHJXODURYHQVIRRGVVXFKDVURDVWVRUFDNHVDUHDOORZHGWRVWDQGWRILQLVKFRRNLQJRU WRVHW6WDQGLQJWLPHLVHVSHFLDOO\LPSRUWDQWLQPLFURZDYHFRRNLQJ1RWHWKDWDPLFURZDYHGFDNHLVQRW
SODFHGRQDFRROLQJUDFN
9HQWLQJ
$IWHUFRYHULQJDGLVKZLWKSODVWLFZUDS\RXYHQWWKHSODVWLFZUDSE\WXUQLQJEDFNRQHFRUQHUVRH[FHVV
VWHDPFDQHVFDSH
$ERXWWKHVHQVRUPLFURZDYHIHDWXUHV
*($SSOLDQFHVFRP
+XPLGLW\6HQVRU
:KDWKDSSHQVZKHQXVLQJWKH6HQVRU)HDWXUHV
7KH6HQVRU)HDWXUHVGHWHFWWKHLQFUHDVLQJKXPLGLW\UHOHDVHGGXULQJFRRNLQJ7KHRYHQ
DXWRPDWLFDOO\DGMXVWVWKHFRRNLQJWLPHWRYDULRXVW\SHVDQGDPRXQWVRIIRRG
'RQRWXVHWKH6HQVRU)HDWXUHVWZLFHLQVXFFHVVLRQRQWKHVDPHIRRGSRUWLRQ³LWPD\UHVXOWLQ
VHYHUHO\RYHUFRRNHGRUEXUQWIRRG,IIRRGLVXQGHUFRRNHGDIWHUWKHFRXQWGRZQXVH7LPH&RRNIRU
DGGLWLRQDOFRRNLQJWLPH
127(6HQVRUIHDWXUHVZLOOQRWRSHUDWHZKHQWKHRYHQLVKRW,IRQHRIWKHVHQVRUFRRNLQJEXWWRQVLV
SUHVVHGZKHQWKHWHPSHUDWXUHLQVLGHWKHRYHQLVJUHDWHUWKDQƒ)´29(1722+27)256(1625
&22.,1*86,1*$/7(51$7(0(7+2'µZLOOEHGLVSOD\HG7KHRYHQZLOODXWRPDWLFDOO\FKDQJH
WRFRRNE\WLPHIROORZWKHGLUHFWLRQVLQWKHGLVSOD\RURQFHWKHRYHQLVFRROHQRXJKWKHVHQVRU
IHDWXUHVZLOOIXQFWLRQQRUPDOO\
„ 7KHSURSHUFRQWDLQHUVDQGFRYHUVDUHHVVHQWLDOIRUEHVWVHQVRUFRRNLQJ
&RYHUHG
„ $OZD\VXVHPLFURZDYHVDIHFRQWDLQHUVDQGFRYHUWKHPZLWKOLGVRUYHQWHGSODVWLFZUDS1HYHU
XVHWLJKWVHDOLQJSODVWLFFRQWDLQHUV³WKH\FDQSUHYHQWVWHDPIURPHVFDSLQJDQGFDXVHIRRGWR
RYHUFRRN
9HQWHG
„ %HVXUHWKHRXWVLGHRIWKHFRRNLQJFRQWDLQHUVDQGWKHLQVLGHRIWKHPLFURZDYHRYHQDUHGU\
EHIRUHSODFLQJIRRGLQWKHRYHQ%HDGVRIPRLVWXUHWXUQLQJLQWRVWHDPFDQPLVOHDGWKHVHQVRU
'U\RIIGLVKHVVRWKH\GRQ·W
PLVOHDGWKHVHQVRU
$XWR&RRN'RQRWXVHWKHVKHOYHVZKHQPLFURZDYHFRRNLQJ
%HFDXVHPRVWFRRNLQJFRQWDLQHUVPXVWEHFRYHUHGGXULQJ$XWR&RRNWKLVIHDWXUHLVEHVWZLWK
IRRGVWKDW\RXZDQWWRVWHDPRUUHWDLQPRLVWXUH
127(8VHRIWKHPHWDOVKHOIZLWK$XWR&RRNLVQRWUHFRPPHQGHG
5HFRPPHQGHG)RRGV
$ZLGHYDULHW\RIIRRGVLQFOXGLQJPHDWVILVKDQGYHJHWDEOHVFDQEHFRRNHG
XVLQJWKLVIHDWXUH
)RRGVQRWUHFRPPHQGHG
)RRGVWKDWPXVWEHFRRNHGXQFRYHUHGIRRGVWKDWUHTXLUHFRQVWDQWDWWHQWLRQIRRGVWKDWUHTXLUH
DGGLWLRQRILQJUHGLHQWVGXULQJFRRNLQJDQGIRRGVFDOOLQJIRUDGU\ORRNRUFULVSVXUIDFHDIWHUFRRNLQJ
VKRXOGQRWEHFRRNHGXVLQJWKLVIHDWXUH,WLVEHVWWR7LPH&RRNWKHP
$ERXWWKHVHQVRUPLFURZDYHIHDWXUHV
$XWR&RRN'RQRWXVHWKHVKHOYHVZKHQ
PLFURZDYHFRRNLQJ
3ODFHFRYHUHGIRRGLQWKHRYHQDQGFORVH
WKHGRRU3UHVVWKH$872&22.EXWWRQ
(17(5)22'7<3( DSSHDUVLQWKHGLVSOD\
7XUQWKHGLDOWRWKHGHVLUHGIRRGW\SH3UHVV
WRHQWHU
6HHWKH6HQVRU)RRG7\SH*XLGH EHORZIRU
VSHFLILFIRRGVDQGLQVWUXFWLRQV
7KHRYHQVWDUWVLPPHGLDWHO\
127('RQRWXVHWKLVIHDWXUH
WZLFHLQVXFFHVVLRQRQWKH
VDPHIRRGSRUWLRQ³LWPD\
UHVXOWLQVHYHUHO\RYHUFRRNHG
RUEXUQWIRRG
127(,IWKHGRRUZDVRSHQZKLOHWKHFRQWURO
ZDVEHLQJVHWFORVHWKHGRRUDQGSUHVVWKH
67$573$86(EXWWRQWREHJLQFRRNLQJ
,IIRRGLVXQGHUFRRNHGDIWHUWKHFRXQWGRZQXVH
7LPH&RRNIRUDGGLWLRQDOFRRNLQJWLPH
'RQRWRSHQWKHRYHQGRRUEHIRUHWKH
FRXQWGRZQWLPHLVGLVSOD\HG³VWHDPHVFDSLQJ
IURPWKHRYHQFDQDIIHFWFRRNLQJSHUIRUPDQFH
,IWKHGRRULVRSHQHGFORVHWKHGRRUDQGSUHVV
67$573$86(LPPHGLDWHO\
,IJURXQGPHDWZDVVHOHFWHGWKHRYHQPD\
VLJQDO\RXWRGUDLQDQGVWLUWKHPHDW2SHQ
WKHGRRUGUDLQWKHPHDWDQGFORVHWKHGRRU
3UHVVWKH67$573$86(EXWWRQLIQHFHVVDU\WR
UHVXPHFRRNLQJ
&RRNLQJ7LSV
„
:KHQRYHQVLJQDOVDQGFRXQWGRZQWLPHLV
GLVSOD\HGWKHGRRUPD\EHRSHQHG
IRUVWLUULQJWXUQLQJRUURWDWLQJIRRG
7RUHVXPHFRRNLQJFORVHWKHGRRUDQGSUHVV
67$573$86(
„
0DWFKWKHDPRXQWRIIRRGWRWKHVL]HRI
FRQWDLQHU)LOOFRQWDLQHUVDWOHDVWIXOO
„
%HVXUHRXWVLGHRIFRQWDLQHUDQGLQVLGHRI
RYHQDUHGU\
„
$IWHUFRPSOHWLRQRI&RRNF\FOHLIIRRGQHHGV
DGGLWLRQDOFRRNLQJUHWXUQIRRGWRRYHQDQG
XVH7LPH&RRNWRILQLVKFRRNLQJ
+RZWR$GMXVWWKH2YHQ·V$XWRPDWLF
6HWWLQJVIRUD6KRUWHURU/RQJHU&RRN7LPH
1RWDYDLODEOHIRUDOOIRRGW\SHV
7RVXEWUDFWIURPWKHDXWRPDWLF
FRRNLQJWLPH
:LWKLQWKHILUVWVHFRQGVDIWHUWKHRYHQVWDUWV
WXUQWKHGLDOFRXQWHUFORFNZLVHXQWLO
DPLQXV´²µVLJQDSSHDUVDQGSUHVVWRHQWHU
7RDGGWRWKHDXWRPDWLFFRRNLQJWLPH
:LWKLQWKHILUVWVHFRQGVDIWHUWKHRYHQVWDUWV
WXUQWKHGLDOFORFNZLVHXQWLODSOXV´µVLJQ
DSSHDUVDQGSUHVVWRHQWHU
6HQVRU)RRG7\SH*XLGH
)RRG7\SH
6HUYLQJV
6HUYLQJ6L]H
&KLFNHQ3LHFHV
WR
WR
SLHFHV
8VHREORQJVTXDUHRUURXQGGLVK
&RYHUZLWKYHQWHGSODVWLFZUDS
)LVK
WR
WRR]
8VHREORQJVTXDUHRUURXQGGLVK
&RYHUZLWKYHQWHGSODVWLFZUDS
³
WRR]
8VHURXQGFDVVHUROHGLVK&UXPEOHPHDW
LQWRGLVK&RYHUZLWKYHQWHGSODVWLFZUDS
3RWDWRHV
WR
WRR]
3LHUFHVNLQZLWKIRUN$UUDQJHLQD
VWDUSDWWHUQLQFHQWHURIWXUQWDEOH
&DQQHG9HJHWDEOHV
WR
WRR]
8VHPLFURZDYHVDIHFDVVHUROHRUERZO
&RYHUZLWKOLGRUYHQWHGSODVWLFZUDS
)UHVK9HJHWDEOHV
WR
WRR]
8VHPLFURZDYHVDIHFDVVHUROHRUERZO
$GGWDEOHVSRRQVZDWHUIRUHDFKVHUYLQJ
&RYHUZLWKOLGRUYHQWHGSODVWLFZUDS
)UR]HQ9HJHWDEOHV
WR
WRR]
8VHPLFURZDYHVDIHFDVVHUROHRUERZO
)ROORZSDFNDJHLQVWUXFWLRQVIRUDGGLQJ
ZDWHU&RYHUZLWKOLGRUYHQWHGSODVWLFZUDS
*URXQG0HDW
%HHI3RUN7XUNH\
&RPPHQWV
*($SSOLDQFHVFRP
3RSFRUQ'RQRWXVHWKHVKHOYHVZKHQPLFURZDYH
7RXVHWKH3RSFRUQIHDWXUH
+RZWR$GMXVWWKH$XWRPDWLF3RSFRUQ6HWWLQJWR
3URYLGHD6KRUWHURU/RQJHU&RRN7LPH
FRRNLQJ
8VHRQO\ZLWKSUHSDFNDJHG
PLFURZDYHSRSFRUQZHLJKLQJ
WRRXQFHV
127('RQRWXVHWKLV
IHDWXUHWZLFHLQVXFFHVVLRQ
RQWKHVDPHIRRGSRUWLRQ³
LWPD\UHVXOWLQVHYHUHO\
RYHUFRRNHGRUEXUQWIRRG
)ROORZSDFNDJHLQVWUXFWLRQVXVLQJ7LPH&RRNLI
WKHSDFNDJHLVOHVVWKDQRXQFHVRUODUJHU
WKDQRXQFHV3ODFHWKHSDFNDJHRISRSFRUQ
LQWKHFHQWHURIWKHWXUQWDEOH
3UHVVWKH323&251EXWWRQ7KHRYHQVWDUWV
,I\RXILQGWKDWWKHEUDQGRISRSFRUQ\RXXVH
XQGHUSRSVRURYHUSRSVFRQVLVWHQWO\\RXFDQDGGRU
VXEWUDFW²VHFRQGVWRWKHDXWRPDWLFSRSSLQJ
WLPH
7RVXEWUDFWWLPH
:LWKLQWKHILUVWVHFRQGVDIWHUWKHRYHQVWDUWVWXUQ
WKHGLDOFRXQWHUFORFNZLVHXQWLODPLQXV
´²µVLJQDSSHDUVIRUVHFRQGVOHVVFRRNLQJWLPH
3UHVVWRHQWHU7XUQDJDLQXQWLOWZRPLQXV´²²µVLJQV
,IIRRGLVXQGHUFRRNHGDIWHUWKHFRXQWGRZQXVH7LPH DSSHDUWRUHGXFHFRRNLQJWLPHDQRWKHUVHFRQGV
&RRNIRUDGGLWLRQDOFRRNLQJWLPH
IRUDWRWDORIVHFRQGV
OHVVWLPH3UHVVWRHQWHU
LPPHGLDWHO\
,I\RXRSHQWKHGRRUZKLOH323&2516(1625
LVGLVSOD\HGDQHUURUPHVVDJHZLOODSSHDU&ORVHWKH
GRRUSUHVV&/($52))DQGEHJLQDJDLQ
7RDGGWLPH
:LWKLQWKHILUVWVHFRQGVDIWHUWKHRYHQVWDUWVWXUQ
WKHGLDOFORFNZLVHXQWLODSOXV´µVLJQDSSHDUVIRU
DQH[WUDVHFRQGVFRRNLQJWLPH3UHVVWRHQWHU
7XUQDJDLQXQWLOWZRSOXV´µVLJQVDSSHDUWR
DGGDQRWKHUVHFRQGVIRUDWRWDORIVHFRQGV
DGGLWLRQDOWLPH3UHVVWRHQWHU
REHEAT
127('RQRWXVHWKLV
IHDWXUHWZLFHLQVXFFHVVLRQ
RQWKHVDPHIRRGSRUWLRQ³
LWPD\UHVXOWLQVHYHUHO\
RYHUFRRNHGRUEXUQWIRRG
5HKHDW'RQRWXVHWKHVKHOYHVZKHQPLFURZDYH
7KH5HKHDW IHDWXUHUHKHDWVVHUYLQJVRISUHYLRXVO\
FRRNHGIRRGVRUDSODWHRIOHIWRYHUV
6RPH)RRGV1RW5HFRPPHQGHGIRU8VH
:LWK5HKHDW
3ODFHWKHFXSRIOLTXLGRUFRYHUHG
,WLVEHVWWRXVH7LPH&RRN IRUWKHVHIRRGV
FRRNLQJ
IRRGLQWKHRYHQ3UHVV5(+($7RQFHWZLFH
WKUHHWLPHVRUIRXUWLPHV7KHRYHQVWDUWV
LPPHGLDWHO\
3UHVVRQFHIRUDSODWHRIOHIWRYHUV
3UHVVWZLFHIRUDSDVWD
3UHVVWKUHHWLPHVIRUWRIXOOFXS
3UHVVIRXUWLPHVIRUWRIXOOFXSV
„ %UHDGSURGXFWV
„ )RRGVWKDWPXVWEHUHKHDWHGXQFRYHUHG
„ )RRGVWKDWQHHGWREHVWLUUHGRUURWDWHG
„ )RRGVFDOOLQJIRUDGU\ORRNRUFULVSVXUIDFHDIWHU
UHKHDWLQJ
7KHRYHQVLJQDOVZKHQVWHDPLV
+RZWR$GMXVWWKH2YHQ·V$XWRPDWLF
6HWWLQJVIRUD6KRUWHURU/RQJHU7LPH
'RQRWRSHQWKHRYHQGRRUXQWLOWLPH
LVFRXQWLQJGRZQ,IWKHGRRULVRSHQHG
FORVHLWDQGSUHVV67$573$86(LPPHGLDWHO\
7RVXEWUDFWIURPWKHDXWRPDWLF
FRRNLQJWLPH
:LWKLQWKHILUVWVHFRQGVDIWHUWKHRYHQVWDUWVWXUQ
WKHGLDOFRXQWHUFORFNZLVHXQWLODPLQXV´²µVLJQ
DSSHDUVDQGSUHVVWRHQWHU
VHQVHGDQGWKHWLPHUHPDLQLQJEHJLQV
FRXQWLQJGRZQ
$IWHUUHPRYLQJIRRGIURPWKHRYHQVWLULISRVVLEOH
WRHYHQRXWWKHWHPSHUDWXUH5HKHDWHGIRRGVPD\
KDYHZLGHYDULDWLRQVLQWHPSHUDWXUH6RPHDUHDVRI
IRRGPD\EHH[WUHPHO\KRW
,IIRRGLVQRWKRWHQRXJKDIWHUWKHFRXQWGRZQXVH
7LPH&RRNIRUDGGLWLRQDOUHKHDWLQJWLPH
7RDGGWRWKHDXWRPDWLFFRRNLQJWLPH
:LWKLQWKHILUVWVHFRQGVDIWHUWKHRYHQVWDUWVWXUQ
WKHGLDOFORFNZLVHXQWLODSOXV´µVLJQDSSHDUVDQG
SUHVVWRHQWHU
$ERXWWKHEDNLQJDQGURDVWLQJIHDWXUHV
%DNLQJRUURDVWLQJXVHVDKHDWLQJHOHPHQWWRUDLVHWKHWHPSHUDWXUHRIWKHDLULQVLGHWKHRYHQ
$Q\RYHQWHPSHUDWXUHIURPƒ)WRƒ)PD\EHVHW$IDQJHQWO\FLUFXODWHVWKLVKHDWHGDLU
WKURXJKRXWWKHRYHQRYHUDQGDURXQGWKHIRRGSURGXFLQJJROGHQEURZQH[WHULRUVDQGULFKPRLVW
LQWHULRUV7KLVFLUFXODWLRQRIKHDWHGDLULVFDOOHGFRQYHFWLRQ
&RUUHFWVKHOISRVLWLRQ
%HFDXVHWKHKHDWHGDLULVNHSWFRQVWDQWO\PRYLQJQRWSHUPLWWLQJDOD\HURIFRROHUDLUWRGHYHORS
DURXQGWKHIRRGVRPHIRRGVFRRNIDVWHUWKDQLQUHJXODURYHQFRRNLQJ
)RU%HVW5HVXOWV«
8VHRQHVKHOILQWKHORZHUSRVLWLRQDQGOHDYHDWOHDVWDLQFKJDSEHWZHHQWKHFRRNLQJGLVKDQGWKH
VLGHVRIWKHRYHQ)RUWZROHYHOFRRNLQJRQO\XVHERWKVKHOYHV
7KHVKHOILVUHTXLUHGIRUJRRGDLUFLUFXODWLRQDQGHYHQEURZQLQJ
6HHWKH&RRNZDUH7LSVVHFWLRQIRULQIRUPDWLRQRQVXJJHVWHGFRRNZDUH
,QFRUUHFWVKHOISRVLWLRQ
%DNHRU5RDVWZLWK3UHKHDW
3UHVVWKH%$.(RU52$67EXWWRQ
7XUQWKHGLDOWRVHWWKHRYHQWHPSHUDWXUH
DQGSUHVVGLDOWRHQWHU'RQRWHQWHUEDNH
WLPHQRZ7KHFRRNWLPHZLOOEHHQWHUHG
ODWHUDIWHUWKHRYHQLVSUHKHDWHG6HHWKH
$XWR5HFLSHŒ&RQYHUVLRQVHFWLRQEHORZ
&ORVHWKHRYHQGRRU7XUQWKHGLDO
WRVHWWKHFRRNWLPHDQGSUHVVWKHGLDORU
67$573$86(WRVWDUWFRRNLQJ
:KHQFRRNLQJLVFRPSOHWHWKHRYHQZLOO
VLJQDODQGWXUQRII
127(<RXPD\FKDQJHWKHFRRNWLPHDWDQ\
3UHVVWKHGLDORUWKH67$573$86(EXWWRQWR
WLPHGXULQJFRRNLQJE\WXUQLQJWKHGLDO
VWDUWSUHKHDWLQJ
<RXPD\FKDQJHWKHRYHQWHPSHUDWXUHDWDQ\
:KHQWKHRYHQLVSUHKHDWHGLWZLOOVLJQDO,I
WLPHGXULQJFRRNLQJE\SUHVVLQJWKH32:(5
\RXGRQRWRSHQWKHGRRUZLWKLQKRXUWKH EXWWRQ7XUQWKHGLDOWRVHWWKHRYHQWHPSHUDWXUH
RYHQZLOOWXUQRIIDXWRPDWLFDOO\
DQGSUHVVWKHGLDOWRHQWHU
2SHQWKHRYHQGRRUDQGXVLQJFDXWLRQ
SODFHWKHIRRGLQWKHRYHQ
7RYLHZWKHFRRNWLPHDQGRYHQWHPSHUDWXUH
GXULQJFRRNLQJSUHVVWKH%$.(EXWWRQ
%DNHRU5RDVWZLWKRXW3UHKHDWLQJ
,I\RXUUHFLSHGRHVQRWUHTXLUHSUHKHDWLQJ
127(<RXPD\FKDQJHWKHFRRNWLPHDWDQ\
WLPHGXULQJFRRNLQJE\WXUQLQJWKHGLDO
7XUQWKHGLDOWRVHWWKHRYHQWHPSHUDWXUH
DQGSUHVVWRHQWHU
<RXPD\FKDQJHWKHRYHQWHPSHUDWXUHDWDQ\
WLPHGXULQJFRRNLQJE\SUHVVLQJWKH32:(5
EXWWRQ7XUQWKHGLDOWRVHWWKHRYHQWHPSHUDWXUH
DQGSUHVVWKHGLDOWRHQWHU
SUHVVWKH%$.(RU52$67EXWWRQ6HHWKH
$XWR5HFLSHŒ&RQYHUVLRQVHFWLRQEHORZ
7XUQWKHGLDOWRVHWWKHFRRNWLPHDQGSUHVV
WRHQWHU
3UHVVWKHGLDORUWKH67$573$86(EXWWRQWR
7RYLHZWKHFRRNWLPHDQGRYHQWHPSHUDWXUH
GXULQJFRRNLQJSUHVVWKH%$.(EXWWRQ
VWDUWWKHRYHQ
$XWR5HFLSHŒ&RQYHUVLRQ
:KHQXVLQJ&219(&7,21%$.(WKH$XWR5HFLSHŒ&RQYHUVLRQIHDWXUHZLOODXWRPDWLFDOO\FRQYHUW
HQWHUHGUHJXODUEDNLQJWHPSHUDWXUHVWRFRQYHFWLRQEDNLQJWHPSHUDWXUHV
7KLVIHDWXUHLVDFWLYDWHGVRWKDWWKHGLVSOD\ZLOOVKRZ2))6(721DQGWKHDFWXDOFRQYHUWHG
UHGXFHGWHPSHUDWXUH)RUH[DPSOHLI\RXHQWHUDUHJXODUUHFLSHWHPSHUDWXUHRIƒ)DQGSUHVV
WKH67$57EXWWRQWKHGLVSOD\ZLOOVKRZWKHFRQYHUWHGWHPSHUDWXUHRIƒ)
7KLVIHDWXUHFDQEHWXUQHGRIILQWKH237,216PHQX6HHWKH$XWR5HFLSHŒ&RQYHUVLRQ6HOHFWLRQLQ
WKH$ERXWWKHRWKHUIHDWXUHVVHFWLRQ
127(,IFRQYHFWLRQEDNLQJDQGWKH$XWR5HFLSHŒ&RQYHUVLRQIHDWXUHLVWXUQHGRIIUHGXFHWKH
RYHQWHPSHUDWXUHƒ)IURPWKHUHFLSHWRSUHYHQWRYHUEURZQLQJRQWKHWRSRIEDNHGJRRGV
$ERXWWKH)DVW%DNHIHDWXUH
*($SSOLDQFHVFRP
)DVW%DNHRIIHUVWKHEHVWIHDWXUHVRIPLFURZDYHHQHUJ\DQGFRQYHFWLRQFRRNLQJ0LFURZDYHVFRRN
IRRGIDVWDQGFRQYHFWLRQFLUFXODWLRQRIKHDWHGDLUEURZQVIRRGVEHDXWLIXOO\$Q\RYHQWHPSHUDWXUH
IURPƒ)WRƒ)PD\EHVHW
)RU%HVW5HVXOWV«
&RUUHFWVKHOISRVLWLRQ
8VHRQHVKHOILQWKHORZHUSRVLWLRQDQGOHDYHDWOHDVWDLQFKJDSEHWZHHQWKHFRRNLQJGLVKDQGWKH
VLGHVRIWKHRYHQ)RUWZROHYHOFRRNLQJRQO\XVHERWKVKHOYHV
7KHVKHOILVUHTXLUHGIRUJRRGDLUFLUFXODWLRQDQGHYHQEURZQLQJ
6HHWKH&RRNZDUH7LSVVHFWLRQIRULQIRUPDWLRQRQVXJJHVWHGFRRNZDUH
6HHWKH%HVW0HWKRGRI&RRNLQJVHFWLRQWRGHWHUPLQHWKHZKLFKIRRGVDUHDSSURSULDWHWRFRRN
XVLQJ)DVW%DNH
,QFRUUHFWVKHOISRVLWLRQ
)DVW%DNHZLWK3UHKHDW
3UHVVWKH)$67%$.(EXWWRQ
7XUQWKHGLDOWRVHWWKHRYHQWHPSHUDWXUH
DQGSUHVVGLDOWRHQWHU'RQRWHQWHU
)$67%$.(FRRNWLPHQRZ7KHFRRN
WLPHZLOOEHHQWHUHGODWHUDIWHUWKHRYHQLV
SUHKHDWHG
3UHVVWKHGLDORUWKH67$573$86(EXWWRQ
WRVWDUWSUHKHDWLQJ
:KHQWKHRYHQLVSUHKHDWHGLWZLOOVLJQDO,I
\RXGRQRWRSHQWKHGRRUZLWKLQKRXUWKH
RYHQZLOOWXUQRIIDXWRPDWLFDOO\
2SHQWKHRYHQGRRUDQGXVLQJFDXWLRQ
SODFHWKHIRRGLQWKHRYHQ
&ORVHWKHRYHQGRRU7XUQWKHGLDOWRVHWWKH
FRRNWLPHDQGSUHVVWRHQWHU3UHVVWKHGLDO
RUWKH67$573$86(EXWWRQWRVWDUW
FRRNLQJ
:KHQFRRNLQJLVFRPSOHWHWKHRYHQZLOO
VLJQDODQGWXUQRII
127(<RXPD\FKDQJHWKHFRRNWLPHDWDQ\
WLPHGXULQJFRRNLQJE\WXUQLQJWKHGLDO
<RXPD\FKDQJHWKHRYHQWHPSHUDWXUHDQG
PLFURZDYHSRZHUOHYHODWDQ\WLPHGXULQJ
FRRNLQJE\SUHVVLQJWKH32:(5EXWWRQ7XUQ
WKHGLDOWRVHWWKHRYHQWHPSHUDWXUHDQG
SUHVVWKHGLDOWRHQWHU7KHQWXUQWKHGLDOWR
VHWPLFURZDYHSRZHUOHYHOWKURXJKDQG
SUHVVWKHGLDOWRHQWHU7KHGHIDXOWSRZHUOHYHO
LV
7RYLHZWKHFRRNWLPHDQGRYHQWHPSHUDWXUH
GXULQJFRRNLQJSUHVVWKH)$67%$.(EXWWRQ
„ &KHFNWKH&RRNZDUH7LSV VHFWLRQIRUFRUUHFW
FRRNZDUHZKHQXVLQJ)DVW%DNH
„ 'RQRWXVHPHWDOFRRNZDUHZLWK
)DVW%DNH
„ 5HGXFHWKHUHFLSHFRRNWLPHE\
„ 6HHWKH%HVW0HWKRGRI&RRNLQJVHFWLRQ
WRGHWHUPLQHWKHZKLFKIRRGVDUH
DSSURSULDWHWRFRRNXVLQJ)DVW%DNH
)DVW%DNHZLWKRXW3UHKHDW
,I\RXUUHFLSHGRHVQRWUHTXLUHSUHKHDWLQJ
SUHVVWKH)$67%$.(EXWWRQ
7XUQWKHGLDOWRVHWWKHRYHQWHPSHUDWXUH
DQGSUHVVWRHQWHU
7XUQWKHGLDOWRVHWWKHFRRNWLPHDQGSUHVV
WRHQWHU
3UHVVWKHGLDORUWKH67$573$86(EXWWRQ
WRVWDUWWKHRYHQ
127(<RXPD\FKDQJHWKHFRRNWLPHDW
DQ\WLPHGXULQJFRRNLQJE\WXUQLQJWKH
GLDO
<RXPD\FKDQJHWKHRYHQWHPSHUDWXUHDQG
PLFURZDYHSRZHUOHYHODWDQ\WLPHGXULQJ
FRRNLQJE\SUHVVLQJWKH32:(5EXWWRQ7XUQ
WKHGLDOWRVHWWKHRYHQWHPSHUDWXUHDQG
SUHVVWKHGLDOWRHQWHU7KHQWXUQWKHGLDOWR
VHWPLFURZDYHSRZHUOHYHOWKURXJKDQG
SUHVVWKHGLDOWRHQWHU7KHGHIDXOWSRZHUOHYHO
LV
7RYLHZWKHFRRNWLPHDQGRYHQWHPSHUDWXUH
GXULQJFRRNLQJSUHVVWKH)$67%$.(EXWWRQ
127(
„ 6RPHUHFLSHVFDOOIRUSUHKHDWLQJ
„ &KHFNWKH&RRNZDUH7LSV VHFWLRQIRUFRUUHFW
FRRNZDUHZKHQXVLQJ)DVW%DNH
„ 'RQRWXVHPHWDOFRRNZDUHZLWK
)DVW%DNH
„ 6HHWKH%HVW0HWKRGRI&RRNLQJVHFWLRQ
WRGHWHUPLQHWKHZKLFKIRRGVDUH
DSSURSULDWHWRFRRNXVLQJ)DVW%DNH
„ 5HGXFHWKHUHFLSHFRRNWLPHE\
&RRNZDUHWLSV
&RQYHFWLRQ%DNHRU5RDVW
0HWDO3DQVDUHUHFRPPHQGHGIRUDOOW\SHVRIEDNHGSURGXFWVEXWHVSHFLDOO\ZKHUHEURZQLQJ
LVLPSRUWDQW
'DUNRUGXOOILQLVKPHWDOSDQVDUHEHVWIRUEUHDGVDQGSLHVEHFDXVHWKH\DEVRUEKHDWDQG
SURGXFHFULVSHUFUXVW
6KLQ\DOXPLQXPSDQVDUHEHWWHUIRUFDNHVFRRNLHVRUPXIILQVEHFDXVHWKH\UHIOHFWKHDW
DQGKHOSSURGXFHDOLJKWWHQGHUFUXVW
*ODVVRU*ODVV&HUDPLFFDVVHUROHRUEDNLQJGLVKHVDUHEHVWVXLWHGIRUHJJDQGFKHHVHUHFLSHV
GXHWRWKHFOHDQDELOLW\RIJODVV
&RPELQDWLRQ)DVW%DNH
*ODVVRU*ODVV&HUDPLFEDNLQJFRQWDLQHUVDUHUHFRPPHQGHG%HVXUHQRWWRXVHLWHPVZLWK
PHWDOWULPDVLWPD\FDXVHDUFLQJVSDUNLQJZLWKRYHQZDOORURYHQVKHOI7KLVFDQGDPDJHWKH
FRRNZDUHWKHVKHOIRUWKHRYHQ
+HDW5HVLVWDQW3ODVWLFPLFURZDYHFRRNZDUHVDIHWRƒ)PD\EHXVHGEXWLWLVQRW
UHFRPPHQGHGIRUIRRGVUHTXLULQJDOODURXQGEURZQLQJEHFDXVHWKHSODVWLFLVDSRRU
FRQGXFWRURIKHDW
&RRNZDUH
0LFURZDYH
&RQYHFWLRQ%DNH
RU5RDVW
&RPELQDWLRQ
)DVW%DNH
+HDW5HVLVWDQW*ODVV*ODVV&HUDPLF
3\UH[ Š)LUH.LQJ Š&RUQLQJ:DUH ŠHWF
<HV
<HV
<HV
0HWDO
1R
<HV
1R
1RQ+HDW5HVLVWDQW*ODVV
1R
1R
1R
0LFURZDYH6DIH3ODVWLFV
<HV
1R
<HV
3ODVWLF)LOPVDQG:UDSV
<HV
1R
1R
3DSHU3URGXFWV
<HV
1R
1R
6WUDZ:LFNHUDQG:RRG
<HV
1R
1R
8VHRQO\PLFURZDYHFRRNZDUHWKDWLVVDIHWRƒ)
6HOHFWWKHEHVWPHWKRGRIFRRNLQJ
*($SSOLDQFHVFRP
8VHWKHIROORZLQJJXLGHWRVHOHFWWKHEHVWPHWKRGRIFRRNLQJ5HFLSHVFDQEHDGDSWHGXVLQJWKHJXLGHOLQHVEHORZWR
GHWHUPLQHWKHDSSURSULDWHFRRNLQJPRGH
)RRGV
$SSHWL]HUV
'LSVDQG6SUHDGV
3DVWU\6QDFNV
%HYHUDJHV
6DXFHVDQG7RSSLQJV
6RXSVDQG6WHZV
0HDWV
'HIURVWLQJ
5RDVWLQJ
3RXOWU\
'HIURVWLQJ
5RDVWLQJ
)LVKDQG6HDIRRG
'HIURVWLQJ
&RRNLQJ
&DVVHUROHV
(JJVDQG&KHHVH
6FUDPEOHG2PHOHWV
4XLFKH6RXIIOH
9HJHWDEOHVIUHVK
%UHDGV
0XIILQV&RIIHH&DNH
4XLFN
<HDVW
'HVVHUWV
&DNHV/D\HUDQG%XQGW
$QJHO)RRGDQG&KLIIRQ
&XVWDUGDQG3XGGLQJ
%DU&RRNLHV
)UXLW
3LHVDQG3DVWU\
&DQG\
%ODQFKLQJ9HJHWDEOHV
)UR]HQ&RQYHQLHQFH)RRGV
0LFURZDYH
%DNH
5RDVW
9
9
9
9
9
9
9
9
9
9
9
9
9
9
9
9
9
9
9
9
9
9
9
9
9
9
9
9
9
9
9
9
9
9
9
)DVW%DNH
9
9
9
9
9
9
9
5HFLSHFRQYHUVLRQV
&RPELQDWLRQ)DVW%DNH
:KHQXVLQJ&20%,1$7,21)$67%$.(UHGXFHUHFLSHFRRNWLPHE\
)RU([DPSOH$UHFLSHVWDWHVWRFRRNDURDVWIRUPLQXWHVDWƒ)
PLQXWHV[ PLQXWHVVDYHG
6RWKHQHZFRRNWLPHLQ)$67%$.(PRGHZLOOEH
PLQXWHV²PLQXWHV PLQXWHV
$ERXWWKHZDUPLQJIHDWXUH
7KH:$50IHDWXUHZLOONHHSKRWFRRNHGIRRGVDWVHUYLQJWHPSHUDWXUH$OZD\VVWDUWZLWKKRWIRRG
8VHFRRNZDUHDQGXWHQVLOVWKDWFDQZLWKVWDQGWHPSHUDWXUHVXSWRƒ)
)RU%HVW5HVXOWV«
&RUUHFWVKHOISRVLWLRQ
$OZD\VXVHWKHVKHOILQLWV´ORZµSRVLWLRQZKHQZDUPLQJ7KHVKHOILVUHTXLUHGIRUJRRGDLUFLUFXODWLRQ
DQGHYHQZDUPLQJ
6HHWKH&RRNZDUH7LSVVHFWLRQIRULQIRUPDWLRQRQVXJJHVWHGFRRNZDUH
,QFRUUHFWVKHOISRVLWLRQ
3UHVVWKH:$50EXWWRQ
7XUQWKHGLDOWRVHOHFWWKHRYHQWHPSHUDWXUH
6HHWKHFKDUWDQGWLSVEHORZ3UHVVWKHGLDO
WRHQWHU
/2:
0(',80
+,*+
ƒ)
ƒ)
ƒ)
,IWKHRYHQGRRULVRSHQHGGXULQJZDUPLQJ
3$86(ZLOODSSHDULQWKHGLVSOD\&ORVHWKHGRRU
DQGSUHVV67$573$86(
7R&ULVS6WDOH,WHPV
„ 3ODFHIRRGRUGLVKHVGLUHFWO\RQWKHVKHOILQ
WKHORZSRVLWLRQ
„ 8VH/2:VHWWLQJ
3UHVVWKHGLDORUWKH67$573$86(EXWWRQWR
VWDUWZDUPLQJ
„ &KHFNFULVSQHVVDIWHUPLQXWHV$GGWLPH
DVQHHGHG
7HPSHUDWXUH6HOHFWLRQ&KDUW
)RRG7\SH
&RQWURO6HWWLQJ
0RLVW&ULVS
%UHDG+DUG5ROOV
0HGLXP
&ULVS
%UHDG6RIW5ROOV
0HGLXP
0RLVW
&DVVHUROHV
0HGLXP
0RLVW
)ULHG)RRGV
+LJK
&ULVS
0HGLXP
&ULVS
3DQFDNHV:DIIOHV
+LJK
&ULVS
3L]]D
+LJK
&ULVS
+LJK
&ULVS
0HGLXP
0RLVW
3RXOWU\ +LJK
0RLVW
7RUWLOOD&KLSV
/RZ
&ULVS
0HGLXP
0RLVW
0HDWVDQG)LVK
3RWDWRHV%DNHG
3RWDWRHV0DVKHG
9HJHWDEOHV
86'$)6,6UHFRPPHQGVDQLQWHUQDOWHPSHUDWXUHRIƒ)DVWKHPLQLPXPGRQHQHVVIRUEHHI8VHD
SRUWDEOHPHDWWKHUPRPHWHUWRFKHFNLQWHUQDOWHPSHUDWXUHV
7LSVIRU&ULVS)RRGV
7LSVIRU0RLVW)RRGV
„ /HDYHIRRGXQFRYHUHG
„ &RYHUIRRGZLWKOLGRUDOXPLQXPIRLO
„ 'RQRWXVHSODVWLFFRQWDLQHUVRU
SODVWLFZUDS
„ 'RQRWXVHSODVWLFFRQWDLQHUVRUSODVWLFZUDS
$ERXWWKHRWKHUIHDWXUHV
+HOS
7KH+(/3EXWWRQGLVSOD\VIHDWXUHLQIRUPDWLRQ
DQGKHOSIXOKLQWV
*($SSOLDQFHVFRP
3UHVV+(/3WKHQWXUQWKHGLDOWRVHOHFW
DIHDWXUHDQGSUHVVWKHGLDOWRHQWHU
&RRNLQJ&RPSOHWH5HPLQGHU
7RUHPLQG\RXWKDW\RXKDYHIRRGLQWKHRYHQ
WKHRYHQZLOOGLVSOD\<285)22',65($'<DQG
EHHSRQFHDPLQXWHXQWLO\RXHLWKHURSHQWKH
RYHQGRRURUSUHVVWKH&/($52))EXWWRQ
5HVXPH
7KHFRRNLQJSURJUDPMXVWXVHGVWD\VLQ
PHPRU\IRUPLQXWHV$IWHUWKDW\RXZLOOQHHG
WREHJLQWKHSURJUDPDJDLQ7RWXUQWKLVRSWLRQ
RIIVHHWKH0RUH7LPH0HVVDJHVHFWLRQ
5(680(&22.,1*ZLOOEHGLVSOD\HGDQGWKH
RYHQZLOOUHVWDUWLPPHGLDWHO\DWRIWKH
RULJLQDOWLPH
,I\RXUIRRGQHHGVWRFRRNDELWORQJHU\RX
FDQUHVWDUWWKHRYHQE\SUHVVLQJWKH
67$573$86(EXWWRQRUVHOHFWRUGLDO
&ORFN
3UHVVWRHQWHUWKHWLPHRIGD\RUWRFKHFN
WKHWLPHRIGD\ZKLOHFRRNLQJ
7XUQWKHGLDOWRVHOHFW$0RU30
3UHVVWKHGLDOWRHQWHU
3UHVVWKH&/2&.EXWWRQ
7XUQWKHGLDOWRVHWKRXUV3UHVVWKHGLDOWR
HQWHU
7XUQWKHGLDOWRVHWPLQXWHV3UHVVWKHGLDOWR
HQWHU
6WDUW3DXVH
START / PAUSE
,QDGGLWLRQWRVWDUWLQJPDQ\IXQFWLRQV67$57
3$86(DOORZV\RXWRVWRSFRRNLQJZLWKRXW
RSHQLQJWKHGRRURUFOHDULQJWKHGLVSOD\
&OHDU2II
CLEAR / OFF
3UHVVWKH&/($52))EXWWRQWRVWRSDQGFDQFHO
FRRNLQJDWDQ\WLPH
&RQWURO/RFN2XW
CLEAR / OFF
<RXPD\ORFNWKHFRQWUROSDQHOWRSUHYHQWWKH
RYHQIURPEHLQJDFFLGHQWDOO\VWDUWHGGXULQJ
FOHDQLQJRUEHLQJXVHGE\FKLOGUHQ
7RORFNRUXQORFNWKHFRQWUROVSUHVVDQG
KROGWKH&/($52))EXWWRQIRUDERXWWKUHH
VHFRQGV:KHQWKHFRQWUROSDQHOLVORFNHG
&21752//2&.('ZLOOEHGLVSOD\HGEULHIO\
DQ\WLPHDEXWWRQRUGLDOLVSUHVVHG
$ERXWWKHRWKHUIHDWXUHV
$XWR1LWH/LJKW
7KH$XWR1LWH/LJKWFDQEHVHWWRFRPHRQDQG
JRRIIDWGHVLUHGWLPHV
3UHVVWKH237,216EXWWRQDQGWXUQWKHGLDO
WRVHOHFW$8721,7(/,*+73UHVVWKHGLDO
WRHQWHU
7XUQWKHGLDOWRVHOHFW6(77,0(63UHVVWKH
GLDOWRHQWHU
(QWHUWKHWLPHRIGD\IRUWKHOLJKWWRFRPH
RQE\WXUQLQJWKHGLDOWRVHOHFWWKHKRXU
PLQXWHVDQG$0RU303UHVVWKHGLDOWR
HQWHUDIWHUHDFKVHOHFWLRQ
(QWHUWKHWLPHRIGD\IRUWKHOLJKWWR
JRRIIE\WXUQLQJWKHGLDOWRVHOHFWWKHKRXU
PLQXWHVDQG$0RU303UHVVWKHGLDOWR
HQWHUDIWHUHDFKVHOHFWLRQ
127(7KH1,7(LQGLFDWRUZLOOEHOLWZKHQHYHUWKH
QLWHOLJKWLVVHWWRRSHUDWH
7RUHYLHZWKHQLWHOLJKWVHWWLQJVWXUQ
WKHGLDOWRVHOHFW5(9,(:6(77,1*6DIWHU
VHOHFWLQJWKH$XWR1LWH/LJKWRSWLRQ3UHVVWKH
GLDOWRHQWHU
7RFOHDUWKHQLWHOLJKWVHWWLQJVWXUQWKH
GLDOWRVHOHFW&/($56(77,1*6DIWHUVHOHFWLQJ
WKH$XWR1LWH/LJKWRSWLRQ3UHVVWKHGLDO
WRHQWHU
%DNH7HPS$GMXVW
%HHSHU9ROXPH
8VHWRVHWWKHRYHQWRDXWRPDWLFDOO\DGMXVWVHW
WHPSHUDWXUHVE\RUGHJUHHV
7KHEHHSHUVRXQGOHYHOFDQEHDGMXVWHG
3UHVVWKH237,216EXWWRQDQGWXUQWKHGLDO
WRVHOHFW%$.(7(03$'-8673UHVVWKHGLDO
WRHQWHU
7XUQWKHGLDOWRVHOHFW12&+$1*(
RUGHJUHHVDQGSUHVVWRHQWHU
3UHVVWKH237,216EXWWRQDQGWXUQWKHGLDO
WRVHOHFW%((3(592/80(3UHVVWKHGLDOWR
HQWHU
7XUQWKHGLDOWRVHOHFWPXWHWRORXG
3UHVVWKHGLDOWRHQWHU
127(7KH087(LQGLFDWRUZLOOEHOLWZKHQHYHU
WKHEHHSHUYROXPHLVVHWWRPXWH
$XWR5HFLSHŒ&RQYHUVLRQ6HOHFWLRQ
'LVSOD\/DQJXDJH
:KHQ21WKHRYHQZLOODXWRPDWLFDOO\
FRQYHUWHQWHUHGUHJXODUEDNLQJWHPSHUDWXUHV
WRFRQYHFWLRQEDNLQJWHPSHUDWXUHV6HH$XWR
5HFLSHŒ&RQYHUVLRQLQWKH$ERXWWKHEDNLQJ
DQGURDVWLQJIHDWXUHVVHFWLRQ
7KHODQJXDJHIRUWKHVFUROOLQJGLVSOD\FDQEH
VHWWRHLWKHU(QJOLVKRU6SDQLVK
3UHVVWKH237,216EXWWRQDQGWXUQ
WKHGLDOWRVHOHFW2))6(73UHVVWKHGLDOWR
HQWHU
3UHVVWKH237,216EXWWRQDQGWXUQWKH
GLDOWRVHOHFW',63/$</$1*8$*(3UHVV
WKHGLDOWRHQWHU
7XUQWKHGLDOWRVHOHFW(1*/,6+RU
63$1,6+3UHVVWKHGLDOWRHQWHU
7XUQWKHGLDOWRVHOHFW&219(&7,21%$.(
7(032))6(7212))DQGSUHVV
WRHQWHU
'LVSOD\212))
'LVSOD\6SHHG
8VHWRWXUQ\RXUFORFNGLVSOD\RQRURII
7KHVFUROOVSHHGRIWKHGLVSOD\FDQEH
FKDQJHG
3UHVVWKH237,216EXWWRQDQGWXUQWKH
GLDOWRVHOHFW',63/$<212))3UHVVWKH
GLDOWRHQWHU
7XUQWKHGLDOWRVHOHFW21RU2))3UHVV
WKHGLDOWRHQWHU
3UHVVWKH237,216EXWWRQDQGWXUQWKH
GLDOWRVHOHFW',63/$<63(('3UHVVWKH
GLDOWRHQWHU
7XUQWKHGLDOWRVHOHFWVORZHVWWRIDVWHVW
3UHVVWKHGLDOWRHQWHU
*($SSOLDQFHVFRP
0HDVXUHV
0RUH7LPH0HVVDJH
0HDVXUHPHQWVFDQEHVHWWRGLVSOD\LQ'HIDXOW
(QJOLVKRUPHWULF
$IWHUFRRNLQJLVFRPSOHWHDPHVVDJHFDQEH
GLVSOD\HGJLYLQJ\RXWKHRSWLRQWRFRRNWKHIRRG
ORQJHUDWWKHVDPHVHWWLQJV6HHWKH5HVXPH
VHFWLRQ
3UHVVWKH237,216EXWWRQDQGWXUQWKHGLDO
WRVHOHFW0($685(63UHVVWKHGLDOWRHQWHU
7XUQWKHGLDOWRVHOHFW'()$8/7RU0(75,&
DQGSUHVVWRHQWHU
3UHVVWKH237,216EXWWRQDQGWXUQWKHGLDO
WRVHOHFW025(7,0(0(66$*(3UHVVWKH
GLDOWRHQWHU
7XUQWKHGLDOWRVHOHFW0(66$*(21RU2))
DQGSUHVVWRHQWHU
6XUIDFH/LJKW
3UHVV685)$&(/,*+7RQFHIRUEULJKWOLJKW
WZLFHIRUWKHQLJKWOLJKWRUDWKLUGWLPHWRWXUQ
WKHOLJKWRII
7LPHU
7KH7LPHURSHUDWHVDVDPLQXWHWLPHUDQGFDQ
EHXVHGDWDQ\WLPHHYHQZKHQWKHRYHQLV
RSHUDWLQJ
3UHVVWKH7,0(5EXWWRQ
7XUQWKHGLDOWRVHOHFWWKHPLQXWHV3UHVVWKH
7RFDQFHOSUHVVWKH7,0(5EXWWRQ
:KHQWLPHLVXSWKHRYHQZLOOVLJQDO
7RWXUQRIIWKHWLPHUVLJQDOSUHVV7,0(5
127(7KH7,0(5LQGLFDWRUZLOOEHOLWZKLOHWKH
WLPHULVRSHUDWLQJ
GLDOWRHQWHU
7XUQWKHGLDOWRVHOHFWWKHVHFRQGV3UHVVWKH
GLDOWRHQWHU
3UHVVWKHGLDORU7,0(5WRVWDUW
7XUQWDEOH2Q2II
)RUEHVWFRRNLQJUHVXOWVOHDYHWKHWXUQWDEOHRQ
,WFDQEHWXUQHGRIIIRUODUJHGLVKHV
6RPHWLPHVWKHWXUQWDEOHFDQEHFRPHWRRKRW
WRWRXFK
3UHVVWKH78517$%/(212))EXWWRQ
7XUQWKHGLDOWRVHOHFW21RU2))
%HFDUHIXOWRXFKLQJWKHWXUQWDEOHGXULQJDQG
DIWHUFRRNLQJ
9HQW)DQ
$XWRPDWLF)DQ
7KHYHQWIDQUHPRYHVVWHDPDQGRWKHUYDSRUV
IURPVXUIDFHFRRNLQJ
$QDXWRPDWLFIDQIHDWXUHSURWHFWVWKH
PLFURZDYHIURPWRRPXFKKHDWULVLQJIURPWKH
FRRNWRSEHORZLW,WDXWRPDWLFDOO\WXUQVRQLILW
VHQVHVWRRPXFKKHDW
3UHVVWKHGLDOWRHQWHU
3UHVV9(17)$1RQFHIRUKLJKIDQVSHHG
WZLFHIRUPHGLXPIDQVSHHGWKUHHWLPHVIRUORZ
IDQVSHHGRUDIRXUWKWLPHWRWXUQWKHIDQRII
127(7KH)$1LQGLFDWRUZLOOEHOLWZKLOH
WKHIDQLVRSHUDWLQJ
,I\RXKDYHWXUQHGWKHIDQRQ\RXPD\ILQGWKDW
\RXFDQQRWWXUQLWRII7KHIDQZLOODXWRPDWLFDOO\
WXUQRIIZKHQWKHLQWHUQDOSDUWVDUHFRRO,W
PD\VWD\RQIRUPLQXWHVRUPRUHDIWHUWKH
FRRNWRSDQGPLFURZDYHFRQWUROVDUHWXUQHGRII
&DUHDQGFOHDQLQJRIWKHRYHQ
+HOSIXO+LQWV
$QRFFDVLRQDOWKRURXJKZLSLQJZLWKDVROXWLRQRIEDNLQJVRGDDQGZDWHUNHHSVWKHLQVLGHIUHVK
%HVXUHWKHSRZHULVRIIEHIRUHFOHDQLQJDQ\SDUWRIWKLVRYHQ
+RZWR&OHDQWKH,QVLGH
:DOOV)ORRU,QVLGH:LQGRZ0HWDODQG3ODVWLF3DUWVRQWKH'RRU
6RPHVSDWWHUVFDQEHUHPRYHGZLWKDSDSHUWRZHORWKHUVPD\UHTXLUHDGDPSFORWK5HPRYH
JUHDV\VSDWWHUVZLWKDVXGV\FORWKWKHQULQVHZLWKDGDPSFORWK'RQRWXVH
DEUDVLYHFOHDQHUVRUVKDUSXWHQVLOVRQRYHQZDOOV
1HYHUXVHDFRPPHUFLDORYHQFOHDQHURQDQ\SDUWRI\RXUPLFURZDYH
5HPRYDEOH7XUQWDEOHDQG7XUQWDEOH6XSSRUW
7RSUHYHQWEUHDNDJHGRQRWSODFHWKHWXUQWDEOHLQWRZDWHUMXVWDIWHUFRRNLQJ:DVKLWFDUHIXOO\
LQZDUPVXGV\ZDWHURULQWKHGLVKZDVKHU7KHWXUQWDEOHDQGVXSSRUWFDQEHEURNHQLIGURSSHG
5HPHPEHUGRQRWRSHUDWHWKHRYHQLQWKHPLFURZDYHPRGHZLWKRXWWKHWXUQWDEOHDQGVXSSRUW
VHDWHGDQGLQSODFH
6KHOYHV
&OHDQZLWKPLOGVRDSDQGZDWHURULQWKHGLVKZDVKHU
'RQRWFOHDQLQDVHOIFOHDQLQJRYHQ
+RZWR&OHDQWKH2XWVLGH
:HUHFRPPHQGDJDLQVWXVLQJFOHDQHUVZLWKDPPRQLDRUDOFRKRODVWKH\FDQGDPDJHWKH
DSSHDUDQFHRIWKHPLFURZDYHRYHQ,I\RXFKRRVHWRXVHDFRPPRQKRXVHKROGFOHDQHUILUVW
DSSO\WKHFOHDQHUGLUHFWO\WRDFOHDQFORWKWKHQZLSHWKHVRLOHGDUHD
&DVH
&OHDQWKHRXWVLGHRIWKHPLFURZDYHZLWKDVXGV\FORWK5LQVHDQGWKHQGU\:LSHWKHZLQGRZFOHDQ
ZLWKDGDPSFORWK
&RQWURO3DQHO
:LSHZLWKDGDPSFORWK'U\WKRURXJKO\'RQRWXVHFOHDQLQJVSUD\VODUJHDPRXQWVRIVRDSDQG
ZDWHUDEUDVLYHVRUVKDUSREMHFWVRQWKHSDQHO³WKH\FDQGDPDJHLW6RPHSDSHUWRZHOVFDQDOVR
VFUDWFKWKHFRQWUROSDQHO
'RRU3DQHO
%HIRUHFOHDQLQJWKHIURQWGRRUSDQHOPDNHVXUH\RXNQRZZKDWW\SHRISDQHO\RXKDYH5HIHUWR
WKHHLJKWKGLJLWRIWKHPRGHOQXPEHU´6µLVVWDLQOHVVVWHHO´/µLV&OHDQ6WHHODQG´%µ´:µRU´&µDUH
SODVWLFFRORUV
6WDLQOHVV6WHHORQVRPHPRGHOV
7KHVWDLQOHVVVWHHOSDQHOFDQEHFOHDQHGZLWK6WDLQOHVV6WHHO0DJLFRUDVLPLODUSURGXFWXVLQJD
FOHDQVRIWFORWK$SSO\VWDLQOHVVFOHDQHUFDUHIXOO\WRDYRLGWKHVXUURXQGLQJSODVWLFSDUWV'RQRWXVH
DSSOLDQFHZD[SROLVKEOHDFKRUSURGXFWVFRQWDLQLQJFKORULQHRQ6WDLQOHVV6WHHOILQLVKHV
*($SSOLDQFHVFRP
3ODVWLF&RORU3DQHOV
8VHDFOHDQVRIWOLJKWO\GDPSHQHGFORWKWKHQGU\WKRURXJKO\
'RRU6HDO
,W·VLPSRUWDQWWRNHHSWKHDUHDFOHDQZKHUHWKHGRRUVHDOVDJDLQVWWKHPLFURZDYH8VHRQO\PLOG
QRQDEUDVLYHGHWHUJHQWVDSSOLHGZLWKDFOHDQVSRQJHRUVRIWFORWK5LQVHZHOO
%RWWRP
&OHDQRIIWKHJUHDVHDQGGXVWRQWKHERWWRPRIWHQ8VHDVROXWLRQRIZDUPZDWHUDQGGHWHUJHQW
5HSODFLQJWKHOLJKWEXOE
&RRNWRS/LJKW1LWH/LJKW
5HPRYHVFUHZ
5HSODFHZLWKDYROWZDWWPD[
KDORJHQEXOE2UGHU:%;IURP\RXU
*(VXSSOLHU
%HVXUHWKHEXOELVFRROEHIRUHUHPRYLQJ
7RUHSODFHWKHFRRNWRSOLJKWQLWHOLJKWILUVW
6FUHZLQWKHQHZEXOEWKHQUDLVHWKHOLJKW
GLVFRQQHFWWKHSRZHUDWWKHPDLQIXVHRU
FLUFXLWEUHDNHUSDQHORUSXOOWKHSOXJ
%UHDNWKHDGKHVLYHVHDOE\JHQWO\
XQVFUHZLQJWKHEXOE
FRYHUDQGUHSODFHWKHVFUHZ&RQQHFW
HOHFWULFDOSRZHUWRWKHRYHQ
5HPRYHWKHVFUHZIURPWKHVLGHRIWKHOLJKW
FRPSDUWPHQWFRYHUDQGORZHUWKHFRYHU
XQWLOLWVWRSV
$ERXWWKHH[KDXVWIHDWXUH
&KDUFRDOILOWHURQVRPHPRGHOV
9HQW)DQ
7KHYHQWIDQKDVWZRPHWDOUHXVDEOHYHQWILOWHUV
0RGHOVWKDWUHFLUFXODWHDLUEDFNLQWRWKHURRP
DOVRXVHDFKDUFRDOILOWHU
5HXVDEOHYHQWILOWHUV
RQDOOPRGHOV
5HXVDEOH9HQW)LOWHUV
7KHPHWDOILOWHUVWUDSJUHDVHUHOHDVHGE\IRRGV
RQWKHFRRNWRS7KH\DOVRSUHYHQWIODPHVIURP
IRRGVRQWKHFRRNWRSIURPGDPDJLQJWKHLQVLGH
RIWKHRYHQ
)RUWKLVUHDVRQWKHILOWHUVPXVWDOZD\VEHLQ
SODFHZKHQWKHKRRGLVXVHG7KHYHQWILOWHUV
VKRXOGEHFOHDQHGRQFHDPRQWKRUDVQHHGHG
5HPRYLQJDQG&OHDQLQJWKH)LOWHUV
7RUHPRYHVOLGHWKHPWRWKHUHDUXVLQJWKH
WDEV3XOOGRZQDQGRXW
7RFOHDQWKHYHQWILOWHUVVRDNWKHPDQGWKHQ
VZLVKDURXQGLQKRWZDWHUDQGGHWHUJHQW'RQ·W
XVHDPPRQLDRUDPPRQLDSURGXFWVEHFDXVH
WKH\ZLOOGDUNHQWKHPHWDO/LJKWEUXVKLQJFDQ
EHXVHGWRUHPRYHHPEHGGHGGLUW
5LQVHVKDNHDQGOHWGU\EHIRUHUHSODFLQJ
7RUHSODFHVOLGHWKHILOWHUVLQWRWKHIUDPHVORWV
RQWKHEDFNRIHDFKRSHQLQJ3UHVVXSDQGWR
WKHIURQWWRORFNLQWRSODFH
*($SSOLDQFHVFRP
&KDUFRDO)LOWHU
7KHFKDUFRDOILOWHUFDQQRWEHFOHDQHG,WPXVW
EHUHSODFHG2UGHU3DUW1R:%;IURP
\RXU*(VXSSOLHU
,IWKHPRGHOLVQRWYHQWHGWRWKHRXWVLGH
WKHDLUZLOOEHUHFLUFXODWHGWKURXJKDGLVSRVDEOH
FKDUFRDOILOWHUWKDWKHOSV
UHPRYHVPRNHDQGRGRUV
7KHFKDUFRDOILOWHUVKRXOGEHUHSODFHGZKHQLWLV
QRWLFHDEO\GLUW\RUGLVFRORUHGXVXDOO\DIWHUWR
PRQWKVGHSHQGLQJ
RQXVDJH6HH´2SWLRQDO.LWVµSDJH
IRUPRUHLQIRUPDWLRQ
7R5HPRYHWKH&KDUFRDO)LOWHU
7RUHPRYHWKHFKDUFRDOILOWHUILUVWGLVFRQQHFW
/LIWWKHILOWHUDWWKHERWWRPXQWLOLWFRPHVIUHHRI
SRZHUDWWKHPDLQIXVHRUFLUFXLWEUHDNHURUSXOO WKHWDEV6OLGHWKHILOWHUGRZQDQGRXW
WKHSOXJ5HPRYHWKHWRSJULOOHE\UHPRYLQJWKH
WZRVFUHZVWKDWKROGLWLQSODFH
5HPRYHJULOOHVFUHZVWRUHPRYH
WKHJULOOH
<RXPD\QHHGWRRSHQWKHFDELQHWGRRUVWR
UHPRYHWKHVFUHZV
7R,QVWDOOWKH&KDUFRDO)LOWHU
7RLQVWDOODQHZFKDUFRDOILOWHUUHPRYHSODVWLF
DQGRWKHURXWHUZUDSSLQJIURPWKHQHZILOWHU
,QVHUWWKHWRSRIWKHILOWHUXSDQGLQWRWKH
JURRYHVRQWKHLQVLGHRIWKHWRSRSHQLQJ3XVK
WKHERWWRPRIWKHILOWHULQXQWLOLWUHVWVLQSODFH
EHKLQGWKHWDEV
%HIRUH\RXFDOOIRUVHUYLFH«
7URXEOHVKRRWLQJ7LSV
6DYHWLPHDQGPRQH\5HYLHZWKHFKDUWVRQWKHIROORZLQJ
SDJHVILUVWDQG\RXPD\QRWQHHGWRFDOOIRUVHUYLFH
3UREOHP
3RVVLEOH&DXVHV
:KDW7R'R
2YHQZLOOQRWVWDUW
$IXVHLQ\RXUKRPHPD\EH
EORZQRUWKHFLUFXLWEUHDNHU
WULSSHG
‡ 5HSODFHIXVHRUUHVHWFLUFXLWEUHDNHU
3RZHUVXUJH
‡ 8QSOXJWKHPLFURZDYHRYHQWKHQSOXJLWEDFNLQ
3OXJQRWIXOO\LQVHUWHGLQWRZDOO
RXWOHW
‡ 0DNHVXUHWKHSURQJSOXJRQWKHRYHQLVIXOO\LQVHUWHG
LQWRZDOORXWOHW
'RRUQRWVHFXUHO\FORVHG
‡ 2SHQWKHGRRUDQGFORVHVHFXUHO\
&RQWUROSDQHOOLJKWHG
\HWRYHQZLOOQRWVWDUW
'RRUQRWVHFXUHO\FORVHG
‡ 2SHQWKHGRRUDQGFORVHVHFXUHO\
67$573$86(EXWWRQQRWSUHVVHG ‡ 3UHVV67$573$86(
DIWHUHQWHULQJFRRNLQJVHOHFWLRQ
$QRWKHUVHOHFWLRQHQWHUHG
DOUHDG\LQRYHQDQG&/($52))
EXWWRQQRWSUHVVHGWRFDQFHOLW
‡ 3UHVV&/($52))
&RRNLQJWLPHQRWHQWHUHGDIWHU
SUHVVLQJ7,0(&22.
‡ 0DNHVXUH\RXKDYHHQWHUHGFRRNLQJWLPHDIWHUSUHVVLQJ
7,0(&22.
&/($52))ZDVSUHVVHG
DFFLGHQWDOO\
‡ 5HVHWFRRNLQJSURJUDPDQGSUHVV67$573$86(
)RRGZHLJKWQRWHQWHUHGDIWHU
VHOHFWLQJ$872'()5267RU
)$67'()5267
‡ 0DNHVXUH\RXKDYHHQWHUHGIRRGZHLJKWDIWHUVHOHFWLQJ
$872'()5267RU)$67'()5267
)RRGW\SHQRWHQWHUHGDIWHU
SUHVVLQJ$872&22.
‡ 0DNHVXUH\RXKDYHHQWHUHGDIRRGW\SH
&21752//2&.('
DSSHDUVRQGLVSOD\
7KHFRQWUROKDVEHHQORFNHG
‡3UHVVDQGKROG&/($52))IRUDERXWVHFRQGV
WRXQORFNWKHFRQWURO
29(1722+27)25
6(1625&22.,1*
86,1*$/7(51$7(
0(7+2'DSSHDUV
RQGLVSOD\
2QHRIWKHVHQVRUFRRNLQJ
EXWWRQVZDVSUHVVHGZKHQWKH
WHPSHUDWXUHLQVLGHWKHRYHQ
ZDVJUHDWHUWKDQƒ)
‡7KHVHIHDWXUHVZLOOQRWRSHUDWHZKHQWKHRYHQLVKRW
7KHRYHQZLOODXWRPDWLFDOO\FKDQJHWRFRRNE\WLPH
IROORZWKHGLUHFWLRQVLQWKHGLVSOD\RURQFHWKHRYHQLV
FRROHQRXJKWKHVHQVRUIHDWXUHVZLOOIXQFWLRQQRUPDOO\
)ORRURIWKHRYHQLVZDUP
HYHQZKHQWKHRYHQKDV
QRWEHHQXVHG
7KHFRRNWRSOLJKWLVORFDWHG
‡7KLVLVQRUPDO
EHORZWKHRYHQIORRU:KHQ
OLJKWLVRQWKHKHDWLWSURGXFHV
PD\PDNHWKHRYHQIORRUJHWZDUP
<RXKHDUDQXQXVXDO
ORZWRQHEHHS
<RXKDYHWULHGWRFKDQJH
WKHSRZHUOHYHOZKHQLWLV
QRWDOORZHG
‡0DQ\RIWKHRYHQ·VIHDWXUHVDUHSUHVHWDQG
FDQQRWEHFKDQJHG
2YHQHPLWVDVPRN\RGRU 2LOVRQWKHVWDLQOHVVVWHHOFDYLW\ ‡7KLVLVQRUPDO
DQGJUD\VPRNHDIWHU
DUHEXUQLQJRIIDIWHUXVLQJWKH
XVLQJWKH%DNHIHDWXUH
%DNHIHDWXUHWKHILUVWIHZWLPHV
*($SSOLDQFHVFRP
3UREOHP
3RVVLEOH&DXVHV
:KDW7R'R
)RRGEURZQVRQWRSPXFK 5DFNKDVEHHQSODFHGLQWKH
IDVWHUWKDQRQWKHERWWRP ´KLJKµSRVLWLRQ
‡ $OZD\VXVHWKHUDFNLQLWV´ORZµSRVLWLRQ
2YHQWHPSHUDWXUH
IOXFWXDWHVGXULQJFRRNLQJ
7KHFRRNLQJHOHPHQWF\FOHV
RQDQGRIIWRPDLQWDLQWKH
RYHQWHPSHUDWXUHDWWKH
GHVLUHGVHWWLQJ
‡ 7KLVLVQRUPDO
9HQWIDQFRPHVRQ
DXWRPDWLFDOO\
7KHYHQWIDQDXWRPDWLFDOO\WXUQV ‡7KLVLVQRUPDO
RQWRSURWHFWWKHPLFURZDYHLILW
VHQVHVWRRPXFKKHDWULVLQJIURP
WKHFRRNWRSEHORZ
'XULQJ%DNH5RDVWRU)DVW%DNH ‡7KLVLVQRUPDO
DIWHUSUHKHDWLQJWKHYHQWIDQ
ZLOODXWRPDWLFDOO\FRPHRQWR
FRROWKHRYHQFRPSRQHQWV
6(1625(5525DSSHDUV
RQWKHGLVSOD\
:KHQXVLQJD6HQVRUIHDWXUH
WKHGRRUZDVRSHQHGEHIRUH
VWHDPFRXOGEHGHWHFWHG
‡'RQRWRSHQGRRUXQWLOVWHDPLVVHQVHGDQGWLPH
LVVKRZQFRXQWLQJGRZQRQWKHGLVSOD\
6WHDPZDVQRWGHWHFWHGLQD
PD[LPXPDPRXQWRIWLPH
‡8VH7LPH&RRNWRKHDWIRUPRUHWLPH
%HIRUH\RXFDOOIRUVHUYLFH«
7KLQJV7KDW$UH1RUPDO:LWK<RXU0LFURZDYH2YHQ
„0RLVWXUHRQWKHRYHQGRRUDQGZDOOVZKLOH
FRRNLQJ:LSHWKHPRLVWXUHRIIZLWKD
SDSHUWRZHORUVRIWFORWK
„0RLVWXUHEHWZHHQWKHRYHQGRRUSDQHOV
ZKHQFRRNLQJFHUWDLQIRRGV0RLVWXUH
VKRXOGGLVVLSDWHVKRUWO\DIWHUFRRNLQJLV
ILQLVKHG
„6WHDPRUYDSRUHVFDSLQJIURPDURXQGWKH
GRRU
„/LJKWUHIOHFWLRQDURXQGGRRURU
RXWHUFDVH
„'LPPLQJRYHQOLJKWDQGFKDQJHLQ
WKHEORZHUVRXQGDWSRZHUOHYHOVRWKHU
WKDQKLJK
„'XOOWKXPSLQJVRXQGZKLOHRYHQLV
RSHUDWLQJ
„7KHYHQWIDQRSHUDWLQJZKLOHWKH
PLFURZDYHLVRSHUDWLQJ7KHYHQWIDQZLOO
QRWJRRIIQRUFDQLWEHWXUQHGRIIXQWLOWKH
PLFURZDYHLVRII
„:DUPFRQYHFWLRQEDNHFRQYHFWLRQ
URDVWDQGFRPELQDWLRQIDVWEDNHKDYHD
PD[LPXPFRRNLQJWLPHRIPLQXWHV
KRXUVDQGPLQXWHV:KHQWKH
PD[LPXPFRRNLQJWLPHLVUHDFKHGWKH
RYHQZLOODXWRPDWLFDOO\LQGLFDWHWKDW
FRRNLQJLVFRPSOHWHDQGWXUQRIIWKH
FRRNLQJHOHPHQW
„:KHQXVLQJFRQYHFWLRQEDNHFRQYHFWLRQ
URDVWRUFRPELQDWLRQIDVWEDNHZLWKD
SUHKHDWWKHRYHQGRRUPXVWEHRSHQHG
DQGWKHFRRNLQJWLPHVHWDIWHUSUHKHDWRU
WKHRYHQZLOOWXUQRIIWKHFRRNLQJHOHPHQW
DIWHUKRXU
„79UDGLRLQWHUIHUHQFHPLJKWEHQRWLFHG
ZKLOHXVLQJWKHPLFURZDYH6LPLODU
WRWKHLQWHUIHUHQFHFDXVHGE\RWKHUVPDOO
DSSOLDQFHVLWGRHVQRWLQGLFDWHDSUREOHP
ZLWKWKHPLFURZDYH3OXJWKHPLFURZDYH
LQWRDGLIIHUHQWHOHFWULFDOFLUFXLWPRYH
WKHUDGLRRU79DVIDUDZD\IURPWKH
PLFURZDYHDVSRVVLEOH
RUFKHFNWKHSRVLWLRQDQGVLJQDORI
WKH79UDGLRDQWHQQD
1RWHV
*($SSOLDQFHVFRP
1RWHV
*(0LFURZDYH2YHQ:DUUDQW\
$OOZDUUDQW\VHUYLFHSURYLGHGE\RXU)DFWRU\6HUYLFH&HQWHUV
RUDQDXWKRUL]HG&XVWRPHU&DUHŠWHFKQLFLDQ7RVFKHGXOHVHUYLFH
RQOLQHKRXUVDGD\YLVLWXVDW*($SSOLDQFHVFRPRUFDOO
*(&$5(63OHDVHKDYHVHULDODQGPRGHOQXPEHUV
DYDLODEOHZKHQFDOOLQJIRUVHUYLFH
6WDSOH\RXUUHFHLSWKHUH
3URRIRIWKHRULJLQDOSXUFKDVH
GDWHLVQHHGHGWRREWDLQVHUYLFH
XQGHUWKHZDUUDQW\
)RU7KH3HULRG2I *(:LOO5HSODFH
2QH<HDU
)URPWKHGDWHRIWKH
RULJLQDOSXUFKDVH
$Q\SDUWRIWKHPLFURZDYHRYHQZKLFKIDLOVGXHWRDGHIHFWLQPDWHULDOVRUZRUNPDQVKLS
'XULQJWKLVOLPLWHGRQH\HDUZDUUDQW\*(ZLOODOVRSURYLGHIUHHRIFKDUJHDOOODERUDQGUHODWHG
VHUYLFHWRUHSODFHWKHGHIHFWLYHSDUW
)LYH<HDUV
)URPWKHGDWHRIWKH
RULJLQDOSXUFKDVH
7KHPDJQHWURQWXEHLIWKHPDJQHWURQWXEHIDLOVGXHWRDGHIHFWLQPDWHULDOVRUZRUNPDQVKLS
'XULQJWKLVILYH\HDUOLPLWHGZDUUDQW\\RXZLOOEHUHVSRQVLEOHIRUDQ\ODERURULQKRPH
VHUYLFHFRVWV
:KDW*(:LOO1RW&RYHU
„ 6HUYLFHWULSVWR\RXUKRPHWRWHDFK\RXKRZWRXVH
WKHSURGXFW
„ 5HSODFHPHQWRIKRXVHIXVHVRUUHVHWWLQJRIFLUFXLW
EUHDNHUV
„ ,PSURSHULQVWDOODWLRQGHOLYHU\RUPDLQWHQDQFH
„ 'DPDJHWRWKHSURGXFWFDXVHGE\DFFLGHQWILUHIORRGV
RUDFWVRI*RG
„ 3URGXFWQRWDFFHVVLEOHWRSURYLGHUHTXLUHGVHUYLFH
„ )DLOXUHRIWKHSURGXFWRUGDPDJHWRWKHSURGXFWLILWLV
DEXVHGPLVXVHGIRUH[DPSOHFDYLW\DUFLQJIURPZLUH
UDFNRUPHWDOIRLORUXVHGIRURWKHUWKDQWKHLQWHQGHG
SXUSRVHRUXVHGFRPPHUFLDOO\
„ ,QFLGHQWDORUFRQVHTXHQWLDOGDPDJHFDXVHGE\SRVVLEOH
GHIHFWVZLWKWKLVDSSOLDQFH
„ 'DPDJHFDXVHGDIWHUGHOLYHU\
„ 5HSODFHPHQWRIWKHFRRNWRSOLJKWEXOEV
(;&/86,212),03/,(':$55$17,(6³<RXUVROHDQGH[FOXVLYHUHPHG\LVSURGXFWUHSDLUDVSURYLGHG
LQWKLV/LPLWHG:DUUDQW\$Q\LPSOLHGZDUUDQWLHVLQFOXGLQJWKHLPSOLHGZDUUDQWLHVRI
PHUFKDQWDELOLW\RUILWQHVVIRUDSDUWLFXODUSXUSRVHDUHOLPLWHGWRRQH\HDURUWKHVKRUWHVWSHULRG
DOORZHGE\ODZ
7KLVZDUUDQW\LVH[WHQGHGWRWKHRULJLQDOSXUFKDVHUDQGDQ\VXFFHHGLQJRZQHUIRUSURGXFWVSXUFKDVHGIRU
KRPHXVHZLWKLQWKH86$,IWKHSURGXFWLVORFDWHGLQDQDUHDZKHUHVHUYLFHE\D*($XWKRUL]HG6HUYLFHULV
QRWDYDLODEOH\RXPD\EHUHVSRQVLEOHIRUDWULSFKDUJHRU\RXPD\EHUHTXLUHGWREULQJWKHSURGXFWWRDQ
$XWKRUL]HG*(6HUYLFH/RFDWLRQIRUVHUYLFH,Q$ODVNDWKHZDUUDQW\H[FOXGHVWKHVHUYLFHFDOOVWR\RXUKRPH
6RPHVWDWHVGRQRWDOORZWKHH[FOXVLRQRUOLPLWDWLRQRILQFLGHQWDORUFRQVHTXHQWLDOGDPDJHV7KLVZDUUDQW\
JLYHV\RXVSHFLILFOHJDOULJKWVDQG\RXPD\DOVRKDYHRWKHUULJKWVZKLFKYDU\IURPVWDWHWRVWDWH7RNQRZ
ZKDW\RXUOHJDOULJKWVDUHFRQVXOW\RXUORFDORUVWDWHFRQVXPHUDIIDLUVRIILFHRU\RXUVWDWH·V$WWRUQH\*HQHUDO
:DUUDQWRU*HQHUDO(OHFWULF&RPSDQ\/RXLVYLOOH.<
&RQVXPHU6XSSRUW
*($SSOLDQFHV:HEVLWH
*($SSOLDQFHVFRP
+DYHDTXHVWLRQRUQHHGDVVLVWDQFHZLWK\RXUDSSOLDQFH"7U\WKH*($SSOLDQFHV:HEVLWHKRXUVDGD\
DQ\GD\RIWKH\HDU)RUJUHDWHUFRQYHQLHQFHDQGIDVWHUVHUYLFH\RXFDQQRZGRZQORDG2ZQHU·V0DQXDOV
RUGHUSDUWVFDWDORJVRUHYHQVFKHGXOHVHUYLFHRQOLQH<RXFDQDOVR´$VN2XU7HDPRI([SHUWVŒµ
\RXUTXHVWLRQVDQGVRPXFKPRUH
6FKHGXOH6HUYLFH
*($SSOLDQFHVFRP
([SHUW*(UHSDLUVHUYLFHLVRQO\RQHVWHSDZD\IURP\RXUGRRU*HWRQOLQHDQGVFKHGXOH\RXUVHUYLFHDW
\RXUFRQYHQLHQFHDQ\GD\RIWKH\HDU2UFDOO*(&$5(6GXULQJQRUPDOEXVLQHVVKRXUV
5HDO/LIH'HVLJQ6WXGLR
*($SSOLDQFHVFRP
*(VXSSRUWVWKH8QLYHUVDO'HVLJQFRQFHSW³SURGXFWVVHUYLFHVDQGHQYLURQPHQWVWKDWFDQEHXVHGE\
SHRSOHRIDOODJHVVL]HVDQGFDSDELOLWLHV:HUHFRJQL]HWKHQHHGWRGHVLJQIRUDZLGHUDQJHRISK\VLFDODQG
PHQWDODELOLWLHVDQGLPSDLUPHQWV)RUGHWDLOVRI*(·V8QLYHUVDO'HVLJQDSSOLFDWLRQVLQFOXGLQJNLWFKHQGHVLJQ
LGHDVIRUSHRSOHZLWKGLVDELOLWLHVFKHFNRXWRXU:HEVLWHWRGD\)RUWKHKHDULQJLPSDLUHGSOHDVHFDOO7''
*($&
([WHQGHG:DUUDQWLHV
*($SSOLDQFHVFRP
3XUFKDVHD*(H[WHQGHGZDUUDQW\DQGOHDUQDERXWVSHFLDOGLVFRXQWVWKDWDUHDYDLODEOHZKLOH\RXUZDUUDQW\
LVVWLOOLQHIIHFW<RXFDQSXUFKDVHLWRQOLQHDQ\WLPHRUFDOOGXULQJQRUPDOEXVLQHVVKRXUV
*(&RQVXPHU+RPH6HUYLFHVZLOOVWLOOEHWKHUHDIWHU\RXUZDUUDQW\H[SLUHV
3DUWVDQG$FFHVVRULHV
*($SSOLDQFHVFRP
,QGLYLGXDOVTXDOLILHGWRVHUYLFHWKHLURZQDSSOLDQFHVFDQKDYHSDUWVRUDFFHVVRULHVVHQWGLUHFWO\WRWKHLUKRPHV
9,6$0DVWHU&DUGDQG'LVFRYHUFDUGVDUHDFFHSWHG2UGHURQOLQHWRGD\KRXUVHYHU\GD\RU
E\SKRQHDWGXULQJQRUPDOEXVLQHVVKRXUV
,QVWUXFWLRQVFRQWDLQHGLQWKLVPDQXDOFRYHUSURFHGXUHVWREHSHUIRUPHGE\DQ\XVHU2WKHUVHUYLFLQJ
JHQHUDOO\VKRXOGEHUHIHUUHGWRTXDOLILHGVHUYLFHSHUVRQQHO&DXWLRQPXVWEHH[HUFLVHGVLQFHLPSURSHU
VHUYLFLQJPD\FDXVHXQVDIHRSHUDWLRQ
&RQWDFW8V
*($SSOLDQFHVFRP
,I\RXDUHQRWVDWLVILHGZLWKWKHVHUYLFH\RXUHFHLYHIURP*(FRQWDFWXVRQRXU:HEVLWHZLWKDOOWKHGHWDLOV
LQFOXGLQJ\RXUSKRQHQXPEHURUZULWHWR *HQHUDO0DQDJHU&XVWRPHU5HODWLRQV
*($SSOLDQFHV$SSOLDQFH3DUN
/RXLVYLOOH.<
5HJLVWHU<RXU$SSOLDQFH
*($SSOLDQFHVFRP
5HJLVWHU\RXUQHZDSSOLDQFHRQOLQH³DW\RXUFRQYHQLHQFH7LPHO\SURGXFWUHJLVWUDWLRQZLOODOORZIRU
HQKDQFHGFRPPXQLFDWLRQDQGSURPSWVHUYLFHXQGHUWKHWHUPVRI\RXUZDUUDQW\VKRXOGWKHQHHGDULVH
<RXPD\DOVRPDLOLQWKHSUHSULQWHGUHJLVWUDWLRQFDUGLQFOXGHGLQWKHSDFNLQJPDWHULDO
3ULQWHGLQ.RUHD
+RUQRGH&RQYHFFLyQ0LFURRQGDV
*(3URILOH
*($SSOLDQFHVFRP
,QVWUXFFLRQHVGHVHJXULGDG²
,QVWUXFFLRQHVGH
)XQFLRQDPLHQWR
&DPELRGHQLYHOGHSRWHQFLD &RQVHMRVGHXWHQVLOLRV
GHFRFLQD )XQFLyQGH´&DOHQWDUµ )XQFLyQGHKRUQHDGR\DVDGR
SDUFRQYHFFLyQ )XQFLyQGHKRUQHDGR
UiSLGR )XQFLRQHVGHVHQVRU ²
)XQFLRQHVGHVXKRUQR )XQFLRQHVGHWLHPSR
\DXWRPiWLFR ²
2SFLRQHVGHFRFFLyQ 2WUDVIXQFLRQHV ²
$FWLYDFLyQ'HVDFWLYDFLyQGHO
GLVSRVLWLYRJLUDWRULR $MXVWHGHODWHPSGHFRFFLyQ %ORTXHRGHOFRQWURO &/($52))
ERUUDUDSDJDGR 5(680(&RQWLQXDU &RQYHUVLyQ$XWR5HFLSHŒ ([WUDFWRUDXWRPiWLFR +(/3D\XGD ,GLRPDGHSDQWDOOD /X]QRFWXUQDDXWRPiWLFD /X]GHVXSHUILFLH 0HGLGDV 0HQVDMH´0iVWLHPSRµ 3DQWDOOD212))
HQFHQGLGDDSDJDGD 5HORM 6HxDOGHILQDOGHFRFFLyQ 67$573$86(LQLFLRSDXVD 7HPSRUL]DGRU 9HORFLGDGGHSDQWDOOD 9HQWLODGRUH[WUDFWRU 9ROXPHQGHVHxDOGHDYLVR 7DEODFRQHOPHMRUPpWRGR
SDUDFRFLQDU &DUDFWHUtVWLFDVGH
PLFURRQGDVSRUVHQVRU 7HUPLQRORJtDGHPLFURRQGDV 0DQXDOGHO
3URSLHWDULR
390
&90
&XLGDGR\/LPSLH]D
$FHURLQR[LGDEOH ([WHULRU )LOWURVGHFDUEyQYHJHWDO )LOWURVGHOH[WUDFWRU
,QWHULRU 5HHPSOD]RGHERPELOODV 5HVROXFLyQGH3UREOHPDV
&RVDVQRUPDOHVGHVXKRUQR
PLFURRQGDV $\XGDDO&OLHQWH
$\XGDDO&OLHQWH FXELHUWDWUDVHUD
*DUDQWtD .LWVRSFLRQDOHV $QRWHDTXtORVQ~PHURVGHPRGHOR
\GHVHULH
0RGHORQ~PHURBBBBBBBBBBBBBBBBBBBB
1~PHURGHVHULH BBBBBBBBBBBBBBBBBBB
/RVHQFRQWUDUiHQXQDHWLTXHWDDODEULU
ODSXHUWD
0)/*(
,16758&&,21(6,03257$17(6'(6(*85,'$'
/($35,0(5272'$/$6,16758&&,21(6
&XDQGRVHXVHQDSDUDWRVHOpFWULFRVVLHPSUHGHEHQVHJXLUVHSUHFDXFLRQHVEiVLFDVGHVHJXULGDGLQFOX\HQGRODV
VLJXLHQWHV
£35(&$8&,Ï1
3RUVXVHJXULGDGODLQIRUPDFLyQFRQWHQLGDHQHVWHPDQXDOGHEHVHJXLUVHSDUDPLQLPL]DUHOULHVJRGHLQFHQGLR
H[SORVLyQGHVFDUJDHOpFWULFDH[SRVLFLyQDHQHUJtDPLFURRQGDVRSDUDHYLWDUGDxRVDODSURSLHGDGOHVLRQHVSHUVRQDOHV
RSpUGLGDGHYLGD
35(&$8&,21(63$5$(9,7$5326,%/((;326,&,Ï1
$81$(;&(6,9$(1(5*Ë$'(0,&5221'$6
D 1R,QWHQWHRSHUDUHVWHKRUQRFRQODSXHUWDDELHUWD\D
TXHHVWRSRGUtDUHVXOWDUHQXQDH[SRVLFLyQDHQHUJtD
PLFURRQGDVGDxLQD(VLPSRUWDQWHQRFDQFHODUQL
PDQLSXODUGHIRUPDLQGHELGDORVGLVSRVLWLYRVGH
VHJXULGDG
F 1R8VHHOKRUQRVLHVWiGDxDGR(VHVSHFLDOPHQWH
LPSRUWDQWHTXHODSXHUWDGHOKRUQRVHFLHUUH
FRUUHFWDPHQWH\TXHQRVHGDxH
ODSXHUWDGREODGD
E 1R6LW~H QLQJ~QREMHWRHQWUHODSDUWHIURQWDOGHOKRUQR
\ODSXHUWDQLSHUPLWDTXHVHDFXPXOHVXFLHGDGR
UHVLGXRVOLPSLRVHQODVJRPDVGHFLHUUHKHUPpWLFR
ELVDJUDV\SDVDGRUHVURWRVRVXHOWRV
VHOORVGHODSXHUWD\JRPDVGHFLHUUHKHUPpWLFR
„/HDWRGDVODVLQVWUXFFLRQHVDQWHVGHXWLOL]DUHVWH
DSDUDWR$OXWLOL]DUDSDUDWRVHOpFWULFRVVHGHEHQVHJXLU
SUHFDXFLRQHVEiVLFDVGHVHJXULGDGLQFOX\HQGRODV
VLJXLHQWHV
„/HD\REHGH]FDODVSUHFDXFLRQHVHVSHFtILFDVHQODVHFFLyQ
GH35(&$8&,21(63$5$(9,7$5326,%/((;326,&,Ï1$81$
(1(5*Ë$(;&(6,9$'(0,&5221'$6GHDUULED
„(VWHHOHFWURGRPpVWLFRGHEHHVWDUFRQHFWDGRDWLHUUD&RQpFWHOR
VyORDXQDWRPDGHFRUULHQWHFRQWRPDGHWLHUUD9HDODVHFFLyQ
GH,16758&&,21(6'(720$'(7,(55$HQODSiJLQD
„(VWHKRUQRGHPLFURRQGDVHVWiOLVWDGRSRU8/SDUDVHULQVWDODGR
VREUHHVWXIDVHOHFWULFDV\GHJDVHQUDQJRV
„(VWHKRUQRSXHGHLQVWDODUVHHQFLPDGHODFRFLQD\HVWiGLVHxDGR
SDUDVXXVRVREUHFRFLQDVHQFLPHUDVQRPiVDQFKDVGH
3XHGHLQVWDODUVHVREUHHTXLSRVSDUDFRFLQDUGHJDVRHOpFWULFRV
„1RXVDUHVWHHOHFWURGRPpVWLFRVLHOFDEOHGHFRUULHQWHRHO
HQFKXIHKDQVXIULGRDOJ~QGDxRVLQRIXQFLRQDFRUUHFWDPHQWHR
VLKDUHVXOWDGRGDxDGRRVHKDFDtGR6LHOFDEOHGHFRUULHQWHKD
VLGRGDxDGRGHEHVHUUHHPSOD]DGRSRUHO6HUYLFLR5HSDUDFLRQHV
GH*HQHUDO(OHFWULF*(6HUYLFHRXQDJHQWH
GHUHSDUDFLRQHVDXWRUL]DGRHPSOHDQGRXQFDEOHGHFRUULHQWHTXH
*HQHUDO(OHFWULFWLHQHDVXGLVSRVLFLyQ
„,QVWDOHRFRORTXHHVWHHOHFWURGRPpVWLFRVLJXLHQGRVyORODV
,QVWUXFFLRQHVGH,QVWDODFLyQSURYLVWDV
G (OKRUQRQRGHEHUtDDMXVWDUVHQLUHSDUDUVHSRUQDGLH
TXHQRVHDSHUVRQDOGHVHUYLFLRDGHFXDGDPHQWH
FDOLILFDGR
„3DUDUHGXFLUHOULHVJRGHLQFHQGLRHQODDSHUWXUDGHOKRUQR
³1RFRFLQHGHPDVLDGRODFRPLGD3UHVWHDWHQFLyQFXLGDGRVD
DOHOHFWURGRPpVWLFRFXDQGRVHFRORFDSDSHOSOiVWLFRXRWUR
PDWHULDOFRPEXVWLEOHHQHOKRUQRPLHQWUDVVHFRFLQD
³4XLWHODVFLQWDVGHFLHUUHFRQPHWDO\ODVDVDVPHWiOLFDVGH
ORVUHFLSLHQWHVGHSDSHORSOiVWLFRDQWHVGHLQWURGXFLUORVHQ
HOKRUQR
³1RDOPDFHQHFRVDVHQHOKRUQR1RGHMHSURGXFWRVGHSDSHO
XWHQVLOLRVGHFRFLQDUQLFRPLGDHQHOKRUQRPLHQWUDVQROR
HVWpXVDQGR
³1RKDJDURVHWDVRSDORPLWDVGHPDt]HQHOPLFURRQGDVDQRVHU
TXHHVWpXVDQGRXQDFFHVRULRHVSHFLDOSDUDSUHSDUDUODVRTXH
HVWpHPSOHDQGRURVHWDVRSDORPLWDVGHPDt]TXHLQGLTXHQVHU
YiOLGDVSDUDHOXVRGHKRUQRVPLFURRQGDV
³6LVHLQFHQGLDUDDOJ~QPDWHULDOGHQWURPDQWHQJDODSXHUWD
GHOKRUQRFHUUDGDDSDJXHHOKRUQR\GHVFRQHFWHHOFDEOHGH
FRUULHQWHHOpFWULFDRDSDJXHODFRUULHQWHHQHOIXVLEOHRSDQHOGHO
GLIHUHQFLDO6LVHDEUHODSXHUWDHOIXHJRSRGUtDH[SDQGLUVH
³1RXWLOLFHODVFDUDFWHUtVWLFDVGH6HQVRUGRVYHFHVFRQVHFXWLYDVHQ
ODPLVPDSRUFLyQGHFRPLGD6LODFRPLGDQRVHKDFRFLQDGRSRU
FRPSOHWRGHVSXpVGHODSULPHUDFXHQWDUHJUHVLYDXVHODIXQFLyQ
7LPH&RRNSDUDWLHPSRGHFRFFLyQDGLFLRQDO
³1RXVHHOKRUQRSDUDVHFDUSHULyGLFRV
*8$5'((67$6,16758&&,21(6
*($SSOLDQFHVFRP
,16758&&,21(6,03257$17(6'(6(*85,'$'
„$OXWLOL]DUODVIXQFLRQHVGH+RUQHDGR%DNH$VDGR5RDVW
X+RUQHDGRUiSLGR)DVW%DNHWDQWRHOH[WHULRUFRPRHO
LQWHULRUGHOKRUQRPLFURRQGDVHVWDUiQDDOWDVWHPSHUDWXUDV
8WLOLFHVLHPSUHPDQRSODVGHFRFLQDSDUDVDFDUORV
UHFLSLHQWHVGHFRPLGD\ORVDFFHVRULRVFRPRSRUHMHPSORHO
HVWDQWHGHOKRUQR
„7HUPyPHWUR³QRXWLOLFHWHUPyPHWURVGHFRFLQDRGHKRUQR
FRQYHQFLRQDOHVDOFRFLQDUFRQPLFURRQGDVRPHGLDQWH
HOPRGR+RUQHDGRUiSLGR(OPHWDO\PHUFXULRHQHVWRV
WHUPyPHWURVSRGUtDFDXVDUODIRUPDFLyQGHDUFRV
HOpFWULFRV\SRVLEOHPHQWHGDxDUHOKRUQR1RXVHXQ
WHUPyPHWURHQODFRPLGDTXHHVWpFDOHQWDQGRHQHOKRUQR
PLFURRQGDVDQRVHUTXHHOWHUPyPHWURHVWpGLVHxDGRR
UHFRPHQGDGRSDUDVXXVRHQXQKRUQRPLFURRQGDV
„1RXVHHVWURSDMRVRIUHJDGRVPHWiOLFRVSDUDOLPSLDU
3RGUtDQFDHUSDUWHVGHOHVWURSDMR\WRFDUHOHPHQWRV
HOpFWULFRVTXHSXGLHUDQFDXVDUXQDGHVFDUJDHOpFWULFD
„1RDOPDFHQHQLQJ~QPDWHULDOTXHQRVHDXQRGHORV
DFFHVRULRVTXHUHFRPHQGDPRVHQHVWHKRUQRFXDQGR
QRHVWpXViQGRVH
„1RDOPDFHQHHVWHHOHFWURGRPpVWLFRDODLUHOLEUH1RXVH
HVWHSURGXFWRFHUFDGHODJXD³SRUHMHPSORHQXQVyWDQR
PRMDGRFHUFDGHXQDDOEHUFDFHUFDGHXQIUHJDGHURRHQ
OXJDUHVVLPLODUHV
„0DQWHQJDHOFDEOHGHFRUULHQWHDOHMDGRGHVXSHUILFLHV
FDOLHQWHV
„1RVXPHUMDHOFDEOHGHFRUULHQWHQLHOHQFKXIHHQDJXD
„1RPRQWHHVWHHOHFWURGRPpVWLFRVREUHXQIUHJDGHUR
„5HYLVHODVLQVWUXFFLRQHVGHOLPSLH]DGHODVXSHUILFLHGH
ODSXHUWDHQODVHFFLyQ&XLGDGR\OLPSLH]DGHOKRUQR
PLFURRQGDVGHHVWHPDQXDO
„/DVUHSDUDFLRQHVGHHVWHHOHFWURGRPpVWLFRGHEHUtDQVHU
UHDOL]DGDVVyORSRUSHUVRQDOFXDOLILFDGR3yQJDVHHQ
FRQWDFWRFRQHOFHQWURGHVHUYLFLRDXWRUL]DGRPiVFHUFDQR
SDUDVXUHYLVLyQUHSDUDFLyQRDMXVWH
„(OXVRGHFXDOTXLHUHOHFWURGRPpVWLFRSRUSDUWHGHQLxRV
GHEHUtDVHUVXSHUYLVDGRGHFHUFDSRUXQDGXOWR
„1RDOPDFHQHQDGDGLUHFWDPHQWHHQFLPDGHODVXSHUILFLH
GHOPLFURRQGDVFXDQGRHVWpHQRSHUDFLyQ
„1RPRQWHHVWHDSDUDWRDUULEDGHOIUHJDGHUR
„1RDOPDFHQHPDWHULDOHVTXHQRVHDQQXHVWURVDFFHVRULRV
UHFRPHQGDGRVHQHVWHKRUQRFXDQGRQRVHHQFXHQWUHHQXVR
„1RXWLOLFHSURGXFWRVGHSDSHOFXDQGRHODSDUDWRVHXWLOL]D
HQPRGRVGLIHUHQWHVDOPLFURRQGDV
£35(&$8&,Ï1
)250$&,Ï1'($5&2(/e&75,&2
6LYHTXHVHIRUPDQDUFRVHOpFWULFRVSUHVLRQHHOERWyQ&/($52))ERUUDUDSDJDGR\UHVXHOYDHO
SUREOHPD
$UFRHOpFWULFRHVORTXHHQODWHUPLQRORJtDGHORV
PLFURRQGDVGHVFULEHODVFKLVSDVHQHOKRUQR
(ODUFRHOpFWULFRVHSURGXFHFXDQGR
„(OHVWDQWHPHWiOLFRQRHVWiLQVWDODGRFRUUHFWDPHQWH
\WRFDODSDUHGGHOPLFURRQGDV
„+D\XQPHWDORSDSHOGHDOXPLQLRWRFDQGRHOODWHUDO
GHOKRUQR
„(OVRSRUWHGHODURJLUDWRULRQRHVWiLQVWDODGR
FRUUHFWDPHQWH
„(OSDSHOGHDOXPLQLRQRHVWiHQYROYLHQGRELHQOD
FRPLGDKD\ERUGHVGREODGRVKDFLDDUULEDTXH
DFW~DQFRPRDQWHQDV
„+D\DOJ~QPHWDOFRPRFLQWDVGHFLHUUHFRQPHWDO
SLQFKRVGHSROORRSODWRVFRQGHFRUDFLyQGHRUR
GHQWURGHOPLFURRQGDV
„6HHVWiXVDQGRSDSHOWRDOODUHFLFODGRTXHFRQWLHQHQ
SHTXHxDVSRUFLRQHVGHPHWDOHQ
HOPLFURRQGDV
*8$5'((67$6,16758&&,21(6
,16758&&,21(6,03257$17(6'(6(*85,'$'
/($35,0(5272'$6/$6,16758&&,21(6
£35(&$8&,Ï1
&20,'$6
„1RKDJDURVHWDVRSDORPLWDVGHPDt]HQHO
PLFURRQGDVDQRVHUTXHHVWpXVDQGRXQDFFHVRULR
HVSHFLDOSDUDSUHSDUDUODVRTXHHVWpHPSOHDQGR
URVHWDVRSDORPLWDVGHPDt]TXHLQGLTXHQVHU
YiOLGDVSDUDHOXVRGHKRUQRVPLFURRQGDV
„1RKLHUYDKXHYRVGHQWURGHXQKRUQRPLFURRQGDV
6HJHQHUDUiSUHVLyQGHQWURGHOD\HPDGHOKXHYR
TXHFDXVDUiTXHH[SORWHSXGLHQGRSRVLEOHPHQWH
GDxDUDDOJXLHQ
„6LVHSRQHHQPDUFKDHOPLFURRQGDVVLQWHQHU
FRPLGDHQVXLQWHULRUSRUPiVGHXQPLQXWRRGRV
SRGUtDQFDXVDUVHGDxRVDOKRUQR\SRGUtDHPSH]DU
XQIXHJR(VWRKDFHDXPHQWDUODWHPSHUDWXUD
DOUHGHGRUGHOPDJQHWUyQ\SXHGHUHGXFLUHOSHUtRGR
GHYLGD~WLOGHOKRUQR
„1RFDOLHQWHODFRPLGDGHOEHEpHQMDUUDVGHFULVWDO
LQFOXVRVLHVWiQGHVWDSDGDV$VHJ~UHVHGHTXH
ORVDOLPHQWRVGHORVQLxRVHVWpQELHQFRFLQDGRV
5HPXHYDODFRPLGDSDUDGLVWULEXLUHOFDORUGHIRUPD
SDUHMD7HQJDFXLGDGRGHTXHHOQLxRQRVHTXHPH
DOFDOHQWDUODOHFKHGHIyUPXOD(OFRQWHQHGRU
SXHGHSDUHFHUPiVIUtRGHORTXHUHDOPHQWHHVWiOD
IyUPXOD3UXHEHVLHPSUHODIyUPXODDQWHVGHGiUVHOD
DOEHEp
„'HEHUtDFRUWDUVHOD´SLHOµH[WHUQDGHDTXHOORV
DOLPHQWRVTXHQRODWHQJDQURWDFRPRODVSDSDV
VDOFKLFKDVHPEXWLGRVWRPDWHVPDQ]DQDVKtJDGRV
GHSROOR\GHPiVPHQXGLOORVGHDYHV\\HPDVGH
KXHYRVSDUDSHUPLWLUODVDOLGDGHYDSRUPLHQWUDVVH
FRFLQDQ
„1RGHVFRQJHOHEHELGDVFRQJHODGDVHQERWHOODV
GHFXHOORHVWUHFKRHVSHFLDOPHQWHEHELGDV
FDUERQDWDGDV,QFOXVRFRQHOFRQWHQHGRUDELHUWR
SRGUtDJHQHUDUVHXQDXPHQWRGHSUHVLyQ(VWR
SXHGHFDXVDUTXHHOFRQWHQHGRUH[SORWHORFXDO
SRGUtDSURGXFLUGDxRVSHUVRQDOHV
„$*8$62%5(&$/(17$'$
„/RVDOLPHQWRVFDOLHQWHV\HOYDSRUSXHGHQFDXVDU
TXHPDGXUDV7HQJDFXLGDGRDODEULUFXDOTXLHU
FRQWHQHGRUFRQFRPLGDFDOLHQWHLQFOXVREROVDV
GHURVHWDVRSDORPLWDVGHPDt]EROVDVRFDMDVGH
FRFLQDU3DUDSUHYHQLUSRVLEOHVGDxRVSHUVRQDOHV
PDQWHQJDHOYDSRUDOHMDGRGHVXVPDQRV\URVWUR
/tTXLGRVWDOHVFRPRDJXDFDIpRWpVHSRGUtDQ
VREUHFDOHQWDUPiVDOOiGHOSXQWRGHHEXOOLFLyQVLQ
SDUHFHUTXHHVWpQKLUYLHQGR1RVLHPSUHKDEUi
EXUEXMDVRHYLGHQFLDGHTXHHOOtTXLGRHVWiKLUYLHQGR
FXDQGRVHH[WUDHHOHQYDVHFRQHOOtTXLGRGHO
PLFURRQGDV(67232'5Ë$5(68/7$5(1/Ë48,'26
08<&$/,(17(6'(5(3(17(&20(1=$1'2$
+(59,5<$5(%26$56(&8$1'2(/(19$6((6
029,'226,81$&8&+$5$8275287(16,/,26(
/(,1752'8&($//Ë48,'2
3DUDUHGXFLUHOULHVJRGHOHVLRQHVSHUVRQDOHV
³1RVREUHFDOLHQWHORVOtTXLGRV
³0XHYDHOOtTXLGRWDQWRDQWHVFRPRDPHGLDGRVGHO
WLHPSRGHFDOHQWDPLHQWR
³1RXVHHQYDVHVGHODGRVUHFWRVFRQFXHOORV
HVWUHFKRV
³'HVSXpVGHOFDOHQWDPLHQWRSHUPLWDTXHHOHQYDVH
SHUPDQH]FDHQHOPLFURRQGDVSRUXQWLHPSRFRUWR
DQWHVGHUHPRYHUHOHQYDVH
³8VHFXLGDGRH[WUHPRFXDQGRLQVHUWHXQDFXFKDUDX
RWURXWHQVLOLRHQHOHQYDVH
„/DVFRPLGDVFRFLQDGDVHQOtTXLGRVFRPROD
SDVWDSXHGHQWHQHUFLHUWDWHQGHQFLDDKHUYLUPiV
UiSLGDPHQWHTXHORVDOLPHQWRVTXHFRQWHQJDQ
PHQRVKXPHGDG6LHVWRRFXUUHUHYLVHODVHFFLyQ
GH&XLGDGR\OLPSLH]DGHOKRUQRPLFURRQGDVGRQGH
HQFRQWUDUiLQVWUXFFLRQHVHQFXDQWRDODOLPSLH]DGHO
LQWHULRUGHOPLFURRQGDV
„1RFRFLQHGHPDVLDGRODVSDSDV3RGUtDQ
GHVKLGUDWDUVHHLQFHQGLDUVHFDXVDQGRGDxRVDVX
KRUQR
„&RFLQHODFDUQH\HOSROORSRUFRPSOHWR³ODFDUQH
KDVWDTXHDOFDQFHXQDWHPSHUDWXUDPtQLPD
,17(5,25GHƒ)\HOSROORKDVWDXQDWHPSHUDWXUD
,17(51$PtQLPDGHƒ)&XDQGRVHFRFLQDQ
DHVWDVWHPSHUDWXUDVVHHYLWDODFRQWUDFFLyQGH
HQIHUPHGDGHVSRULQWR[LFDFLyQ
*8$5'((67$6,16758&&,21(6
*($SSOLDQFHVFRP
87(16,/,26'(&2&,1$3$5$0,&5221'$6
1RSRQJDHQPDUFKDHOKRUQRHQHOPRGRPLFURRQGDVVLQTXHHOGLVSRVLWLYRJLUDWRULR\HOVRSRUWHGHOGLVSRVLWLYR
HVWpQHQFDMDGRVHQVXOXJDU(OGLVSRVLWLYRJLUDWRULRGHEHHVWDUVXHOWRSDUDTXHSXHGDJLUDU
$VHJ~UHVHGHTXHWRGRVORVXWHQVLOLRVGHFRFLQDTXHXVHHQVXKRUQRVHDQDSWRVSDUDPLFURRQGDV3XHGHQXVDUVH
ODPD\RUtDGHODVFD]XHODVSODWRVSDUDFRFLQDUWD]DVGHPHGLUWD]DVGHIODQHV\ERWHVGHFULVWDORODVYDMLOODV
GHSRUFHODQDTXHQRWLHQHQGHFRUDFLRQHVPHWiOLFDVREDUQLFHVFRQEULOORPHWiOLFR$OJXQRVXWHQVLOLRVWLHQHQOD
VLJXLHQWHLQVFULSFLyQ´SXHGHXVDUVHHQPLFURRQGDVµ
„6LQRHVWiVHJXURGHTXH
XQSODWRSXHGDXVDUVHHQHO
PLFURRQGDVKDJDHVWDSUXHED
&RORTXHHOSODWRTXHHVWp
SUREDQGR\XQYDVRGHPHGLU
FRQPOWD]DGHDJXDHQHO &yPRSUREDUVLXQHQYDVH
KRUQR²SRQJDODWD]DGHPHGLU HVVHJXURSDUDXVDUVHHQ
GHQWURRDOODGRGHOSODWR3RQJD XQKRUQRGHPLFURRQGDV
HOPLFURRQGDVHQPDUFKDDPi[LPDSRWHQFLDGXUDQWH
VHJXQGRV6LHOSODWRVHFDOLHQWDQRGHEHUtDXVDUVH
HQHOPLFURRQGDV
6LHOSODWRVHPDQWLHQHIUtR\VyORVHFDOLHQWDODWD]D
HQWRQFHVHOSODWRSXHGHXVDUVHGHIRUPDVHJXUDHQHO
PLFURRQGDV
„/RVDOLPHQWRVRXWHQVLOLRVGHPHWDOGHPDVLDGRJUDQGHV
QRGHEHUtDQXVDUVHHQXQKRUQRGHPLFURRQGDV
FRQYHFFLyQ\DTXHDXPHQWDQHOULHVJRGHGHVFDUJD
HOpFWULFD\SRGUtDQFDXVDUXQLQFHQGLR
„$YHFHVHOVXHORHOSODWRJLUDWRULRRODVSDUHGHVGHOKRUQR
SXHGHQHVWDUGHPDVLDGRFDOLHQWHVSDUDWRFDUODV7HQJD
FXLGDGRDOWRFDUHOVXHORHOSODWRJLUDWRULRRODVSDUHGHV
GHOKRUQRGHVSXpVGHFRFLQDU
„6LXVDXQWHUPyPHWURGHFDUQHDOFRFLQDUFRQ
PLFURRQGDVRDOXWLOL]DUODIXQFLyQ)$67%$.(+RUQHDGR
UiSLGRDVHJ~UHVHGHTXHVHDDSWRSDUDVHUXVDGRHQ
PLFURRQGDV
„1RXVHSURGXFWRVGHSDSHOUHFLFODGR(OSDSHOWRDOODODV
VHUYLOOHWDV\HOSDSHOGHFHUDUHFLFODGRVSXHGHQFRQWHQHU
PRWDVPHWiOLFDVTXHSRGUtDQFDXVDUODIRUPDFLyQGH
DUFRVHOpFWULFRVRLQFHQGLDUVH/RVSURGXFWRVGHSDSHOTXH
FRQWHQJDQQLOyQRILODPHQWRVGHQLOyQWDPSRFRGHEHUtDQ
XVDUVH\DTXHVHSRGUtDQLQFHQGLDUGHLJXDOPRGR
„$OJXQDVEDQGHMDVGHSOiVWLFRFRPRHQODVTXHVH
HPSDTXHWDODFDUQHWLHQHQXQDFLQWDILQDGHPHWDO
LQFUXVWDGDHQHOSODWR$OSRQHUVHHQHOPLFURRQGDVHO
PHWDOSXHGHTXHPDUHOVXHORGHOKRUQRRLQFHQGLDUXQ
SDSHOWRDOOD
„8VRGHOHVWDQWHDFFHVRULR
³4XLWHHOHVWDQWHGHOKRUQRFXDQGRQRORHVWpXVDQGR
³8VHPDQRSODVFXDQGRHVWpPDQLSXODQGRHOHVWDQWH\
ORVXWHQVLOLRVGHFRFLQD3RGUtDQHVWDUFDOLHQWHV
³$VHJ~UHVHTXHHOHVWDQWHHVWiELHQFRORFDGRGHQWURGHO
KRUQRSDUDTXHQRVHSURGX]FDQGDxRV
³1RFXEUDHOHVWDQWHQLQLQJXQDSDUWHGHOKRUQRFRQ
SDSHOGHDOXPLQLR(VWRSRGUtDFDXVDUTXHHOKRUQR
PLFURRQGDVGHFRQYHFFLyQVHVREUHFDOHQWDUD
„1RXVHVXKRUQRPLFURRQGDVGHFRQYHFFLyQSDUDVHFDU
SHULyGLFRV
„1RWRGRILOPSOiVWLFRSXHGHXVDUVHHQKRUQRVPLFURRQGDV
5HYLVHHOXVRDGHFXDGRGHOSDTXHWH
„3XHGHXVDUVHWRDOODGHSDSHOSDSHOHQFHUDGR\ILOP
SOiVWLFRSDUDFXEULUORVSODWRV\UHWHQHUODKXPHGDG
DVtFRPRSDUDSUHYHQLUVDOSLFDGXUDVFXDQGRVHXWLOL]D
HOPLFURRQGDV$VHJ~UHVHGHSURYHHUXQDIRUPDGH
YHQWLODFLyQDOILOPSOiVWLFRSDUDTXHHOYDSRUSXHGDVDOLU
„1RXWLOLFHSURGXFWRVGHSDSHOFXDQGRHOKRUQR
PLFURRQGDVRGHFRQYHFFLyQHVWiIXQFLRQDQGRHQHO
PRGR%$.(KRUQHDGR52$67DVDGRX)$67%$.(
KRUQHDGRUiSLGR
„3RGUtDQFDOHQWDUVHORVXWHQVLOLRVSRUHOFDORUWUDQVIHULGR
SRUORVDOLPHQWRVFDOLHQWHV3XHGHQHFHVLWDUXVDU
PDQRSODVFHFRFLQDSDUDPDQHMDUORVXWHQVLOLRV
„$OXWLOL]DUFRQHOPLFURRQGDVEROVDVGHFRFLQDU´TXH
SXHGDQKHUYLUµDVtFRPRFXDOTXLHUEROVDGHSOiVWLFR
ILUPHPHQWHFHUUDGDGHEHUiQFRUWDUVHSHUIRUDUVHR
SURYHHUFXDOTXLHUWLSRGHYHQWLODFLyQVHJ~QLQGLTXHHO
SDTXHWH(QFDVRFRQWUDULRHOSOiVWLFRSRGUtDH[SORWDU
PLHQWUDVVHFRFLQDRGHVSXpVSXGLHQGRFDXVDUGDxRV
ItVLFRV$GHPiVORVUHFLSLHQWHVGHSOiVWLFRGHEHUtDQ
SHUPDQHFHUDOPHQRVSDUFLDOPHQWHGHVWDSDGRV\D
TXHSXHGHQVHOODUVHIXHUWHPHQWH&XDQGRFRFLQHFRQ
UHFLSLHQWHVILUPHPHQWHFXELHUWRVFRQILOPSOiVWLFRUHWLUHOD
FXELHUWDFRQFXLGDGR\PDQWHQJDHOYDSRUDOHMDGRGHVXV
PDQRV\URVWUR
„8VHSDSHOGHDOXPLQLRVyORGHODIRUPDGHWDOODGDHQ
HVWHPDQXDO&XDQGRXVHDOXPLQLRGHQWURGHXQKRUQR
PLFURRQGDVPDQWHQJDHODOXPLQLRDOPHQRVDXQD
SXOJDGDGHGLVWDQFLDGHORVODWHUDOHVGHOKRUQR
„8WHQVLOLRVGHSOiVWLFR³/RVXWHQVLOLRVGHSOiVWLFRGLVHxDGRV
SDUDVXXVRHQPLFURRQGDVVRQPX\SUiFWLFRVSHUR
GHEHQXVDUVHFRQFXLGDGR,QFOXVRDTXHOORVXWHQVLOLRV
DXWRUL]DGRVSDUDVXXVRHQPLFURRQGDVSRGUtDQQR
VHUWDQWROHUDQWHVFRPRHOFULVWDORORVPDWHULDOHVGH
FHUiPLFDHQFRQGLFLRQHGHVREUHFDOHQWDPLHQWR\SRGUtDQ
DEODQGDUVHRFDUERQL]DUVHDOVRPHWHUORVDSHUtRGRV
FRUWRVGHVREUHFDOHQWDPLHQWR(QH[SRVLFLRQHVPiV
ODUJDVDVREUHFDOHQWDPLHQWRODFRPLGD\ORVXWHQVLOLRV
SRGUtDQLQFHQGLDUVH
6LJDHVWDVQRUPDV
8VHVRODPHQWHSOiVWLFRVDSWRVSDUDPLFURRQGDV\
~VHORVVLJXLHQGRHVWULFWDPHQWHODVUHFRPHQGDFLRQHV
GHOIDEULFDQWHGHORVXWHQVLOLRV
1RLQWURGX]FDHQHOPLFURRQGDVUHFLSLHQWHVYDFtRV
1RSHUPLWDTXHORVQLxRVXVHQXWHQVLOLRVGHSOiVWLFR
VLQFRPSOHWDVXSHUYLVLyQ
*8$5'((67$6,16758&&,21(6
,1)250$&,Ï1,03257$17('(6(*85,'$'
/($35,0(5272'$/$6,16758&&,21(6
£$'9(57(1&,$
,16758&&,21(6'(720$'(7,(55$
$'9(57(1&,$(OXVRLQGHELGRGHOHQFKXIHGHWLHUUDSXHGHUHVXOWDUHQULHVJRGH
GHVFDUJDHOpFWULFD
$VHJ~UHVHGHTXHH[LVWH
XQDFRQH[LyQDSURSLDGD
DWLHUUDDQWHVGHOXVR
(VWHHOHFWURGRPpVWLFR
GHEHHVWDUFRQHFWDGRD
WLHUUD6LVHSURGXMHUDXQ
FRUWRFLUFXLWRODWRPDGH
WLHUUDUHGXFHHOULHVJR
GHGHVFDUJDHOpFWULFD
DOSURYHHUXQFDEOHGH
HVFDSHSDUDODFRUULHQWH
HOpFWULFD
6LODWRPDGHFRUULHQWHHVXQPRGHORHVWiQGDU
GHGRVFODYLMDVHVVXUHVSRQVDELOLGDGSHUVRQDO\VX
REOLJDFLyQHOUHHPSOD]DUODSRUXQDWRPDDGHFXDGD
SDUDWUHVFODYLMDVFRQFRQH[LyQDWLHUUD
%DMRQLQJXQDFLUFXQVWDQFLDGHEHFRUWDURTXLWDUOD
WHUFHUDFODYLMDWLHUUDGHOFDEOHGHFRUULHQWH
1RXVHXQHQFKXIHDGDSWDGRUFRQHVWH
HOHFWURGRPpVWLFR
(VWHHOHFWURGRPpVWLFRHVWiHTXLSDGRFRQXQFDEOHGH
FRUULHQWHTXHGLVSRQHGHXQKLORSDUDWRPDGHWLHUUD
FRQXQHQFKXIHFRQWRPDGHWLHUUD(OHQFKXIHGHEH
HVWDUFRQHFWDGRDXQDWRPDGHFRUULHQWHTXHHVWp
GHELGDPHQWHLQVWDODGD\FRQVDOLGDDWLHUUD
1RXVHXQFDEOHH[WHQVRUGHFRUULHQWHFRQ
HVWHHOHFWURGRPpVWLFR6LHOFDEOHGHFRUULHQWHHV
GHPDVLDGRFRUWRKDJDTXHXQHOHFWULFLVWDFXDOLILFDGR
RXQWpFQLFRGHUHSDUDFLRQHVLQVWDOHQXQDWRPDGH
FRUULHQWHFHUFDGHOHOHFWURGRPpVWLFR
&RQVXOWHFRQXQHOHFWULFLVWDFXDOLILFDGRRXQWpFQLFR
GHUHSDUDFLRQHVVLQRHQWLHQGHFRPSOHWDPHQWHODV
LQVWUXFFLRQHVVREUHODWRPDGHWLHUUDRVLWXYLHVH
DOJXQDGXGDVREUHVLVXDSDUDWRHVWiGHELGDPHQWH
FRQHFWDGRDWLHUUD
3DUDXQPHMRUIXQFLRQDPLHQWRHQFKXIHHVWH
HOHFWURGRPpVWLFRHQXQDWRPDGHFRUULHQWHH[FOXVLYD
SDUDHYLWDUSDUSDGHRVGHOX]IXVLEOHVTXHPDGRVRTXH
VDOWHHOGLIHUHQFLDO
(/9(17,/$'25(;75$&725
(OYHQWLODGRUVHSRQGUiHQIXQFLRQDPLHQWRGHIRUPD „7HQJDFXLGDGRDOOLPSLDUORVILOWURVGHOYHQWLODGRU
DXWRPiWLFDEDMRFLHUWDVFLUFXQVWDQFLDVYHUIXQFLyQ
H[WUDFWRU/RVSURGXFWRVGHOLPSLH]DFRUURVLYRV
GH9HQWLODGRU$XWRPiWLFR3UHYHQJDHOTXHHPSLHFH
FRPRORVOLPSLDKRUQRVDEDVHGHOHMtDSXHGHQ
DOJ~QIXHJRDOFRFLQDU\TXHVHH[WLHQGDPLHQWUDVHO
GDxDUORVILOWURV
YHQWLODGRUGHOUHVSLUDGHURHVWiHQPDUFKD
„3RQJDHQPDUFKDHOH[WUDFWRUFXDQGR
„/LPSLHDPHQXGRODSDUWHLQIHULRUGHO
HVWpFRFLQDQGRFRPLGDVFRQOODPDEDMRHO
PLFURRQGDV1RSHUPLWDTXHVHDFXPXOHJUDVD
PLFURRQGDV
HQHOPLFURRQGDVRHQORVILOWURVGHOYHQWLODGRU
„1XQFDGHMHODVXQLGDGHVGHODFRFLQD
„6LODJUDVDVHLQFHQGLDUDHQODVXQLGDGHVGH
IRJRQHVEDMRVXPLFURRQGDVVLQDWHQFLyQ
ODFRFLQDIRJRQHVEDMRHOKRUQRPLFURRQGDV
FXDQGRVHHVWpWUDEDMDQGRDDOWDVWHPSHUDWXUDV
VRIRTXHFXDOTXLHUVDUWpQHQOODPDVGHODXQLGDG
&XDQGRODFRPLGDHQWUDHQHEXOOLFLyQVHJHQHUDQ
GHFRFLQDSRUFRPSOHWRFRQXQDWDSDXQD
KXPRV\VHGHUUDPDQJUDVDVTXHSXGLHUDQ
EDQGHMDGHJDOOHWDVRFXDOTXLHURWUDEDQGHMD
LQFHQGLDUVH\SURSDJDUVHVLHOYHQWLODGRUGHO
SODQD
PLFURRQGDVHVWiIXQFLRQDQGR3DUDPLQLPL]DU
HOIXQFLRQDPLHQWRGHOH[WUDFWRUDXWRPiWLFRXVH
XWHQVLOLRVGHFRFLQDGHWDPDxRDGHFXDGR\XVH
HOIXHJRUiSLGRHQODVXQLGDGHVGHODFRFLQD
IRJRQHVVyORFXDQGRVHDQHFHVDULR
*8$5'((67$6,16758&&,21(6
*($SSOLDQFHVFRP
$'9(57(1&,$
0$5&$3$626
/DPD\RUtDGHORDVPDUFDSDVRVHVWiQSURWHJLGRVFRQWUDODLQWHUIHUHQFLDGHDSDUDWRVHOHFWUyQLFRV
LQFOX\HQGRORVPLFURRQGDV6LQHPEDUJRFXDQGRWHQJDQDOJXQDGXGDORVSDFLHQWHVFRQPDUFD
SDVRVGHEHQFRQVXWDUFRQVXPpGLFR
)$925'(/((5<6(*8,5&8,'$'26$0(17((67$
,1)250$&,Ï1'(6(*85,'$'
*8$5'((67$6,16758&&,21(6
.LWVRSFLRQDOHV
'LVSRQLEOHVHQVXGLVWULEXLGRU*(SRUXQFRVWRDGLFLRQDO
.LWVGHSDQHOGHUHOOHQR
.LWVGHILOWURV
„-;:+³%ODQFR
„-;³1HJUR
„ - ;'³.LWGHILOWURGHFDUEyQYHJHWDOGH
$OFDPELDUODWDSDGHXQDFRFLQDHQFLPHUD
GHORVNLWVGHSDQHOHVGHUHOOHQRRFXSDQHO
HVSDFLRDGLFLRQDOSURYH\HQGRXQDVSHFWRGH
PRQWDMHDPHGLGD
6yORSDUDLQVWDODUVHHQWUHDUPDULRVQRSXHGHQ
LQVWDODUVHDOILQDOGHORVDUPDULRV&DGDNLW
FRQWLHQHGRVSDQHOHVGHUHOOHQRGH
UHFLUFXODFLyQ
/RVNLWVGHILOWURVVH
XVDQFXDQGRHOKRUQR
QRSXHGHWHQHUXQD
VDOLGDDOH[WHULRU
-;'
/RVNLWVGHILOWURV
HVWiQGLVSRQLEOHVD
XQFRVWRDGLFLRQDOHQ
VXDEDVWHFHGRU*(
3DUDSHGLUOODPHD
-;-;
*(RYLVLWHQXHVWURVLWLR
:HE*($SSOLDQFHVFRP
FRQVXOWHODSiJLQDWUDVHUD
/DVIXQFLRQHVGHVXKRUQR
6XPRGHORSXHGHWHQHURWUDVFDUDFWHUtVWLFDV\DSDULHQFLDTXHODVLOXVWUDGDVHQHVWHPDQXDO
)XQFLRQHVGHOKRUQR
7LUDGRU
(QJDQFKHVGHSXHUWD
9HQWDQDFRQHVFXGRPHWiOLFR/DYHQWDQD
SHUPLWHYHUFRPRVHFRFLQDQORVDOLPHQWRV\
HYLWDTXHVDOJDQPLFURRQGDVGHOKRUQR
3DQHOGHFRQWURO\GLDOVHOHFWRU
'LVSRVLWLYRJLUDWRULRH[WUDtEOH1RSRQJDHQ
PDUFKDHOKRUQRHQHOPRGRPLFURRQGDVVLQTXH
HVWpQODEDVH\HOVRSRUWHGHODEDVHFRORFDGRV
HQVXOXJDU
6RSRUWHGHOSODWRJLUDWRULRH[WUDtEOH(OVRSRUWH
GHOSODWRJLUDWRULRGHEHHVWDUHQVXOXJDUFXDQGR
VHXVHHOKRUQR
(VWDQWHV8WLOtFHORVFRQ&RQYHFWLRQ%DNH
KRUQHDGRSRUFRQYHFFLyQ&RQYHFWLRQ5RDVW
DVDGRSRUFRQYHFFLyQR&RPELQDWRQ)DVW
%DNHKRUQHDGRUiSLGRFRPELQDGRQRORVXWLOLFH
PLHQWUDVHOPLFURRQGDVHVWiFRFLQDQGR
3DUDREWHQHUPHMRUHVUHVXOWDGRVXWLOLFHXQ
HVWDQWHHQODSRVLFLyQLQIHULRU\GHMHDOPHQRV
XQDEUHFKDGHXQDSXOJDGDHQWUHHOSODWRTXH
HVWiFRFLQDQGR\ORVODWHUDOHVGHOKRUQR3DUD
+RUQHDGRDGRVQLYHOHVX+RUQHDGRUiSLGR
XWLOLFHDPERVHVWDQWHV
$FHUFDGHODVIXQFLRQHVGHFRFFLyQ\FDOHQWDPLHQWR
GHVXKRUQRPLFURRQGDVSRUFRQYHFFLyQ
*($SSOLDQFHVFRP
(VSRVLEOHFRFLQDUHQPRGR0LFURRQGDV+RUQHDGRSRUFRQYHFFLyQ$VDGRSRUFRQYHFFLyQX+RUQHDGRUiSLGR
FRPELQDGR*UDFLDVDODIXQFLyQ´&DOHQWDUµSXHGHPDQWHQHUFDOLHQWHVORVDOLPHQWRV\DKRUQHDGRV\VHUYLUORVDXQD
WHPSHUDWXUDDSURSLDGD
POPCORN
REHEAT
BEVERAGE
AUTO
COOK
TIME
COOK
POWER
DEFROST
MICRO
EXPRESS
CONVECTION
BAKE
OS
RN T ELECT
TU
CONVECTION
ROAST
'LDO6HOHFWRU
'LDO6HOHFWRU
COMBI
FAST BAKE
PR
CLEAR
OFF
HELP
WARM
OPTIONS
CLOCK
AM/PM
390
ESS TO E NTE
TIMER
R
START
PAUSE
TURNTABLE
ON/OFF
VENT
FAN
SURFACE
LIGHT
&90
&RQWUROHVGHFRFFLyQ
)XQFLRQHVGHWLHPSRGHFRFFLyQSRUPLFURRQGDV\DXWRPiWLFDV
3UHVLRQH
*LUH\DSULHWHHOGLDOSDUDDFHSWDU
7,0(&22.FRFFLyQSRUWLHPSR
&DQWLGDGGHWLHPSRGHFRFFLyQ
3XOVHXQDYH]7LPH&RRN,7LHPSRGHFRFFLyQ,
SDUDXWLOL]DUODIXQFLyQPLFURRQGDVHQXQLQWHUYDOR
GHWLHPSRGHHQWUHVHJXQGRV\PLQXWRV
3XOVHGRVYHFHV7LPH&RRN,,7LHPSRGHFRFFLyQ,,SDUDFDPELDUORVQLYHOHVGHSRWHQFLD
GHIRUPDDXWRPiWLFDGXUDQWHODFRFFLyQ
0,&52(;35(66FRFLQDU$xDGLUVHJ£(PSLH]DLQPHGLDWDPHQWH
'()5267GHVFRQJHODU
3XOVHXQDYH]5iSLGR
&DQWLGDGGHWLHPSRGHGHVFRQJHODFLyQ
3XOVHGRVYHFHV$XWR
3HVRGHDOLPHQWRVKDVWDVHLVOLEUDV
3XOVHWUHVYHFHV7LHPSR
3HVRGHDOLPHQWRVKDVWDXQDOLEUD
%(9(5$*(EHELGD
£(PSLH]DLQPHGLDWDPHQWH
3UHVLRQHXQDYH]²R]
3UHVLRQHGRVYHFHV²R]
3UHVLRQHWUHVYHFHV²R]
1LYHOGH327(1&,$
1LYHOGHSRWHQFLD²
)XQFLRQHVGHVHQVRU
3UHVLRQH
323&251URVHWDVRSDORPLWDVGHPDt]
5(+($7UHFDOHQWDU
3UHVLRQHXQDYH]SODWR
3UHVLRQHGRVYHFHVDXQDWD]D
3UHVLRQHWUHVYHFHVDWD]DV
$872&22.FRFLQDUDXWRPiWLFDPHQWH
*LUH\DSULHWHHOGLDOSDUDDFHSWDU £(PSLH]DLQPHGLDWDPHQWH
£(PSLH]DLQPHGLDWDPHQWH
2SFLyQ
0iVPHQRVWLHPSR
0iVPHQRVWLHPSR
7LSRGHDOLPHQWRV²
0iVPHQRVWLHPSR
&RQYHFWLRQ%DNLQJR&RQYHFWLRQ5RDVWLQJ+RUQHDGRSRUFRQYHFFLyQR$VDGRSRUFRQYHFFLyQ
3UHVLRQH
*LUH\DSULHWHHOGLDOSDUDDFHSWDU
&219(&7,21%$.,1*
7HPSHUDWXUDGHKRUQR\WLHPSRGHFRFFLyQ
+RUQHDGRSRUFRQYHFFLyQR
&219(&7,2152$67,1*$VDGRSRUFRQYHFFLyQ
&RPELQDWLRQ)DVW%DNLQJ+RUQHDGRUiSLGRFRPELQDGR
3UHVLRQH
+RUQHDGRUiSLGRFRPELQDGR
*LUH\DSULHWHHOGLDOSDUDDFHSWDU
7HPSHUDWXUDGHKRUQR\WLHPSRGHFRFFLyQ
:DUPLQJ&DOHQWDPLHQWR
3UHVLRQH
:$50&DOHQWDU
*LUH\DSULHWHHOGLDOSDUDDFHSWDU
7HPSHUDWXUDGHOKRUQR\WLHPSRGHFDOHQWDPLHQWR
2SFLRQHVGHFRFFLyQGLVSRQLEOHV
&RFFLyQSRUPLFURRQGDV
6XKRUQRXVDHQHUJtDGHPLFURRQGDVSDUDFRFLQDUVHJ~QXQSHUtRGRGHWLHPSR
SUHGHWHUPLQDGRVHJ~QHOSHVRRGHIRUPDDXWRPiWLFDSRUPHGLRGHXQVHQVRU
(OPLFURRQGDVSRUVHQVRUIXQFLRQDGHWHFWDQGRHOLQFUHPHQWRGHKXPHGDGOLEHUDGDGXUDQWH
ODFRFFLyQ(OKRUQRDMXVWDGHIRUPDDXWRPiWLFDHOWLHPSRGHFRFFLyQDYDULRVWLSRV\
FDQWLGDGHVGHDOLPHQWRV
0pWRGRGH
FRFFLyQ
1RXWLOLFHORVHVWDQWHVFXDQGR
FRFLQHSRUPLFURRQGDV
/DHQHUJtD
PLFURRQGDVVH
GLVWULEX\HGHIRUPD
SDUHMDHQWRGRHO
KRUQRSDUDTXHOD
FRPLGDVHFRFLQH
GHIRUPDUiSLGD\
FRPSOHWD
)XHQWHGHFDORU
(QHUJtD
PLFURRQGDV
&RQGXFFLyQGHO
FDORU
%HQHILFLRV
5iSLGDDOWDHILFDFLD
GHFRFFLyQ(OKRUQR
&DORUSURGXFLGR
GHQWURGHODFRPLGD \VXVDOUHGHGRUHV
QRVHFDOLHQWDQ
SRUSHQHWUDFLyQ
LQVWDQWiQHDGH
)iFLOGHOLPSLDU
HQHUJtD
&RQYHFWLRQ%DNLQJKRUQHDGRSRUFRQYHFFLyQ\
&RQYHFWLRQ5RDVWLQJDVDGRSRUFRQYHFFLyQ
'XUDQWHHOSURFHVRGHKRUQHDGRRDVDGRVHXWLOL]DXQHOHPHQWRGHFDOHIDFFLyQSDUD
DXPHQWDUODWHPSHUDWXUDGHODLUHLQWHULRUGHOKRUQR3XHGHVHOHFFLRQDUVHFXDOTXLHU
WHPSHUDWXUDHQWUHƒ)\ƒ)8QYHQWLODGRUKDFHFLUFXODUOLJHUDPHQWHHODLUHSRUWRGR
HOKRUQRSRUHQFLPD\DOUHGHGRUGHODFRPLGDSURGXFLHQGRTXHVHGRUHSRUIXHUD\TXHORV
LQWHULRUHVVHDQULFRV\MXJRVRV(VWDFLUFXODFLyQGHDLUHFDOLHQWHHVOODPDGDFRQYHFFLyQ
'HELGRDTXHHODLUHVHPDQWLHQHHQFRQVWDQWHPRYLPLHQWRDOQRSHUPLWLUVHODIRUPDFLyQ
GHXQDFDSDGHDLUHPiVIUtRDOUHGHGRUGHODFRPLGDDOJXQDVFRPLGDVVHFRFLQDQPiV
UiSLGDPHQWHTXHHQXQKRUQRGHFRFLQDQRUPDO
8VHVLHPSUHHOHVWDQWHFXDQGR
HVWpKRUQHDQGR3DUDREWHQHU
PHMRUHVUHVXOWDGRVXWLOLFHXQ
HVWDQWHHQODSRVLFLyQLQIHULRU
3DUDFRFFLyQDGRVQLYHOHV
H[FOXVLYDPHQWHXWLOLFHDPERV
HVWDQWHV
0pWRGRGH
FRFFLyQ
(ODLUHFDOLHQWH
FLUFXODDOUHGHGRU
GHODFRPLGDSDUD
SURGXFLUH[WHULRUHV
GRUDGRV\
PDQWHQHUORVMXJRV
HQHOLQWHULRU
)XHQWHGHFDORU
$LUHFDOLHQWHHQ
FLUFXODFLyQ
&RQYHFFLyQ
&RQGXFFLyQGHO
FDORU
(OFDORUVHFRQGXFH
GHVGHHOH[WHULRUGH
ODFRPLGDKDFLDVX
LQWHULRU
%HQHILFLRV
$\XGDDGRUDU
\VHOODHOVDERU
HQHOLQWHULRU
$OJXQRVDOLPHQWRV
VHFRFLQDQPiV
UiSLGDPHQWH
TXHHQKRUQRV
FRQYHQFLRQDOHV
2SFLRQHVGHFRFFLyQGLVSRQLEOHV
*($SSOLDQFHVFRP
&RPELQDWLRQ)DVW%DNLQJ+RUQHDGRUiSLGRFRPELQDGR
6XKRUQRWDPELpQWLHQHODRSFLyQGHFRFFLyQUiSLGD)DVW%DNLQJXVDQGRODHQHUJtD
PLFURRQGDVMXQWRDODFRFFLyQSRUFRQYHFFLyQ'HHVWDIRUPDFRFLQDFRQYHORFLGDG\
SUHFLVLyQSURSRUFLRQDQGRDOPLVPRWLHPSRDOLPHQWRVGRUDGRV\FUXMLHQWHV
8WLOLFHVLHPSUHHOHVWDQWHGXUDQWH
+RUQHDGRUiSLGR3DUDREWHQHU
PHMRUHVUHVXOWDGRVXWLOLFHXQ
HVWDQWHHQODSRVLFLyQLQIHULRU
3DUDFRFFLyQDGRVQLYHOHV
H[FOXVLYDPHQWHXWLOLFHDPERV
HVWDQWHV
0pWRGRGH
FRFFLyQ
)XHQWHGHFDORU
&RQGXFFLyQGHO
(QHUJtDPLFURRQGDV FDORU
/DHQHUJtD
PLFURRQGDV
\HOFDORUSRU
FRQYHFFLyQVH
FRPELQDQSDUD
FRFLQDUDOLPHQWRV
KDVWDXQ
PiVUiSLGR
TXHORVKRUQRV
FRQYHQFLRQDOHV\
GRUDUSRUIXHUD\
DODYH]PDQWHQHU
OtTXLGRV
\DLUHFDOLHQWHHQ
FLUFXODFLyQ
/DFRPLGDVH
FDOLHQWDSRUHQHUJtD
LQVWDQWiQHDSRU
SHQHWUDFLyQ\
FDORUSURYHQLHQWH
GHOH[WHULRUGHORV
DOLPHQWRV
%HQHILFLRV
7LHPSRGH
FRFFLyQDFRUWDGR
SRUODHQHUJtD
PLFURRQGDV
DGHPiVHOFDORUGH
FRQYHFFLyQGRUD\
SURGXFHFUXMLHQWHV
H[WHULRUHV
:DUPLQJ&DOHQWDU
/DIXQFLyQ´&DOHQWDUµPDQWHQGUiORVDOLPHQWRVDODWHPSHUDWXUDLGHDOSDUDVHUYLUORV
&RPLHQFHVLHPSUHFRQFRPLGDFDOLHQWH8WLOLFHUHFLSLHQWHV\XWHQVLOLRVGHFRFLQDTXHSXHGDQ
VRSRUWDUWHPSHUDWXUDVGHKDVWDž)
0pWRGRGH
FRFFLyQ
8WLOLFHVLHPSUHHOHVWDQWHFXDQGR
FDOLHQWH
(ODLUHFDOLHQWH
FLUFXODDOUHGHGRU
GHORVDOLPHQWRV
SDUDPDQWHQHU
FDOLHQWHODFRPLGD
SUHYLDPHQWH
FRFLQDGD
)XHQWHGHFDORU
$LUHFDOLHQWH
HQFLUFXODFLyQ
FRQYHFFLyQ
&RQGXFFLyQGH
FDORU
(OFDORUVHFRQGXFH
GHVGHHOH[WHULRU
KDFLDHOLQWHULRUGH
ORVDOLPHQWRV
%HQHILFLRV
0DQWLHQHODFRPLGD
KRUQHDGDFDOLHQWH
DWHPSHUDWXUD
ySWLPDSDUD
VHUYLUOD
)XQFLRQHVGHPLFURRQGDVSRUWLHPSR\DXWRPiWLFR
&yPRXVDUHOGLDO
3RGUiKDFHUVHOHFFLRQHVHQHOKRUQRJLUDQGR
HOGLDO\SUHVLRQDQGRSDUDLQJUHVDUOD
VHOHFFLyQ
8VWHGWDPELpQSXHGHSUHVLRQDUHOGLDO
HQYH]GHERWyQ67$573$86(SDUDXQD
SURJUDPDFLyQPiVUiSLGDGHOKRUQR
7LPH&RRNFRFFLyQSRUWLHPSR
7LPH&RRN,,FRFFLyQSRUWLHPSR,,
QRXWLOL]DUORVHVWDQWHVFXDQGRFRFLQDSRU
PLFURRQGDV
/HSHUPLWHFDPELDUORVQLYHOHVGHSRWHQFLDGH
IRUPDDXWRPiWLFDPLHQWUDVFRFLQD
6HKDFHGHODVLJXLHQWHIRUPD
7LPH&RRN,FRFFLyQSRUWLHPSR,
/HSHUPLWHXVDUHOPLFURRQGDVSRUXQSHUtRGR
GHHQWUHVHJXQGRV\PLQXWRV
(O1LYHOGHSRWHQFLDDOWRSRZHUOHYHO
>[email protected]
SHURSXHGHFDPELDUORSDUDPD\RU
IOH[LELOLGDG
3UHVLRQHHOERWyQ7,0(&22.FRFFLyQ
SRUWLHPSR
*LUHHOGLDOSDUDDMXVWDUHOWLHPSRGH
FRFFLyQ\SUHVLRQHHOGLDOSDUD
VHOHFFLRQDU
&DPELHHOQLYHOGHSRWHQFLDVLQRTXLHUH
TXHFRFLQHDWRGDSRWHQFLD3UHVLRQH
32:(5*LUHHOGLDOSDUDEXVFDU3UHVLRQH
HOGLDOSDUDVHOHFFLRQDU
3UHVLRQHHOGLDORHOERWyQ67$573$86(
SDUDHPSH]DUDFRFLQDU
&XDQGRXVH7LPH&RRNSXHGHDEULUODSXHUWD
SDUDUHYLVDUODFRPLGD&LHUUHODSXHUWD\
SUHVLRQHHOGLDOR67$573$86(SDUDVHJXLU
FRFLQDQGR
127$(OWLHPSRGHFRFFLyQSXHGH
FDPELDUVHHQFXDOTXLHUPRPHQWRPLHQWUDV
VHFRFLQDJLUDQGRHOGLDO8VWHGSXHGH
WDPELpQFDPELDUHOQLYHOGHHQHUJtD
SUHVLRQDQGRHOERWyQGHHQHUJtD32:(5
3UHVLRQHHOERWyQ7,0(&22.FRFFLyQ
SRUWLHPSR
*LUHHOGLDOSDUDDMXVWDUHOSULPHUWLHPSR
GHFRFFLyQ\SUHVLRQHHOGLDOSDUD
VHOHFFLRQDU
&DPELHHOQLYHOGHSRWHQFLDVLQRTXLHUH
TXHFRFLQHDWRGDSRWHQFLD3UHVLRQH
32:(5*LUHHOGLDOSDUDVHOHFFLRQDU
3UHVLRQHHOGLDOSDUDVHOHFFLRQDU
3UHVLRQHHOERWyQ7,0(&22.FRFFLyQ
SRUWLHPSRGHQXHYR
*LUHHOGLDOSDUDDMXVWDUHOVHJXQGR
WLHPSRGHFRFFLyQ\SUHVLRQHHOGLDOSDUD
VHOHFFLRQDU
&DPELHHOQLYHOGHSRWHQFLDVLQRTXLHUH
TXHFRFLQHDWRGDSRWHQFLD3UHVLRQH
32:(5*LUHHOGLDOSDUDVHOHFFLRQDU
3UHVLRQHHOGLDOSDUDVHOHFFLRQDU
3UHVLRQHHOHOGLDORHOERWyQ67$57
3$86(SDUDHPSH]DUDFRFLQDU
&XDQGRDFDED7LPH&RRN,7LPH&RRN,,
HPSLH]DDIXQFLRQDU
127$(OWLHPSRGHFRFFLyQSXHGH
FDPELDUVHHQFXDOTXLHUPRPHQWRPLHQWUDV
VHFRFLQDJLUDQGRHOGLDO8VWHGSXHGH
WDPELpQFDPELDUHOQLYHOGHHQHUJtD
SUHVLRQDQGRHOERWyQGHHQHUJtD32:(5
0LFURH[SUHVVFRRN
FRFFLyQPLFURH[SUHVV
QRXWLOL]DUORVHVWDQWHVFXDQGRFRFLQDSRU
PLFURRQGDV
(VWDHVODIRUPDUiSLGDGHDMXVWDU\HPSH]DU
DFRFLQDUHQEORTXHVGHVHJXQGRVFDGD
YH]TXHVHDSULHWDHOERWyQ0,&52(;35(66
(OWLHPSRGHFRFFLyQSXHGHFDPELDUVHHQ
FXDOTXLHUPRPHQWRPLHQWUDVVHFRFLQD
JLUDQGRHOGLDO
(OQLYHOGHSRWHQFLDHVWDUiDXWRPiWLFDPHQWH
VHOHFFLRQDGRD\HOKRUQRHPSH]DUi
LQPHGLDWDPHQWH
(OQLYHOGHSRWHQFLDSXHGHFDPELDUVH
PLHQWUDVHOWLHPSRVHYDDJRWDQGR3UHVLRQH
HOERWyQ32:(5JLUHHOGLDO\SUHVLyQHORSDUD
VHOHFFLRQDU
*($SSOLDQFHVFRP
'HVFRQJHODFLyQUiSLGD
QRXWLOL]DUORVHVWDQWHVFXDQGRFRFLQDSRU
PLFURRQGDV
)DVW'HIURVWDMXVWDGHIRUPDDXWRPiWLFD
ORVWLHPSRVGHGHVFRQJHODFLyQ\ORVQLYHOHV
GHSRWHQFLDSDUDSURGXFLUUHVXOWDGRVGH
GHVFRQJHODFLyQSDUHMRVSDUDFDUQHVDYHV
\SHVFDGRTXHSHVHQKDVWDXQDOLEUD
„6DTXHODFDUQHGHOSDTXHWH\FROyTXHODHQ
XQSODWRDSWRSDUDPLFURRQGDV
3UHVLRQHHOERWyQ'()5267GHVFRQJHODU
WUHVYHFHV
*LUHHOGLDOKDVWDDOFDQ]DUHOSHVRGHOD
FRPLGDXVDQGROD7DEODGH&RQYHUVLyQD
ODGHUHFKD3RUHMHPSORSRQJDHOGLDOD
SDUDOLEUDVRQ]DV3UHVLRQHHOGLDO
SDUDVHOHFFLRQDU
3UHVLRQHHOERWyQ67$573$86(SDUD
HPSH]DUDGHVFRQJHODU
'HODYXHOWDDODFRPLGDVLDSDUHFHHO
PHQVDMH7851)22'29(5
$XWR'HIURVWGHVFRQJHODFLyQ
DXWRPiWLFDQRXWLOL]DUORVHVWDQWHV
FXDQGRFRFLQDSRUPLFURRQGDV
8VH$XWR'HIURVWSDUDFDUQHDYHV\
SHVFDGRVTXHSHVHQKDVWDVHLVOLEUDV8VH
7LPH'HIURVW SDUDODPD\RUtDGHOUHVWRGH
FRPLGDVFRQJHODGDV
$XWR'HIURVWDMXVWDGHIRUPDDXWRPiWLFD
ORVWLHPSRVGHGHVFRQJHODFLyQ\ORVQLYHOHV
GHSRWHQFLDSDUDSURGXFLUUHVXOWDGRVGH
GHVFRQJHODFLyQSDUHMRVSDUDFDUQHVDYHV
\SHVFDGR
„6DTXHODFDUQHGHOSDTXHWH\FROyTXHODHQ
XQSODWRDSWRSDUDPLFURRQGDV
3UHVLRQHHOERWyQ'()5267GHVFRQJHODU
GRVYHFHV
*LUHHOGLDOKDVWDDOFDQ]DUHOSHVRGHOD
FRPLGDXVDQGROD7DEODGH&RQYHUVLyQD
ODGHUHFKD3RUHMHPSORSRQJDHOGLDOD
SDUDOLEUDVOLEUDRQ]DV
3UHVLRQHHOGLDOSDUDVHOHFFLRQDU
3UHVLRQHHOERWyQ67$573$86(SDUD
HPSH]DUDGHVFRQJHODU
'HODYXHOWDDODFRPLGDVLDSDUHFHHO
„5HWLUHODFDUGHGHVFRQJHODGDRFXEUDODV
iUHDVFDOLHQWHVFRQSHTXHxRVUHFRUWHVGH
SDSHOGHDOXPLQLR
„8QDYH]GHVFRQJHODGDVODPD\RUtDGH
FDUQHVQHFHVLWDQPLQXWRVHQUHSRVRSDUD
TXHDFDEHQGHGHVFRQJHODUVH
7DEODGHFRQYHUVLyQ
6LHOSHVRGHODFRPLGDVHFDOFXODHQOLEUDV
\RQ]DVODVRQ]DVGHEHUiQFRQYHUWLUVHD
GpFLPDVGHOLEUD
3HVRGHODFRPLGD ,QWURGX]FDHOSHVRGHOD
HQRQ]DV
FRPLGDGpFLPDVGHOLEUD
²
²
²
²
²
²
„5HWLUHODFDUQHGHVFRQJHODGDRFXEUDODV
iUHDVFDOLHQWHVFRQSHTXHxRVUHFRUWHVGH
SDSHOGHDOXPLQLR
„8QDYH]GHVFRQJHODGDVODPD\RUtDGHODV
FDUQHVQHFHVLWDQPLQXWRVHQUHSRVRSDUD
TXHDFDEHQGHGHVFRQJHODUVH/RVDVDGRV
JUDQGHVGHEHUtDQGHMDUVHUHSRVDUSRUXQRV
PLQXWRV
7DEODGHFRQYHUVLyQ
6LHOSHVRGHODFRPLGDVHFDOFXODHQOLEUDV
\RQ]DVODVRQ]DVGHEHUiQFRQYHUWLUVHD
GpFLPDVGHOLEUD
3HVRGHODFRPLGD
,QWURGX]FDHOSHVRGHOD
HQRQ]DV
FRPLGDGpFLPDVGHOLEUD
²
²
²
²
²
²
PHQVDMH7851)22'29(5
)XQFLRQHVGHPLFURRQGDVSRUWLHPSR\DXWRPiWLFR
'HVFRQJHODFLyQSRUWLHPSR
QRXWLOL]DUORVHVWDQWHVFXDQGRFRFLQDSRU
PLFURRQGDV
8VH7LPH'HIURVWSDUDGHVFRQJHODUSRUXQ
SHUtRGRGHWLHPSRVHOHFFLRQDGR
3UHVLRQHHOERWyQ'()5267GHVFRQJHODU
XQDYH]
*LUHHOGLDOSDUDVHOHFFLRQDUHOWLHPSRTXH
GHVHH3UHVLRQHHOGLDOSDUDVHOHFFLRQDU
3UHVLRQHHOERWyQ67$573$86(SDUD
HPSH]DUDGHVFRQJHODU
'pODYXHOWDDODFRPLGDVLDSDUHFHHO
PHQVDMH7851)22'29(5
3XHGHYDULDUHOWLHPSRGHGHVFRQJHODFLyQHQ
FXDOTXLHUPRPHQWRPLHQWUDVVHGHVFRQJHOD
JLUDQGRHOGLDO
&RQVHMRVGHGHVFRQJHODFLyQ
„/DFRPLGDFRQJHODGDHQSDSHORSOiVWLFR
SXHGHGHVFRQJHODUVHHQHOSDTXHWH/RV
SDTXHWHVFHUUDGRVGHEHUtDQFRUWDUVH
SLQFKDUVHRGHEHUtDSURYHHUVHFXDOTXLHU
WLSRGHYHQWLODFLyQ'(638e6GHKDEHU
GHVFRQJHODGRODFRPLGDSDUFLDOPHQWH
/RVUHFLSLHQWHVGHSOiVWLFRGHEHUtDQGHMDUVH
SDUFLDOPHQWHGHVWDSDGRV
„/DVFRPLGDVSUHHPSDTXHWDGDV
FRQJHODGDVGHWDPDxRIDPLOLDUSXHGHQ
GHVFRQJHODUVH\KDFHUVHHQHOPLFURRQGDV
6LODFRPLGDHVWiHQXQFRQWHQHGRUGH
DOXPLQLRSiVHODDXQSODWRVHJXURSDUDVX
XVRHQPLFURRQGDV
(OQLYHOGHSRWHQFLDHVWiSUHVHOHFFLRQDGR
DSHURSXHGHFDPELDUOR3XHGH
GHVFRQJHODUDUWtFXORVSHTXHxRVUiSLGDPHQWH
HOHYDQGRHOQLYHOGHSRWHQFLDXQDYH]
LQWURGXFLGRHOWLHPSR(OQLYHOGHSRWHQFLD
SRZHUOHYHOUHFRUWDHOWLHPSRWRWDO
GHGHVFRQJHODFLyQDODPLWDGHOQLYHOGH
SRWHQFLDSRZHUOHYHOUHFRUWDHO
WLHPSRWRWDOHQDSUR[LPDGDPHQWHXQD
WHUFHUDSDUWH6LQHPEDUJRODFRPLGD
QHFHVLWDUiPiVDWHQFLyQGHORQRUPDO
„/DVFRPLGDVTXHVHHFKDQDSHUGHU
UiSLGDPHQWHQRGHEHUtDQGHMDUVHIXHUD
SRUXQSHUtRGRGHPiVGHXQDKRUDWUDVVX
GHVFRQJHODFLyQ/DWHPSHUDWXUDDPELHQWH
SURPXHYHHOFUHFLPLHQWRGHEDFWHULDV
GDxLQDV
'XUDQWHODGHVFRQJHODFLyQSRGUtDRtUVH
XQUXLGRGHJROSHVVRUGR(VWRHVQRUPDO
FXDQGRHOKRUQRQRHVWiIXQFLRQDQGR
HQODSRWHQFLD+LJK$OWD
„&XDQGRHVWpGHVFRQJHODGDODFRPLGD
GHEHUtDHVWDUIUtDSHUREODQGDHQWRGDV
VXViUHDV6LD~QHVWiOLJHUDPHQWHKHODGD
GHYXpOYDODDOPLFURRQGDVSRUPX\SRFR
WLHPSRRGpMHODIXHUDXQRVPLQXWRV
„3DUDODGHVFRQJHODFLyQPiVLJXDODGD
GHDOLPHQWRVPD\RUHVFRPRDVDGRV
XVH$XWR'HIURVW$VHJ~UHVHGHTXHODV
FDUQHVJUDQGHVHVWpQFRPSOHWDPHQWH
GHVFRQJHODGDVDQWHVGHFRFLQDUODV
%HYHUDJHEHELGD
BEVERAGE
QRXWLOL]DUORVHVWDQWHVFXDQGRFRFLQDSRU
PLFURRQGDV
/DIXQFLyQ%(9(5$*(%HELGDFDOLHQWD
EHELGDVGHHQWUH\RQ]DV
3XOVHXQDYH]SDUDR]
3XOVHGRVYHFHVSDUDR]
3XOVHWUHVYHFHVSDUDR]
/DVEHELGDVFDOHQWDGDVFRQODIXQFLyQ
%HYHUDJHSXHGHQHVWDUPX\FDOLHQWHV6DTXH
HOUHFLSLHQWHFRQFXLGDGR
&yPRFDPELDUHOQLYHOGHSRWHQFLD
(OQLYHOGHSRWHQFLDSXHGHLQWURGXFLUVHR
FDPELDUVHGHIRUPDLQPHGLDWDWUDVLQWURGXFLU
HOWLHPSRGHFRFFLyQ7LPH&RRNHOWLHPSR
GHGHVFRQJHODFLyQ7LPH'HIURVWR([SUHVV
&RRN(OQLYHOGHSRWHQFLDWDPELpQSXHGH
FDPELDUVHGXUDQWHODFXHQWDDWUiV
3ULPHURVLJDODVLQVWUXFFLRQHVSDUDHO
WLHPSRGHFRFFLyQ7LPH&RRNHOWLHPSR
GHGHVFRQJHODFLyQ7LPH'HIURVWR
([SUHVV&RRN
3UHVLRQHHOERWyQ32:(5
*LUHHOGLDOHQHOVHQWLGRGHODVDJXMDVGHO
UHORMSDUDDXPHQWDU\HQHOVHQWLGR
FRQWUDULRSDUDGLVPLQXLUODSRWHQFLD
3UHVLRQHHOGLDOSDUDVHOHFFLRQDU
3UHVLRQHHOERWyQ67$573$86(SDUD
HPSH]DUDFRFLQDU
/RVQLYHOHVGHSRWHQFLDYDULDEOHVDxDGHQ
IOH[LELOLGDGDODFRFLQDFRQPLFURRQGDV/RV
QLYHOHVGHSRWHQFLDGHOKRUQRPLFURRQGDV
SXHGHQFRPSDUDUVHFRQODVXQLGDGHVGH
ODHQFLPHUDIRJRQHVHQXQDFRFLQD&DGD
QLYHOGHSRWHQFLDOHSURSRUFLRQDHQHUJtD
PLFURRQGDVGXUDQWHFLHUWRSRUFHQWDMHGHO
WLHPSR1LYHOGHSRWHQFLDSRZHUOHYHO
HVHQHUJtDPLFURRQGDVDOGHOWLHPSR
1LYHOGHSRWHQFLDSRZHUOHYHOHVHQHUJtD
DOGHOWLHPSR1RUPDOPHQWHVHFRFLQDUi
HQ$OWRQLYHOGHSRWHQFLD+LJKSRZHU
OHYHOTXHSURSRUFLRQDXQDSRWHQFLDGHO
3RZHUOHYHOOHSHUPLWLUiFRFLQDU
PiVUiSLGRSHURODFRPLGDSRVLEOHPHQWH
QHFHVLWDUiTXHODDJLWHJLUHRGpODYXHOWD
PiVDPHQXGR
*($SSOLDQFHVFRP
/RVSHUtRGRVGHGHVFDQVRFXDQGRVHDFDED
HOFLFORGHODHQHUJtDPLFURRQGDVOHGDQ
WLHPSRDODFRPLGDD´LJXDODUVHµRWUDQVIHULU
HOFDORUDVXLQWHULRU6HPXHVWUDXQHMHPSOR
GHHVWRFRQHOFLFORGHGHVFRQJHODFLyQ
SRZHUOHYHO6LODHQHUJtDPLFURRQGDVQR
IXQFLRQDUDHQFLFORVODSDUWHH[WHUQDGHOD
FRPLGDVHFRFLQDUtDDQWHVGHTXHHOLQWHULRU
VHGHVFRQJHODUD
(VWRVVRQDOJXQRVHMHPSORVGHDSOLFDFLRQHV
SDUDGLIHUHQWHVQLYHOHVGHSRWHQFLD
$OWD3HVFDGREDFRQYHUGXUDVFDOHQWDU
OtTXLGRV
0HGLDDOWD&RFFLyQVXDYHGHFDUQH\DYHV
VLUYHSDUDFRFLQDUJXLVRV\SDUDUHFDOHQWDU
0HGLD&RFLQDOHQWD\WLHUQDSDUDHVWRIDGRV
RJXLVRV\SDUDSDUWHVPHQRVWLHUQDVGH
FDUQH
%DMDR3DUDGHVFRQJHODUFRFHUD´IXHJRµ
OHQWRSDUDVDOVDVGHOLFDGDV
$OJRFDOLHQWH0DQWHQHUODFRPLGDFDOLHQWH
DEODQGDUODPDQWHTXLOOD
8QQLYHOLQIHULRUFRFLQDUiODFRPLGDGHIRUPD
PiVSDUHMD\QRQHFHVLWDUiTXHODDJLWHJLUH
RGpODYXHOWDWDQWR$OJXQDVFRPLGDVSXHGHQ
WHQHUPHMRUVDERUWH[WXUDRDVSHFWRVLVH
XVDXQQLYHOLQIHULRU8VHXQQLYHOGHSRWHQFLD
LQIHULRUFXDQGRHVWpFRFLQDQGRFRPLGDVTXH
WHQJDQWHQGHQFLDDKHUYLUFRPRODVSDSDV
JUDWLQDGDV
7HUPLQRORJtDGHPLFURRQGDV
7pUPLQR
'HILQLFLyQ
$UFRHOpFWULFR(ODUFRHOpFWULFRHVORTXHHQODWHUPLQRORJtDGHORVPLFURRQGDVGHVFULEHODVFKLVSDVHQHOKRUQR(ODUFR
HOpFWULFRVHSURGXFHFXDQGR
„ HOHVWDQWHGHPHWDOVHKDLQVWDODGRGHIRUPDLQFRUUHFWD\HVWiWRFDQGRODVSDUHGHVGHOPLFURRQGDV
„ KD\XQPHWDORSDSHOGHDOXPLQLRWRFDQGRHOODWHUDOGHOKRUQR
„ KD\SDSHOGHDOXPLQLRQRHVWiHQYROYLHQGRELHQODFRPLGDKD\ERUGHVGREODGRVKDFLDDUULEDTXH
DFW~DQFRPRDQWHQDV
„ KD\DOJ~QPHWDOFRPRFLQWDVGHFLHUUHFRQPHWDOSLQFKRVGHSROORRSODWRVFRQGHFRUDFLyQGHRUR
„ KD\SDSHOWRDOODUHFLFODGRTXHFRQWLHQHSHTXHxDVSLH]DVGHPHWDO
„ HOVRSRUWHGHODURGHOSODWRJLUDWRULRHVWiLQVWDODGRLQFRUUHFWDPHQWH
&XELHUWR
/DVFXELHUWDVPDQWLHQHQODKXPHGDGGHQWURSHUPLWLHQGRXQFDOHQWDPLHQWRPiVSDUHMR\UHGXFLHQGRHO
WLHPSRGHFRFFLyQ&XDQGRVHDJXMHUHDHOHQYROWRULRGHSOiVWLFRRVHFXEUHFRQSDSHOGHFHUDVHSHUPLWHOD VDOLGDGHOYDSRU
5HVJXDUGDU
(QXQKRUQRFRQYHQFLRQDOVHWDSDQRUHVJXDUGDQODVSHFKXJDVGHSROORRODVFRPLGDVKRUQHDGDVSDUD
TXHQRVHGRUHQGHPDVLDGR$OXVDUHOPLFURRQGDVXVHSHTXHxDVFLQWDVGHSDSHOGHDOXPLQLRSDUDFXEULU
SDUWHVILQDVFRPRODVSXQWDVGHODVDODVHQODVDYHVTXHSRGUtDQFRFLQDUVHDQWHVTXHODVSDUWHVPD\RUHV
7LHPSRGH
UHSRVR
&XDQGRFRFLQDHQKRUQRVUHJXODUHVODVFRPLGDVFRPRORVDVDGRVRSDVWHOHVVHGHMDQUHSRVDUSDUD
TXHDFDEHQGHFRFLQDUVHRVHDVLHQWHQ(OWLHPSRGHUHSRVRHVHVSHFLDOPHQWHLPSRUWDQWHDOFRFLQDUFRQ
PLFURRQGDV7HQJDHQFXHQWDTXHXQSDVWHOFRFLGRHQKRUQRPLFURRQGDVQRVHFRORFDHQXQHVWDQWH
GHHQIULDPLHQWR
$EULU
8QDYH]TXHKD\DFXELHUWRXQSODWRFRQILOPSOiVWLFRGHEHUiDEULUXQRULILFLRGHVSOHJDQGRXQD
UHVSLUDGHURV HVTXLQDSDUDTXHSXHGDHVFDSDUHOYDSRU
&DUDFWHUtVWLFDVGHPLFURRQGDVSRUVHQVRU
*($SSOLDQFHVFRP
6HQVRUGHKXPHGDG
4XpVXFHGHFXDQGRXVDODVIXQFLRQHVGHVHQVRUHV
/DVIXQFLRQHVGH6HQVRUGHWHFWDQODPD\RUKXPHGDGOLEHUDGDGXUDQWHODFRFFLyQ
(OKRUQRDMXVWDDXWRPiWLFDPHQWHHOWLHPSRGHFRFFLyQDORVGLIHUHQWHVWLSRV\FDQWLGDGHVGH
FRPLGD
1RXWLOLFHODVIXQFLRQHVGH6HQVRUGRVYHFHVFRQVHFXWLYDVHQODPLVPDSRUFLyQGHFRPLGD
3XHGHUHVXOWDUHQTXHORVDOLPHQWRVVHFRFLQHQHQH[FHVRRVHTXHPHQ6LODFRPLGDQRVHKD
FRFLQDGRSRUFRPSOHWRGHVSXpVGHODFXHQWDUHJUHVLYDXVHODIXQFLyQ7LPH&RRNSDUDWLHPSR
GHFRFFLyQDGLFLRQDO
127$ODVIXQFLRQHVGHVHQVRUQRHVWDUiQGLVSRQLEOHVFXDQGRHOKRUQRHVWiFDOLHQWH6LVHSXOVD
XQRGHORVERWRQHVGHFRFLQDUSRUVHQVRUFXDQGRODWHPSHUDWXUDGHQWURGHOKRUQRHVVXSHULRU
DORVž)DSDUHFHUiHOPHQVDMH´29(1722+27)256(1625&22.,1*86,1*$/7(51$7(
0(7+2'µ+RUQRGHPDVLDGRFDOLHQWHSDUDFRFLQDUSRUVHQVRU6HHVWiXWLOL]DQGRRWURPpWRGR
(OKRUQRFDPELDUiDXWRPiWLFDPHQWHDODIXQFLyQ´FRRNE\WLPHµFRFLQDUSRUWLHPSRVLJDODV
LQGLFDFLRQHVGHODSDQWDOODRXQDYH]TXHHOKRUQRHVWpORVXILFLHQWHPHQWHIUtRODVIXQFLRQHVGHO
VHQVRUVHHMHFXWDUiQGHIRUPDQRUPDO
„(VHVHQFLDOXVDUORVUHFLSLHQWHV\ODVWDSDVDSURSLDGRVSDUDFRFLQDUSRUVHQVRUGHIRUPD
ySWLPD
$JXMHUHDGR
„8VHVLHPSUHUHFLSLHQWHVDSWRVSDUDPLFURRQGDV\F~EUDORVFRQWDSDVRILOPGHSOiVWLFR
DJXMHUHDGR1RXVHQXQFDUHFLSLHQWHVFHUUDGRVSRUFRPSOHWR³SXHGHQKDFHUTXHHOYDSRU
QRVDOJD\FDXVDUTXHODFRPLGDVHFRFLQHGHPDVLDGR
&XELHUWR
„$VHJ~UHVHTXHWDQWRHOH[WHULRUGHORVUHFLSLHQWHVFRPRHOLQWHULRUGHOKRUQRPLFURRQGDV
HVWpQVHFRVDQWHVGHSRQHUODFRPLGDHQHOKRUQR/DVDFXPXODFLRQHV
GHKXPHGDGTXHVHFRQYLHUWHQHQYDSRUSXHGHQHQJDxDUDOVHQVRU
6HTXHORVSODWRVSDUDTXHQR
HQJDxHQDOVHQVRU
&DUDFWHUtVWLFDVGHPLFURRQGDVSRUVHQVRU
$XWR&RRNFRFLQDUDXWRPiWLFDPHQWHQRXWLOL]DUORVHVWDQWHVFXDQGRFRFLQDSRU
PLFURRQGDV
'DGRTXHODPD\RUtDGHORVUHFLSLHQWHVGHEHQHVWDUFXELHUWRVGXUDQWH$XWR&RRN
HVWDIXQFLyQWUDEDMDPHMRUFRQFRPLGDVTXHTXLHUDKDFHUDOYDSRURHQODVTXHTXLHUD
PDQWHQHUODKXPHGDG
127$1RVHUHFRPLHQGDHOXVRGHOHVWDQWHGHPHWDOFRQ$XWR&RRN
&RPLGDVUHFRPHQGDGDV
&RQHVWDIXQFLyQVHSXHGHQFRFLQDUXQDJUDQYDULHGDGGHFRPLGDVLQFOX\HQGRFDUQHV
SHVFDGR\YHJHWDOHV
&RPLGDVQRUHFRPHQGDGDV
1RGHEHUtDQFRFLQDUVHXVDQGRHVWDIXQFLyQDTXHOODVFRPLGDVTXHGHEDQFRFLQDUVH
GHVFXELHUWDVDTXHOODVTXHUHTXLHUDQDWHQFLyQFRQVWDQWHDTXHOODVTXHUHTXLHUDQDxDGLU
LQJUHGLHQWHVGXUDQWHVXFRFFLyQ\FRPLGDVTXHGHEDQWHQHUDSDULHQFLDVHFDRFRQXQD
VXSHUILFLHFUXMLHQWH(VPHMRUFRFLQDUWRGDVHVWDVXVDQGR7LPH&RRN
$XWR&RRNFRFLQDUDXWRPiWLFDPHQWH
QRXWLOL]DUORVHVWDQWHVFXDQGRFRFLQDSRU
PLFURRQGDV
127$1RXWLOLFHHVWDIXQFLyQ
GRVYHFHVFRQVHFXWLYDVHQ
ODPLVPDSRUFLyQGHFRPLGD
3XHGHUHVXOWDUHQTXHORV
DOLPHQWRVVHFRFLQHQHQ
H[FHVRRVHTXHPHQ
&RQVHMRVGHFRFFLyQ
„&XDQGRHOKRUQRKDFHXQDVHxDO\DSDUHFH
HOWLHPSRKDFLDDWUiVODSXHUWDSXHGH
DEULUVHSDUDUHPRYHUJLUDURGDUODYXHOWD
3RQJDODFRPLGDFXELHUWDHQHOKRUQR\
DODFRPLGD&LHUUHODSXHUWD\SUHVLRQH
FLHUUHODSXHUWD3XOVHHOERWyQ$872
67$573$86(SDUDVHJXLUFRFLQDQGR
&22.FRFFLyQDXWRPiWLFD$SDUHFHHQ
SDQWDOOD(17(5)22'7<3(LQWURGX]FDHO „$MXVWHODFDQWLGDGGHFRPLGDDOWDPDxR
GHOUHFLSLHQWH/OHQHORVUHFLSLHQWHVSRUOR
WLSRGHFRPLGD
PHQRVKDVWDODPLWDG
*LUHHOGLDODOWLSRGHFRPLGDGHVHDGR
„$VHJ~UHVHGHTXHODSDUWHH[WHULRUGHO
3UHVLRQHSDUDVHOHFFLRQDU
UHFLSLHQWH\HOLQWHULRUGHOKRUQRHVWpQ
9HUOD7DEODGH7LSRVGH&RPLGDVFRQ6HQVRU
VHFRV
GHPiVDEDMRSDUDWLSRVHVSHFtILFRVGH
„8QDYH]FRPSOHWDGRHOFLFORGH&RFFLyQVL
FRPLGDVHLQVWUXFFLRQHV
ODFRPLGDQHFHVLWDFRFHUVHPiVYXpOYDOD
(OKRUQRHPSLH]DDIXQFLRQDU
DSRQHUHQHOKRUQR\XVH7LPH&RRNSDUD
LQPHGLDWDPHQWH
DFDEDUGHFRFLQDUOD
127$6LODSXHUWDVHDEUHPLHQWUDVVHHVWi
VHOHFFLRQDQGRHOFRQWUROFLpUUHOD\SUHVLRQHHO &yPRDMXVWDUODFRQILJXUDFLyQ
ERWyQ67$573$86(SDUDHPSH]DUDFRFLQDU DXWRPiWLFDGHOKRUQRSDUDXQWLHPSR
GHFRFFLyQPiVFRUWRRPiVODUJR
6LODFRPLGDQRVHKDFRFLQDGRSRUFRPSOHWR QRGLVSRQLEOHSDUDWRGRVORVWLSRVGH
GHVSXpVGHODFXHQWDUHJUHVLYDXVHOD
DOLPHQWRV
IXQFLyQ7LPH&RRNSDUDWLHPSRGHFRFFLyQ
3DUDUHVWDUHOGHOWLHPSRGHFRFFLyQ
DGLFLRQDO
DXWRPiWLFR
1RDEUDODSXHUWDGHOKRUQRDQWHVGHTXH
(QORVSULPHURVVHJXQGRVWUDVHOKRUQR
HOWLHPSRGHFXHQWDDWUiVDSDUH]FDHQ
FRPLHQ]DDIXQFLRQDUJLUHHOGLDOHQHO
ODSDQWDOOD³HOYDSRUTXHVHHVFDSDGHO
VHQWLGRFRQWUDULRGHODVDJXMDVGHOUHORMKDVWD
KRUQRSXHGHDIHFWDUODFRFFLyQ6LVHDEUH
TXHDSDUH]FDXQVLJQRPHQRV´²µ
ODSXHUWDFLpUUHOD\SUHVLRQH67$573$86(
\SXOVHSDUDLQWURGXFLUODVHOHFFLyQ
LQPHGLDWDPHQWH
3DUDDJUHJDUHODOWLHPSRGHFRFFLyQ
6LVHOHFFLRQDFDUQHSLFDGDJURXQGPHDWHO
DXWRPiWLFR
KRUQRSXHGHTXHOHLQGLTXHTXHOHH[WUDLJD
'HQWURGHORVSULPHURVVHJXQGRVWUDVHO
HOOtTXLGR\ODUHPXHYD$EUDODSXHUWDVHTXH KRUQRFRPLHQ]DDIXQFLRQDUJLUHHOGLDOHQ
ODFDUQH\FLHUUHODSXHUWD3UHVLRQHHOERWyQ
HOVHQWLGRGHODVDJXMDVGHOUHORMKDVWDTXH
67$573$86(VLIXHUDQHFHVDULRSDUDVHJXLU DSDUH]FDXQVLJQRPiV´µ\SXOVHSDUD
FRQODFRFFLyQ
LQWURGXFLUODVHOHFFLyQ
*($SSOLDQFHVFRP
7DEODGHWLSRVGHFRPLGDVFRQVHQVRU
7LSRGHFRPLGD
5DFLRQHV 7DPDxRVGHODVUDFLRQHV
&RPHQWDULRV
3LH]DVGHSROOR
D
D
SLH]DV
8VHXQSODWRRYDODGRFXDGUDGRRUHGRQGR
&XEUDFRQHQYROWXUDSOiVWLFDYHQWLODGD
3HVFDGR
D
DR]
8VHXQSODWRRYDODGRFXDGUDGRRUHGRQGR
&~EUDORFRQXQILOPSOiVWLFRDJXMHUHDGR
³
DR]
8VHSODWRGHJXLVRVUHGRQGR5HSDUWDODFDUQH HQHOSODWR&~EUDORFRQXQSDSHOGHFHUDRXQ ILOPSOiVWLFRDJXMHUHDGR
3DSDV
D
DR]
5RPSDODSLHOFRQXQWHQHGRU$UUpJOHODVHQXQ SDWUyQHQIRUPDGHHVWUHOODDOFHQWURGHOSODWR JLUDWRULR
9HJHWDOHVHQODWDGRV
D
DR]
8VHFD]XHODGHJXLVRVSDUDPLFURRQGDVWD]yQ RERO&~EUDORFRQXQDWDSDRXQILOPSOiVWLFR
DJXMHUHDGR
9HJHWDOHVIUHVFRV
D
DR]
8VHFD]XHODGHJXLVRVSDUDPLFURRQGDVWD]yQ RERO$xDGDGRVFXFKDUDGDVGHDJXDSRUFDGD UDFLyQ&~EUDORFRQXQDWDSDRXQILOPSOiVWLFR DJXMHUHDGR
9HJHWDOHVFRQJHODGRV
D
DR]
8VHFD]XHODGHJXLVRVSDUDPLFURRQGDVWD]yQ
RERO6LJDODVLQVWUXFFLRQHVGHOSDTXHWHHQ
FXDQWRDODJXDDDxDGLU&~EUDORFRQXQDWDSDR
XQILOPSOiVWLFRDJXMHUHDGR
&DUQHSLFDGD
7HUQHUD3XHUFR3DYR
3RSFRUQURVHWDVRSDORPLWDVGH
PDt]QRXWLOL]DUORVHVWDQWHVFXDQGRFRFLQD
SRUPLFURRQGDV
8VHVyORFRQSDORPLWDVR
URVHWDVSUHHPSDTXHWDGDV
SDUDPLFURRQGDVTXHSHVHQ
GHDRQ]DV
127$1RXWLOLFHHVWDIXQFLyQ
GRVYHFHVFRQVHFXWLYDVHQOD
PLVPDSRUFLyQGHFRPLGD
3XHGHUHVXOWDUHQTXHORV
DOLPHQWRVVHFRFLQHQHQ
H[FHVRRVHTXHPHQ
3DUDXVDUODIXQFLyQ3RSFRUQ
6LJDODVLQGLFDFLRQHVGHOSDTXHWHXVH
7LPH&RRNVLHOSDTXHWHSHVDPHQRVGH
RQ]DVRHVPD\RUGHRQ]DV6LW~H
HOSDTXHWHGHURVHWDVHQHOFHQWURGHO
SODWRJLUDWRULR
3UHVLRQHHOERWyQ323&251XQDRGRV
YHFHV(OKRUQRHPSLH]DDIXQFLRQDU
LQPHGLDWDPHQWH
6LDEUHODSXHUWDPLHQWUDVDSDUHFHHQ
SDQWDOOD323&2516(1625VHQVRUGH
SDORPLWDVDSDUHFHUiXQPHQVDMHGH
HUURU&LHUUHODSXHUWDSXOVH&/($52))
ERUUDUGHVDFWLYDU\FRPLHQFHGHQXHYR
6LODFRPLGDQRVHKDFRFLQDGRSRUFRPSOHWR
GHVSXpVGHODFXHQWDUHJUHVLYDXVHOD
IXQFLyQ7LPH&RRNSDUDWLHPSRGHFRFFLyQ
DGLFLRQDO
&yPRDMXVWDUODFRQILJXUDFLyQDXWRPiWLFD
SDUDSDORPLWDVGHPDt]SDUDXQPD\RUR
PHQRUWLHPSRGHFRFFLyQ
6LVHGDFXHQWDGHTXHHQODEROVDGHOD
PDUFDGHSDORPLWDVTXHXVDTXHGDPXFKR
PDt]VLQUHYHQWDURORFXHFHGHPDVLDGR
SXHGHDxDGLURVXEVWUDHU²VHJXQGRVDO
WLHPSRDXWRPiWLFRGHFRFFLyQ
3DUDVXVWUDHUWLHPSR
$QWHVGHTXHDFDEHQORVSULPHURV
VHJXQGRVGHVGHTXHHOKRUQRVHSRQHHQ
IXQFLRQDPLHQWRJLUHHOGLDOHQHOVHQWLGR
FRQWUDULRDODVDJXMDVGHOUHORMSDUD
VHJXQGRV²PHQRVGHWLHPSRGHFRFFLyQ
3XOVHSDUDLQWURGXFLUODVHOHFFLyQ*LUHGH
QXHYRKDVWDTXHDSDUH]FDQGRVVLJQRV
PHQRV´µSDUDUHGXFLUHOWLHPSRGHFRFFLyQ
HQRWURVVHJXQGRVKDVWDXQDFDQWLGDGGH
UHGXFFLyQGHWLHPSRGHVHJXQGRV3XOVH
SDUDLQWURGXFLUODVHOHFFLyQ
3DUDDxDGLUWLHPSR
$QWHVGHTXHDFDEHQORVSULPHURV
VHJXQGRVGHVGHTXHHOKRUQRVHSRQHHQ
IXQFLRQDPLHQWRJLUHHOGLDOHQHOVHQWLGR
GHODVDJXMDVGHOUHORMVHJXQGRVPiV
DOWLHPSRGHFRFFLyQ3XOVHSDUDLQWURGXFLU
ODVHOHFFLyQ*LUHGHQXHYRKDVWDTXH
DSDUH]FDQGRVVLJQRVPiV´µSDUDDxDGLU
RWURVVHJXQGRVKDVWDXQWRWDOGH
VHJXQGRVGHWLHPSRDGLFLRQDO3XOVHSDUD
LQWURGXFLUODVHOHFFLyQ
&DUDFWHUtVWLFDVGHPLFURRQGDVSRUVHQVRU
5HKHDWUHFDOHQWDU
REHEAT
127$1RXWLOLFHHVWDIXQFLyQ
GRVYHFHVFRQVHFXWLYDVHQ
ODPLVPDSRUFLyQGHFRPLGD
3XHGHUHVXOWDUHQTXHORV
DOLPHQWRVVHFRFLQHQHQ
H[FHVRRVHTXHPHQ
QRXWLOL]DUORVHVWDQWHVFXDQGRFRFLQDSRU
PLFURRQGDV
/DIXQFLyQGHUHFDOHQWDU5HKHDWYXHOYHD
FDOHQWDUUDFLRQHVGHFRPLGDVSUHYLDPHQWH
FRFLQDGDVRXQSODWRGHVREUDV
&RORTXHODWD]DGHOtTXLGRRFRPLGD
FXELHUWDHQHOKRUQR3XOVH5(+($7
UHFDOHQWDUXQDGRVWUHVRFXDWURYHFHV
(OKRUQRHPSLH]DDIXQFLRQDU
DXWRPiWLFDPHQWH
3UHVLRQHXQDYH]SDUDXQSODWRGHVREUDV
3XOVHGRVYHFHVSDUDSDVWD
3UHVLRQHWUHVYHFHVSDUDFDQWLGDGHVGH
DWD]DOOHQD
3XOVHFXDWURYHFHVSDUDHQWUH\
WD]DVOOHQDV
(OKRUQRGDXQDVHxDOFXDQGRDGYLHUWH
TXHKD\YDSRU\HPSLH]DDPRVWUDUVH
KDFLDDWUiVHOWLHPSRTXHTXHGD
1RDEUDODSXHUWDGHOKRUQRKDVWDTXHHO
WLHPSRHQHOKRUQRDSDUH]FDHQFXHQWD
DWUiV6LVHDEUHODSXHUWDFLpUUHOD\SUHVLRQH
67$573$86(LQPHGLDWDPHQWH
8QDYH]TXHKD\DUHWLUDGRODFRPLGDGHO
KRUQRUHPXpYDODVLHVSRVLEOHSDUDLJXDODU
ODWHPSHUDWXUD/DVFRPLGDVUHFDOHQWDGDV
SXHGHQWHQHUJUDQGHVGLIHUHQFLDVGH
WHPSHUDWXUD$OJXQDViUHDVSXHGHQHVWDU
H[WUHPDGDPHQWHFDOLHQWHV
6LODFRPLGDQRHVWiVXILFLHQWHPHQWHFDOLHQWH
GHVSXpVGHODFXHQWDUHJUHVLYDXVH7LPH
&RRNWLHPSRDGLFLRQDOSDUDUHFDOHQWDU
1RHVWiUHFRPHQGDGRHOXVRGHUHKHDWSDUD
DOJXQDVFRPLGDV
(VPHMRUXVDU7LPH&RRNHQHVWRVFDVRV
„3URGXFWRVGHSDQ
„&RPLGDVTXHGHEHQUHFDOHQWDUVHVLQFXEULU
„$OLPHQWRVTXHQHFHVLWHQUHPRYHUVHR
URWDUVH
„&RPLGDVTXHQHFHVLWHQWHQHUXQDVSHFWR
VHFRRXQDVXSHUILFLHFUXMLHQWHWUDVVHU
UHFDOHQWDGRV
&yPRDMXVWDUODFRQILJXUDFLyQ
DXWRPiWLFDGHOKRUQRSDUDXQPD\RUR
PHQRUWLHPSRGHFRFFLyQ
3DUDVXVWUDHUXQGHOWLHPSRGH
FRFFLyQDXWRPiWLFR
$QWHVGHTXHDFDEHQORVSULPHURV
VHJXQGRVGHVGHTXHHOKRUQRVHSRQHHQ
IXQFLRQDPLHQWRJLUHHOGLDOHQHOVHQWLGR
FRQWUDULRDODVDJXMDVGHOUHORM\SUHVLyQHOR
SDUDVHOHFFLRQDU
3DUDDxDGLUXQGHOWLHPSRGHFRFFLyQ
DXWRPiWLFR
$QWHVGHTXHDFDEHQORVSULPHURV
VHJXQGRVGHVGHTXHHOKRUQRVHSRQHHQ
IXQFLRQDPLHQWRJLUHHOGLDOHQHOVHQWLGR
GHODVDJXMDVGHOUHORM\SUHVLyQHORSDUD
VHOHFFLRQDU
$FHUFDGHODVIXQFLRQHV
GH+RUQHDGR\$VDGR
3RVLFLyQFRUUHFWDGHOHVWDQWH
(OSURFHVRGHKRUQHDGRRDVDGRXWLOL]DXQHOHPHQWRGHFDOHIDFFLyQSDUDDXPHQWDUHODLUHGHO
LQWHULRUGHOKRUQR3XHGHHVWDEOHFHUVHFXDOTXLHUWHPSHUDWXUDGHKRUQRHQWUHž)\ž)
8QYHQWLODGRUKDFHFLUFXODUOLJHUDPHQWHHODLUHSRUWRGRHOKRUQRSRUHQFLPD\DOUHGHGRUGH
ODFRPLGDSURGXFLHQGRTXHVHGRUHSRUIXHUD\TXHORVLQWHULRUHVVHDQULFRV\MXJRVRV(VWD
FLUFXODFLyQGHDLUHFDOLHQWHHVOODPDGDFRQYHFFLyQ
'HELGRDTXHHODLUHVHPDQWLHQHHQFRQVWDQWHPRYLPLHQWRDOQRSHUPLWLUVHODIRUPDFLyQ
GHXQDFDSDGHDLUHPiVIUtRDOUHGHGRUGHODFRPLGDDOJXQDVFRPLGDVVHFRFLQDQPiV
UiSLGDPHQWHTXHHQXQKRUQRGHFRFLQDQRUPDO
9HDODVHFFLyQGH&RQVHMRVGH8WHQVLOLRVGH&RFLQDSDUDLQIRUPDFLyQVREUHXWHQVLOLRV
UHFRPHQGDGRV
3DUDFRQVHJXLUPHMRUHVUHVXOWDGRV
3RVLFLyQLQFRUUHFWDGHOHVWDQWH
8WLOLFHXQHVWDQWHHQODSRVLFLyQLQIHULRU\GHMHXQDEUHFKDGHDOPHQRVXQDSXOJDGDHQWUHHO
SODWRGHFRFFLyQ\ORVODWHUDOHVGHOKRUQR3DUDFRFFLyQDGRVQLYHOHVH[FOXVLYDPHQWHXWLOLFH
DPERVHVWDQWHV
(OHVWDQWHVHQHFHVLWDSDUDODEXHQDFLUFXODFLyQGHODLUH\SDUDGRUDU
9HDODVHFFLyQGH&RQVHMRVGH8WHQVLOLRVGH&RFLQDSDUDLQIRUPDFLyQVREUHXWHQVLOLRV
UHFRPHQGDGRV
*($SSOLDQFHVFRP
+RUQHDGRRDVDGRFRQSUHFDOHQWDPLHQWR
3UHVLRQHHOERWyQ%$.(KRUQHDUR
52$67DVDU
*LUHHOGLDOSDUDDMXVWDUHOWLHPSRGHO
KRUQR\SUHVLyQHORSDUDVHOHFFLRQDU1R
LQWURGX]FDHOWLHPSRGHKRUQHDGRD~Q(O
WLHPSRGHFRFFLyQVHLQWURGXFLUiPiV
DGHODQWHXQDYH]TXHHOKRUQRVHKD\D
UHFDOHQWDGR&RQVXOWHODVHFFLyQ
VLJXLHQWH&RQYHUVLyQ$XWR5HFLSHŒ
3UHVLRQHHOERWyQ67$573$86(SDUD
HPSH]DUDSUHFDOHQWDU
(OKRUQRGDUiXQDVHxDOFXDQGRHVWp
UHFDOHQWDGR6LQRDEUHODSXHUWDHQ
PHQRVGHXQDKRUDHOKRUQRVHDSDJDUi
GHIRUPDDXWRPiWLFD
$EUDODSXHUWDGHOKRUQR\FRQFXLGDGR
LQWURGX]FDODFRPLGDHQHOPLVPR
&LHUUHODSXHUWDGHOKRUQR*LUHHO
GLDOSDUDDMXVWDUHOWLHPSRGHFRFFLyQ\
SUHVLRQH67$573$86(SDUDHPSH]DUD
FRFLQDU
&XDQGRVHDFDEHGHFRFLQDUHOKRUQR
GDUiXQDVHxDO\VHDSDJDUi
127$3RGUiFDPELDUHOWLHPSRGHFRFFLyQ
HQFXDOTXLHUPRPHQWRGXUDQWHODFRFFLyQ
JLUDQGRHOGLDO
3RGUiFDPELDUODWHPSHUDWXUDGHOKRUQR
HQFXDOTXLHUPRPHQWRGXUDQWHODFRFFLyQ
SUHVLRQDQGRHOERWyQ32:(5*LUHHO
GLDOSDUDILMDUODWHPSHUDWXUDGHOKRUQR\
SUHVLRQHHOGLDOSDUDVHOHFFLRQDU
3DUDYHUHOWLHPSRGHFRFFLyQ\OD
WHPSHUDWXUDGHOKRUQRGXUDQWHHOWLHPSR
GHFRFLQDGRSUHVLRQHHOERWyQ%$.(
+RUQHDU5HGX]FDODWHPSHUDWXUDGHOD
UHFHWDGHOKRUQRHQƒ)SDUDDOLPHQWRV
KRUQHDGRV
+RUQHDGRRDVDGRVLQSUHFDOHQWDPLHQWR
6LVXUHFHWDQRQHFHVLWDSUHFDOHQWDUHO
KRUQRSUHVLRQHHOERWyQ%$.(R
52$67&RQVXOWHODVHFFLyQVLJXLHQWH
&RQYHUVLyQ$XWR5HFLSHŒ
*
LUHHOGLDOSDUDDMXVWDUODWHPSHUDWXUD
GHOKRUQR\SUHVLyQHORSDUDVHOHFFLRQDU
*
LUHHOGLDOSDUDDMXVWDUHOWLHPSRGH
FRFFLyQ\SUHVLyQHORSDUDVHOHFFLRQDU
3UHVLRQHHOERWyQ67$573$86(SDUD
SRQHUHOKRUQRHQPDUFKD
127$3RGUiFDPELDUHOWLHPSRGH
FRFFLyQHQFXDOTXLHUPRPHQWRGXUDQWH
ODFRFFLyQJLUDQGRHOGLDO
3RGUiFDPELDUODWHPSHUDWXUDGHOKRUQR
HQFXDOTXLHUPRPHQWRGXUDQWHODFRFFLyQ
SUHVLRQDQGRHOERWyQ32:(5*LUHHO
GLDOSDUDILMDUODWHPSHUDWXUDGHOKRUQR\
SUHVLRQHHOGLDOSDUDVHOHFFLRQDU
3DUDYHUHOWLHPSRGHFRFFLyQ\OD
WHPSHUDWXUDGHOKRUQRGXUDQWHHOWLHPSR
GHFRFLQDGRSUHVLRQHHOERWyQ%$.(
+RUQHDU
&RQYHUVLyQ$XWR5HFLSHŒ
&XDQGRXVHHO+251($'2325&219(&&,Ï1ODIXQFLyQGH&RQYHUVLyQ$XWR5HFLSHŒ
FRQYHUWLUiDXWRPiWLFDPHQWHODVWHPSHUDWXUDVGHKRUQHDGRUHJXODUHVDWHPSHUDWXUDVGH
KRUQHDGRSRUFRQYHFFLyQ
&XDQGRHVWDIXQFLyQVHDFWLYDHOYLVRUPRVWUDUiODOH\HQGD2))6(721\ODWHPSHUDWXUDUHDO
FRQYHUWLGDUHGXFLGD3RUHMHPSORVLLQJUHVDXQDWHPSHUDWXUDUHJXODUGHUHFHWDGHƒ)\
RSULPHHOERWyQ67$57HOYLVRUPRVWUDUiODWHPSHUDWXUDFRQYHUWLGDGHƒ)
(VWDIXQFLyQVHSXHGHDSDJDUHQHOPHQ~GHRSFLRQHV237,216&RQVXOWHODVHFFLyQ
&RQYHUVLyQ$XWR5HFLSHŒHQODVHFFLyQ/DVRWUDVIXQFLyQHV
127$6LHOKRUQHDGRHVSRUFRQYHFFLyQ\ODIXQFLyQGH&RQYHUVLyQ$XWR5HFLSHŒHVWi
DSDJDGDUHGX]FDODWHPSHUDWXUDGHOKRUQRƒ)GHODTXHLQGLTXHODUHFHWDSDUDHYLWDUTXH
VHGRUHQGHPDVLDGRORVDOLPHQWRVKRUQHDGRV
)XQFLyQGHKRUQHDGRUiSLGR
)DVW%DNHKRUQHDGRUiSLGROHRIUHFHODVPHMRUHVIXQFLRQHVGHODHQHUJtDGHPLFURRQGDVFRQ
ODFRFLQDSRUFRQYHFFLyQ/DVPLFURRQGDVFRFLQDQODFRPLGDGHIRUPDUiSLGD\ODFLUFXODFLyQGH
FRQYHFFLyQGHODLUHFDOLHQWHGRUDORVDOLPHQWRVGHIRUPDPDUDYLOORVD3XHGHSURJUDPDUVHFXDOTXLHU
WHPSHUDWXUDHQWUHORVƒ)\ORVƒ)
3DUDFRQVHJXLUPHMRUHVUHVXOWDGRV
3RVLFLyQFRUUHFWDGHOHVWDQWH
8WLOLFHXQHVWDQWHHQODSRVLFLyQLQIHULRU\GHMHXQHVSDFLRGHDOPHQRVXQDSXOJDGDHQWUHHOSODWRTXH
HVWpFRFLQDQGR\ORVODGRVGHOKRUQR8WLOLFHDPERVHVWDQWHV~QLFDPHQWHSDUDFRFLQDUDGRVQLYHOHV
(OHVWDQWHVHQHFHVLWDSDUDODEXHQDFLUFXODFLyQGHODLUH\SDUDGRUDU
9HDODVHFFLyQGH&RQVHMRVGH8WHQVLOLRVGH&RFLQDSDUDLQIRUPDFLyQVREUHXWHQVLOLRV
UHFRPHQGDGRV
3RVLFLyQLQFRUUHFWDGHOHVWDQWH
9HUOD6HFFLyQ0HMRU0pWRGRGH&RFFLyQSDUDGHWHUPLQDUFXiOHVDOLPHQWRVVRQDSURSLDGRVSDUD
FRFLQDUXVDQGR)DVW%DNH
+RUQHRUiSLGRFRQSUHFDOHQWDPLHQWR
3UHVLRQHHOERWyQ)$67%$.(
*LUHHOGLDOSDUDDMXVWDUHOWLHPSRGHOKRUQR
\SUHVLyQHORSDUDVHOHFFLRQDU1R
LQWURGX]FDHOWLHPSRGHFRFFLyQ)$67
%$.(D~Q(OWLHPSRGHFRFFLyQVH
LQWURGXFLUiPiVDGHODQWHXQDYH]TXHHO
KRUQRVHKD\DUHFDOHQWDGR
UHVLRQHHOGLDORHOERWyQ67$573$86(
3SDUDHPSH]DUDSUHFDOHQWDU
(OKRUQRGDUiXQDVHxDOFXDQGRHVWp
UHFDOHQWDGR6LQRDEUHODSXHUWDHQPHQRV
GHXQDKRUDHOKRUQRVHDSDJDUiGHIRUPD
DXWRPiWLFD
$EUDODSXHUWDGHOKRUQR\FRQFXLGDGR
LQWURGX]FDODFRPLGDHQHOPLVPR
&LHUUHODSXHUWDGHOKRUQR*LUHHO
GLDOSDUDDMXVWDUHOWLHPSRGHFRFFLyQ
\SUHVLyQHORSDUDVHOHFFLRQDU3UHVLRQH
HOGLDORHOERWyQ67$573$86(SDUD
HPSH]DUDFRFLQDU
&XDQGRVHDFDEHGHFRFLQDUHOKRUQRGDUi
XQDVHxDO\VHDSDJDUi
HQFXDOTXLHUPRPHQWRGXUDQWHODFRFFLyQ
JLUDQGRHOGLDO
3RGUiFDPELDUODWHPSHUDWXUDGHOKRUQR\HO
QLYHOGHSRWHQFLDGHOPLFURRQGDVHQFXDOTXLHU
PRPHQWRGXUDQWHODFRFFLyQSUHVLRQDQGR
HOERWyQ32:(5*LUHHOGLDOSDUDILMDUOD
WHPSHUDWXUDGHOKRUQR\SUHVLRQHHOGLDO
SDUDVHOHFFLRQDU/XHJRJLUHHOGLDOSDUD
ILMDUHOQLYHOGHOPLFURRQGDVGHKDVWD
\SUHVLRQHHOGLDOSDUDVHOHFFLRQDU(OQLYHO
SUHGHWHUPLQDGRGHOKRUQRHV
3DUDYHUHOWLHPSRGHFRFFLyQ\OD
WHPSHUDWXUDGHOKRUQRGXUDQWHHOWLHPSR
GHFRFFLyQSUHVLRQHHOERWyQ)$67%$.(
+RUQHDUUiSLGR
„5HYLVHODVHFFLyQGH&RQVHMRVGH8WHQVLOLRVGH&RFLQD
SDUDXVDUORVXWHQVLOLRVFRUUHFWRVDOXVDU)DVW%DNH
„1RXVHXWHQVLOLRVPHWiOLFRVFRQ)DVW%DNH
„5HGX]FDHOWLHPSRGHFRFLQDGRGHODUHFHWD
HQ
„9HUOD6HFFLyQ0HMRU0pWRGRGH&RFFLyQSDUD
GHWHUPLQDUFXiOHVDOLPHQWRVVRQDSURSLDGRVSDUD
FRFLQDUXVDQGR)DVW%DNH
127$3RGUiFDPELDUHOWLHPSRGHFRFFLyQ
+RUQHRUiSLGRVLQSUHFDOHQWDPLHQWR
6LVXUHFHWDQRQHFHVLWDSUHFDOHQWDUHOKRUQR
SUHVLRQHHOERWyQ)$67%$.(
*LUHHOGLDOSDUDDMXVWDUODWHPSHUDWXUDGHOKRUQR\
SUHVLyQHORSDUDVHOHFFLRQDU
SUHVLyQHORSDUDVHOHFFLRQDU
3DUDYHUHOWLHPSRGHFRFFLyQ\ODWHPSHUDWXUDGHO
KRUQRGXUDQWHHOWLHPSRGHFRFFLyQSUHVLRQHHO
ERWyQ)$67%$.(+RUQHDUUiSLGR
3UHVLRQHHOGLDORHOERWyQ67$573$86(SDUD
SRQHUHOKRUQRHQPDUFKD
127$
„$OJXQDVUHFHWDVUHTXLHUHQHOSUHFDOHQWDPLHQWR
*LUHHOGLDOSDUDDMXVWDUHOWLHPSRGHFRFFLyQ\
127$3RGUiFDPELDUHOWLHPSRGHFRFFLyQHQ
FXDOTXLHUPRPHQWRGXUDQWHODFRFFLyQJLUDQGR
HOGLDO
3RGUiFDPELDUODWHPSHUDWXUDGHOKRUQR\HO
QLYHOGHSRWHQFLDGHOPLFURRQGDVHQFXDOTXLHU
PRPHQWRGXUDQWHODFRFFLyQSUHVLRQDQGRHOERWyQ
32:(5*LUHHOGLDOSDUDILMDUODWHPSHUDWXUDGHO
KRUQR\SUHVLRQHHOGLDOSDUDVHOHFFLRQDU/XHJR
JLUHHOGLDOSDUDILMDUHOQLYHOGHOPLFURRQGDVGH
KDVWD\SUHVLRQHHOGLDOSDUDVHOHFFLRQDU(OQLYHO
SUHGHWHUPLQDGRGHOKRUQRHV
„5HYLVHODVHFFLyQGH&RQVHMRVGH8WHQVLOLRVGH&RFLQD
SDUDXVDUORVXWHQVLOLRVFRUUHFWRVDOXVDU)DVW%DNH
„1RXVHXWHQVLOLRVPHWiOLFRVFRQ)DVW%DNH
„9HUOD6HFFLyQ0HMRU0pWRGRGH&RFFLyQSDUD
GHWHUPLQDUFXiOHVDOLPHQWRVVRQDSURSLDGRVSDUD
FRFLQDUXVDQGR)DVW%DNH
„5HGX]FDHOWLHPSRGHFRFLQDGRGHODUHFHWDHQ
&RQVHMRVGHXWHQVLOLRVGHFRFLQD
*($SSOLDQFHVFRP
+RUQHDGRRDVDGRSRUFRQYHFFLyQ
6HUHFRPLHQGDHOXVRGHEDQGHMDVPHWiOLFDVSDUDWRGRWLSRGHSURGXFWRVKRUQHDGRV
SHURHVSHFLDOPHQWHFXDQGRHVLPSRUWDQWHTXHHVWpQGRUDGRV
/DVEDQGHMDVFRQDFDEDGRVRVFXURVRPDWHVVRQPHMRUHVSDUDSDQHV\SDVWHOHVUHOOHQRV
\DTXHDEVRUEHQFDORU\SURGXFHQXQH[WHULRUPiVFUXMLHQWH
/DVEDQGHMDVGHDOXPLQLREULOODQWHVVRQPHMRUHVSDUDSDVWHOHVJDOOHWDVRPDJGDOHQDV
PXIILQV\DTXHODVPLVPDVUHIOHMDQHOFDORU\D\XGDQDSURGXFLUXQH[WHULRUVXDYHPHQWH
FUXMLHQWH\WLHUQR
/DVFD]XHODVRSODWRVGHKRUQRGHFULVWDORGHFHUiPLFDDFULVWDODGDVRQPHMRUHVSDUD
UHFHWDVGHKXHYRV\TXHVR\DTXHHOFULVWDOVHOLPSLDIiFLOPHQWH
+RUQHDGRUiSLGRFRPELQDGR
6HUHFRPLHQGDXVDUUHFLSLHQWHVGHFULVWDORFHUiPLFDDFULVWDODGD$VHJ~UHVHGHTXH
QRXVDDUWtFXORVFRQGHFRUDFLRQHVPHWiOLFDV\DTXHSRGUtDQFDXVDUDUFRVHOpFWULFRV
FKLVSDVFRQODVSDUHGHVRHOHVWDQWHGHOPLFURRQGDV(VWRSXHGHGDxDUORVXWHQVLOLRVHO
HVWDQWHRHOKRUQR
3XHGHQXVDUVHXWHQVLOLRVGHPLFURRQGDVGHSOiVWLFRUHVLVWHQWHDOFDORUVHJXURVSDUD
XVRHQƒ)SHURQRVHUHFRPLHQGDSDUDFRPLGDVTXHQHFHVLWHQHVWDUGRUDGDVSRU
FRPSOHWR\DTXHHOSOiVWLFRHVXQSREUHFRQGXFWRUGHFDORU
8WHQVLOLRV
0LFURRQGDV
+RUQHDGRR$VDGR
+RUQHDGR
GHFRQYHFFLyQ
UiSLGRFRPELQDGR
&ULVWDOUHVLVWHQWHDOFDORUFHUiPLFDDFULVWDODGD
3\UH[Š)LUH.LQJŠ&RUQLQJ:DUHŠHWF
6t
6t
6t
0HWDO
1R
6t
1R
&ULVWDOQRUHVLVWHQWHDOFDORU
1R
1R
1R
3OiVWLFRVDSWRVSDUDPLFURRQGDV
6t
1R
6tM
)LOPVSOiVWLFRVRHQYROWRULRV
6t
1R
1R
3URGXFWRVGHSDSHO
6t
1R
1R
3DMDPLPEUH\PDGHUD
6t
1R
1R
8VDUVyORFRQXWHQVLOLRVSDUDPLFURRQGDVTXHSXHGDQVRSRUWDUƒ)GHWHPSHUDWXUD
Q
6HOHFFLRQHHOPHMRUPpWRGRGHFRFFLyQ
8VHODWDEODVLJXLHQWHSDUDVHOHFFLRQDUHOPHMRUPpWRGRSDUDFRFLQDU/DVUHFHWDVSXHGHQVHUDGDSWDGDVXVDQGROD
WDEODDFRQWLQXDFLyQSDUDGHWHUPLQDUHOPRGRGHFRFFLyQDSURSLDGR
&RPLGDV
0LFURRQGDV +RUQHDGR $VDGR+RUQHDUUiSLGR
$SHULWLYRV
6DOVDVSDUDPRMDU\XQWDU
9
6QDFNVGHSDVWHOHUtD
9
9
9
%HELGDV
9
6DOVDV\DFDEDGRV
9
6RSDV\HVWRIDGRV
9
&DUQHV
'HVFRQJHODFLyQ
9
$VDGRV
9
9
$YHV
'HVFRQJHODFLyQ
9
$VDGRV
9
9
9
3HVFDGR\PDULVFRV
'HVFRQJHODFLyQ
9
&RFFLyQ
9
9
9
*XLVRV
9
9
9
+XHYRV\TXHVR
5HYXHOWRVWRUWLOODV
9
9
4XLFKHVRXIOp
9
9
9HJHWDOHVIUHVFRV
9
3DQHV
0DJGDOHQDVSDVWHOGHWp
9
9
0DVDGHOHYDGXUD
9
/HYDGXUD
9
3RVWUHV
3DVWHOHVSDVWHOHVFRQFDSDV\EXQGW
9
&DEHOORGHDQJHO\SDVWDILQD
9
)ODQ\SXGtQ
9
*DOOHWDVDODUJDGDV
9
9
)UXWD
9
3DVWHOHVUHOOHQRV\SDVWHOHUtD
9
'XOFHV
9
9HJHWDOHVEODQTXHDGRV
9
$OLPHQWRVSUHSDUDGRVFRQJHODGRV 9
9
9
&RQYHUVLRQHVGH5HFHWDV
+RUQHDGRUiSLGRFRPELQDGR
$OXWLOL]DUODIXQFLyQ+251($'25È3,'2&20%,1$'2UHGX]FDHOWLHPSRGHFRFFLyQ
LQGLFDGRHQODUHFHWDHQXQ
3RUHMHPSOR8QDUHFHWDLQGLFDFRFLQDUXQDVDGRGXUDQWHPLQXWRVDž)
PLQXWRV[ VHDKRUUDQPLQXWRV
3RUORWDQWRHOQXHYRWLHPSRGHFRFFLyQHQHOPRGR+251($'25È3,'2VHUi
PLQXWRV²PLQXWRV PLQXWRV
$FHUFDGHODIXQFLyQ´FDOHQWDUµ
*($SSOLDQFHVFRP
/DIXQFLyQ&$/(17$5PDQWHQGUiFDOLHQWHVODVFRPLGDV\DKRUQHDGDVDXQDWHPSHUDWXUD
ySWLPDSDUDVHUYLUODV&RPLHQFHVLHPSUHSRUFRPLGDFDOLHQWH8WLOLFHUHFLSLHQWHV\XWHQVLOLRVGH
FRFLQDTXHSXHGDQUHVLVWLUWHPSHUDWXUDVGHKDVWDž)
3DUDREWHQHUPHMRUHVUHVXOWDGRV
3RVLFLyQFRUUHFWDGHOHVWDQWH
8WLOLFHVLHPSUHHOHVWDQWHHQVXSRVLFLyQ´EDMDµDOFDOHQWDU(OHVWDQWHHVQHFHVDULRSDUDXQD
EXHQDFLUFXODFLyQGHODLUHHLQFOXVRSDUDFDOHQWDUGHIRUPDSDUHMD
&RQVXOWHODVHFFLyQ&RQVHMRVVREUHLQVWUXPHQWRVGHFRFLQDSDUDREWHQHULQIRUPDFLyQVREUHORV
LQVWUXPHQWRVGHFRFLQDDFRQVHMDGRV
3RVLFLyQLQFRUUHFWDGHOHVWDQWH
3XOVHHOERWyQ:$50&DOHQWDU
*LUHHOGLDOSDUDVHOHFFLRQDUOD
WHPSHUDWXUDGHOKRUQR&RQVXOWHHO
JUiILFR\ORVFRQVHMRVDFRQWLQXDFLyQ
3XOVHHOGLDOSDUDLQWURGXFLUODVHOHFFLyQ
&$/(17$5
%$-2
0(',2
$/72
ƒ)
ƒ)
ƒ)
3XOVHHOGLDORHOERWyQ67$573$86(
,QLFLR3DXVDSDUDFRPHQ]DUDFDOHQWDU
6LVHDEUHODSXHUWDGHOKRUQRGXUDQWHOD
IXQFLyQ´&DOHQWDUµDSDUHFHUiHQSDQWDOOD
3$86(3DXVD&LHUUHODSXHUWD\SXOVH
67$573$86(,QLFLR3DXVD
3DUDKDFHUTXHORVHOHPHQWRVVHFRVHVWpQ
FUXMLHQWHV
„ &RORTXHORVDOLPHQWRVRORVSODWRV
GLUHFWDPHQWHHQHOHVWDQWHHQODSRVLFLyQ
LQIHULRU
„ 8WLOLFHHODMXVWH/2:%$-2
„ 5HYLVHTXpWDQFUXMLHQWHHVWiHODOLPHQWR
WUDVPLQXWRV$xDGDWLHPSRVHJ~QVH
QHFHVLWH
*,5(3$5$6(/(&&,21$538/6(
3$5$,1752'8&,5
7DEODGHVHOHFFLyQGHWHPSHUDWXUD
7LSRGHDOLPHQWR
$MXVWH
+~PHGR&UXMLHQWH
3DQUROOLWRVGXURV
0HGLXP0HGLR
&ULVS&UXMLHQWH
3DQUROOLWRVEODQGRV
0HGLXP0HGLR
0RLVW+~PHGR
*XLVDGRV
0HGLXP0HGLR
0RLVW+~PHGR
+LJK$OWR
&ULVS&UXMLHQWH
&DUQHV\SHVFDGRV
0HGLXP0HGLR
&ULVS&UXMLHQWH
3DQTXHTXHVZDIOHV
+LJK$OWR
&ULVS&UXMLHQWH
3L]]D
+LJK$OWR
&ULVS&UXMLHQWH
+LJK$OWR
&ULVS&UXMLHQWH
3DSDVSXUp
0HGLXP0HGLR
0RLVW+~PHGR
&DUQHGHDYH
+LJK$OWR
0RLVW+~PHGR
7UR]RVGHWRUWLOOD
/RZ%DMR
&ULVS&UXMLHQWH
0HGLXP0HGLR
0RLVW+~PHGR
&RPLGDVIULWDV
3DSDVKRUQHDGDV
9HUGXUDV /D86'$)6,6UHFRPLHQGDXQDWHPSHUDWXUDLQWHUQDGHƒ)FRPRHOQLYHOGHFRFFLyQPtQLPRGH
UHV8WLOLFHXQWHUPyPHWURSRUWiWLOGHFDUQHSDUDUHYLVDUODVWHPSHUDWXUDVLQWHUQDV
7UXFRVSDUDDOLPHQWRVFUXMLHQWHV
7UXFRVSDUDDOLPHQWRVK~PHGRV
„ 1RFXEUDORVDOLPHQWRV
„ &XEUDORVDOLPHQWRVFRQXQDWDSDRFRQ
SDSHOGHDOXPLQLR
„ 1RXWLOLFHFRQWHQHGRUHVQLHQYROWXUDV
GHSOiVWLFR
„ 1RXWLOLFHFRQWHQHGRUHVQLHQYROWXUDV
GHSOiVWLFR
/DVRWUDVIXQFLRQHV
+HOSD\XGD
(OERWyQ+(/3OHPXHVWUDLQIRUPDFLyQGH
FDUDFWHUtVWLFDV\FRQVHMRVSUiFWLFRV3UHVLRQH
+(/3JLUHHOGLDOSDUDVHOHFFLRQDUXQD
IXQFLyQ\SUHVLRQHHOGLDOSDUDVHOHFFLRQDU
6HxDOGHILQDOGHFRFFLyQ
3DUDUHFRUGDUOHTXHWLHQHFRPLGDHQHO
KRUQRDSDUHFHUiHOPHQVDMH<285)22'
,65($'<6XFRPLGDHVWiOLVWD\VRQDUiXQ
5HVXPH&RQWLQXDU
(OSURJUDPDGHFRFFLyQTXHDFDEDGHXWLOL]DU
SHUPDQHFHHQPHPRULDGXUDQWHPLQXWRV
7UDVHVWRHVQHFHVDULRTXHLQLFLHHOSURJUDPD
GHQXHYR3DUDGHVDFWLYDUHVWDIXQFLyQ
FRQVXOWHODVHFFLyQ0HQVDMH´0iVWLHPSRµ
SLWLGRFDGDPLQXWRKDVWDTXHDEUDODSXHUWD
GHOKRUQRRSUHVLRQHHOERWyQ&/($52))
6LQHFHVLWDFRFLQDUORVDOLPHQWRVXQSRFR
PiVSXHGHUHLQLFLDUHOKRUQRSXOVDQGRHO
ERWyQ67$573$86(,QLFLR3DXVDRHO
GLDOVHOHFWRU
5(680(&22.,1*&RQWLQXDUFRFFLyQ
DSDUHFHUiHQSDQWDOOD\HOKRUQRVH
UHLQLFLDUiLQPHGLDWDPHQWHDO
GHOWLHPSRRULJLQDO
5HORM
3UHVLRQHSDUDLQWURGXFLUODKRUDGHOGtDR
SDUDUHYLVDUODKRUDGHGtDPLHQWUDVFRFLQD
3UHVLRQHHOERWyQ&/2&.UHORM
*LUHHOGLDOSDUDFRQILJXUDUODVKRUDV
3UHVLRQHHOGLDOSDUDVHOHFFLRQDU
*LUHHOGLDOSDUDFRQILJXUDUORVPLQXWRV
3UHVLRQHHOGLDOSDUDVHOHFFLRQDU
6WDUW3DXVHLQLFLRSDXVD
START / PAUSE
$GHPiVGHSRQHUHQPDUFKDPXFKDV
IXQFLRQHV67$573$86(OHSHUPLWHSDUDUOD
FRFFLyQVLQWHQHUTXHDEULUODSXHUWDRERUUDU
ORTXHKD\DHQSDQWDOOD
*LUHHOGLDOSDUDVHOHFFLRQDU$0R30
3UHVLRQHHOGLDOSDUDVHOHFFLRQDU
*($SSOLDQFHVFRP
&OHDU2IIERUUDUDSDJDGR
CLEAR / OFF
CLEAR / OFF
3UHVLRQHHOERWyQ&/($52))SDUDSDUDU\
FDQFHODUODFRFFLyQHQFXDOTXLHUPRPHQWR
%ORTXHRGHOFRQWURO
3XHGHEORTXHDUHOSDQHOGHFRQWURO
SDUDHYLWDUTXHHQFLHQGDQHOKRUQR
DFFLGHQWDOPHQWHGXUDQWHODOLPSLH]DR
SDUDTXHQRORXWLOLFHQORVQLxRV
3DUDEORTXHDU\GHVEORTXHDUORVFRQWUROHV
DSULHWH\PDQWHQJDHOERWyQ&/($52))
GXUDQWHXQSHUtRGRGHWUHVVHJXQGRV&RQ
HOSDQHOGHFRQWUROEORTXHDGRDSDUHFHUi
EUHYHPHQWHHOPHQVDMH&21752//2&.('
FDGDYH]TXHVHDSULHWHXQERWyQRHOGLDO
/X]QRFWXUQDDXWRPiWLFD
/DOX]QRFWXUQDDXWRPiWLFDSXHGH
FRQILJXUDUVHSDUDTXHVHHQFLHQGD\VH
DSDJXHDKRUDVGHWHUPLQDGDV
3UHVLRQHHOERWyQ237,216\JLUHHO
GLDOSDUDVHOHFFLRQDU$8721,7(/,*+7
3UHVLRQHHOGLDOSDUDVHOHFFLRQDU
*LUHHOGLDOSDUDVHOHFFLRQDU6(77,0(6
3UHVLRQHHOGLDOSDUDVHOHFFLRQDU
,QWURGX]FDODKRUDGHOGtDSDUDTXHODOX]
VHHQFLHQGDJLUDQGRHOGLDOSDUD
VHOHFFLRQDUODKRUDPLQXWRV\$0R30
3UHVLRQHHOGLDOSDUDVHOHFFLRQDUFDGD
FDPELRTXHTXLHUDUHDOL]DU
,QWURGX]FDODKRUDGHOGtDSDUDTXHODOX]
VHDSDJXHJLUDQGRHOGLDOSDUD
VHOHFFLRQDUODKRUDPLQXWRV\$0R30
3UHVLRQHHOGLDOSDUDVHOHFFLRQDUFDGD
FDPELRTXHTXLHUDUHDOL]DU
127$(OLQGLFDGRU1,7(QRFKHVH
HQFHQGHUiFXDQGRODOX]GHQRFKHVHKD\D
ILMDGRSDUDRSHUDU
3DUDUHYLVDUODFRQILJXUDFLyQGHODOX]
QRFWXUQDJLUHHOGLDOSDUDVHOHFFLRQDU
5(9,(:6(77,1*6GHVSXpVGHVHOHFFLRQDUOD
RSFLyQ$XWR1LWH/LJKW3UHVLRQHHOGLDOSDUD
VHOHFFLRQDU
3DUDERUUDUODFRQILJXUDFLyQGHODOX]
QRFWXUQDJLUHHOGLDOSDUDVHOHFFLRQDU
&/($56(77,1*6GHVSXpVGHVHOHFFLRQDUOD
RSFLyQ$XWR1LWH/LJKW3UHVLRQHHOGLDOSDUD
VHOHFFLRQDU
$MXVWHGHWHPSGHFRFFLyQ
9ROXPHQGHVHxDOGHDYLVR
6HXWLOL]DSDUDKDFHUTXHHOKRUQRDMXVWHODV
WHPSHUDWXUDVHVWDEOHFLGDVDXWRPiWLFDPHQWH
HQRJUDGRV
3UHVLRQHHOERWyQ237,216\JLUHHOGLDO
SDUDVHOHFFLRQDU%$.(7(03$'-867
3XOVHHOGLDOSDUDLQWURGXFLUODVHOHFFLyQ
*LUHHOGLDOSDUDVHOHFFLRQDU12&+$1*(
6LQFDPELRVRJUDGRV\
SXOVHSDUDLQWURGXFLUODVHOHFFLyQ
(OYROXPHQGHODVHxDOGHDYLVRSXHGH
DMXVWDUVH
3UHVLRQHHOERWyQ237,216\JLUHHO
GLDOSDUDVHOHFFLRQDU%((3(592/80(
3UHVLRQHHOGLDOSDUDVHOHFFLRQDU
*LUHHOGLDOSDUDVHOHFFLRQDUGHVGHPXGR
DDOWR3UHVLRQHHOGLDOSDUDVHOHFFLRQDU
127$(OLQGLFDGRU087(VLOHQFLRVRVH
HQFHQGHUiFXDQGRHOYROXPHQVHKD\DILMDGR
HQVLOHQFLRVR
/DVRWUDVIXQFLRQHV
6HOHFFLyQGH&RQYHUVLyQ$XWR5HFLSHŒ
,GLRPDGHSDQWDOOD
&XDQGRHVWDIXQFLyQVHDFWLYDFRQYHUWLUi
(OLGLRPDGHOPHQ~GHSDQWDOODSXHGH
DXWRPiWLFDPHQWHODVWHPSHUDWXUDVGH
FRQILJXUDUVHSDUD,QJOpV\(VSDxRO
KRUQHDGRUHJXODUHVDWHPSHUDWXUDVGH
3UHVLRQHHOERWyQ237,216\JLUHHOGLDO
KRUQHDGRSRUFRQYHFFLyQ&RQVXOWHOD
SDUDVHOHFFLRQDU',63/$</$1*8$*(
VHFFLyQ&RQYHUVLyQ$XWR5HFLSHŒHQ
3UHVLRQHHOGLDOSDUDVHOHFFLRQDU
ODVHFFLRQ´$FHUFDGHODVIXQFWLRQHVGH
+RUQHDGR\$VDGR´
*LUHHOGLDOSDUDVHOHFFLRQDU(1*/,6+
R63$1,6+3UHVLRQHHOGLDOSDUD
3UHVLRQHHOERWyQ237,216\JLUHHOGLDO
SDUDVHOHFFLRQDU2))6(73UHVLRQHHOGLDO
VHOHFFLRQDU
SDUDVHOHFFLRQDU
*LUHHOGLDOSDUDVHOHFFLRQDU&219(&7,21
%$.(7(032))6(7212))
&RPSHQVDFLyQGHWHPSGHKRUQHDGR
SRUFRQYHFFLyQDFWLYDGRGHVDFWLYDGR
3UHVLRQHHOGLDOSDUDVHOHFFLRQDU
3DQWDOOD212))HQFHQGLGD
DSDJDGD
ÒVHORSDUDDSDJDURHQFHQGHUODSDQWDOODGHO
UHORM
3UHVLRQHHOERWyQ237,216\JLUHHO
GLDOSDUDVHOHFFLRQDU',63/$<212))
3UHVLRQHHOGLDOSDUDVHOHFFLRQDU
*LUHHOGLDOSDUDVHOHFFLRQDU21R2))
3UHVLRQHHOGLDOSDUDVHOHFFLRQDU
/DYHORFLGDGGHOPHQ~GHSDQWDOODSXHGH
FDPELDUVH
3UHVLRQHHOERWyQ237,216\JLUHHO
GLDOSDUDVHOHFFLRQDU',63/$<63(('
3UHVLRQHHOGLDOSDUDVHOHFFLRQDU
*LUHHOGLDOSDUDVHOHFFLRQDUGHVGHHOPiV
OHQWRDOPiVUiSLGR3UHVLRQHHOGLDOSDUD
VHOHFFLRQDU
0HGLGDV
0HQVDMH´0iVWLHPSRµ
3XHGHQFRQILJXUDUVHODVPHGLGDVSDUDTXH
DSDUH]FDQGHODIRUPDSRUGHIHFWRLQJOHVDR
PpWULFD
8QDYH]TXHVHFRPSOHWHODFRFFLyQSXHGH
PRVWUDUVHXQPHQVDMHTXHOHRIUH]FDOD
RSFLyQGHFRFLQDUODFRPLGDGXUDQWHPiV
WLHPSRXWLOL]DQGRODPLVPDFRQILJXUDFLyQ
&RQVXOWHODVHFFLyQ&RQWLQXDU
3XOVHHOERWyQ237,2162SFLRQHV\JLUH
HOGLDOSDUDVHOHFFLRQDU0($685(6
0HGLGDV3XOVHHOGLDOSDUDLQWURGXFLUOD
VHOHFFLyQ
*LUHHOGLDOSDUDVHOHFFLRQDU'()$8/7
3UHHVWDEOHFLGRR0(75,&0pWULFR\
SXOVHSDUDLQWURGXFLUODVHOHFFLyQ
9HORFLGDGGHSDQWDOOD
3XOVHHOERWyQ237,2162SFLRQHV\JLUH
HOGLDOSDUDVHOHFFLRQDU025(7,0(
0(66$*(0HQVDMH´0iVWLHPSRµ3XOVH
HOGLDOSDUDLQWURGXFLUODVHOHFFLyQ
*LUHHOGLDOSDUDVHOHFFLRQDU0(66$*(
210HQVDMHDFWLYDGRR0(66$*(2))
0HQVDMHGHVDFWLYDGR\SXOVHSDUD
LQWURGXFLUODVHOHFFLyQ
*($SSOLDQFHVFRP
/X]GHVXSHUILFLH
3UHVLRQH685)$&(/,*+7XQDYH]SDUDXQD
LOXPLQDFLyQIXHUWHGRVYHFHVSDUDODOX]
QRFWXUQDRXQDWHUFHUDYH]SDUDDSDJDUOD
7HPSRUL]DGRU
(O7LPHUWHPSRUL]DGRUIXQFLRQDFRPR
WHPSRUL]DGRUGHPLQXWRV\VHSXHGHXVDUHQ
FXDOTXLHUPRPHQWRLQFOXVRFXDQGRHOKRUQR
HVWiHQPDUFKD
3UHVLRQHHOERWyQ7,0(5
*LUHHOGLDOSDUDFRQILJXUDUORVPLQXWRV
3UHVLRQHHOGLDOSDUDVHOHFFLRQDU
3DUDFDQFHODUSUHVLRQHHOERWyQ7,0(5
&XDQGRVHDFDEHHOWLHPSRHOKRUQR
GDUiXQDVHxDO3DUDDSDJDUODVHxDOGHO
WHPSRUL]DGRUSUHVLRQH7,0(5
127$(OLQGLFDGRUGHOWHPSRUL]DGRUVH
HQFHQGHUiPLHQWUDVHOWHPSRUL]DGRUHVWpHQ
PDUFKD
*LUHHOGLDOSDUDFRQILJXUDUORVVHJXQGRV
3UHVLRQHHOGLDOSDUDVHOHFFLRQDU
3UHVLRQHHOGLDOR7,0(5SDUDHPSH]DU
'LVSRVLWLYRJLUDWRULRDFWLYDGR
GHVDFWLYDGR
3DUDREWHQHUPHMRUHVUHVXOWDGRVGHFRFFLyQ
GHMHHOGLVSRVLWLYRJLUDWRULRDFWLYDGR3XHGH
GHVDFWLYDUVHVLYDDFRFLQDUSODWRVJUDQGHV
(QGHWHUPLQDGDVRFDVLRQHVHOGLVSRVLWLYR
JLUDWRULRSXHGHFDOHQWDUVHGHPDVLDGRFRPR
SDUDWRFDUOR
3XOVHHOERWyQ78517$%/(212))
7HQJDFXLGDGRDOWRFDUORGXUDQWHODFRFFLyQ
RSRVWHULRUPHQWHDHOOD
'LVSRVLWLYRJLUDWRULRDFWLYDGR
GHVDFWLYDGR
*LUHHOGLDOSDUDVHOHFFLRQDU21$FWLYDGR
X2))'HVDFWLYDGR3XOVHHOGLDOSDUD
LQWURGXFLUODVHOHFFLyQ
9HQWLODGRUH[WUDFWRU
([WUDFWRUDXWRPiWLFR
(OH[WUDFWRUDVSLUDHOYDSRUGHDJXD\RWURV
YDSRUHVGHODHQFLPHUDGHODFRFLQD
(OH[WUDFWRUDXWRPiWLFRSURWHJHDOKRUQR
PLFURRQGDVGHOFDORUH[FHVLYRTXHVXUJH
GHODHVWXIDGHEDMRGHpVWH6HHQFLHQGH
GHIRUPDDXWRPiWLFDVLSHUFLEHGHPDVLDGR
FDORU
3XOVH9(17)$19HQWLODGRUH[WUDFWRUXQD
YH]SDUDDOWDYHORFLGDGGHYHQWLODFLyQGRV
YHFHVSDUDYHORFLGDGPHGLDWUHVYHFHV
SDUDYHORFLGDGEDMD\XQDFXDUWDYH]SDUD
GHVDFWLYDUHOYHQWLODGRU
127$(OLQGLFDGRUGHOH[WUDFWRUHVWDUi
SUHQGLGRPLHQWUDVHOH[WUDFWRUHVWpRSHUDQGR
6LKDHQFHQGLGRHOH[WUDFWRUHVSRVLEOHTXH
VLHQWDTXHQRORSXHGHDSDJDU(OH[WUDFWRU
VHDSDJDUiDXWRPiWLFDPHQWHFXDQGRODV
SDUWHVLQWHUQDVVHKD\DQHQIULDGR3XHGH
SHUPDQHFHUHQFHQGLGRKDVWDSRU
PLQXWRVRPiVGHVSXpVGHTXHORVFRQWUROHV
GHODHVWXID\GHOPLFURRQGDVVHKD\DQ
DSDJDGR
&XLGDGR\OLPSLH]DGHOKRUQR
&RQVHMRVSUiFWLFRV
3DUDPDQWHQHUHOLQWHULRUIUHVFRSiVHOHXQSDxRFRQXQDVROXFLyQGHDJXD\ELFDUERQDWR
VyGLFRGHFXDQGRHQFXDQGR
$VHJ~UHVHGHTXHHVWpDSDJDGRHQRIIDQWHVGHOLPSLDUFXDOTXLHUSDUWHGHHVWHKRUQR
&yPROLPSLDUHOLQWHULRU
3DUHGHVVXHORYHQWDQDLQWHULRU\SLH]DVGHSOiVWLFRGHODSXHUWD
$OJXQDVVDOSLFDGXUDVSXHGHQOLPSLDUVHFRQXQSDSHOWRDOODRWUDVSXHGHQQHFHVLWDUXQSDxR
K~PHGR4XLWHODVVDOSLFDGXUDVFRQXQSDxRHQMDERQDGR\DFODUHFRQXQSDxRK~PHGR1R
XVHOLPSLDGRUHVDEUDVLYRVQLXWHQVLOLRVDILODGRVHQODVSDUHGHVGHOKRUQR
1XQFDXVHXQOLPSLDGRUFRPHUFLDOGHKRUQRHQQLQJXQDSDUWHGHOPLFURRQGDV
%DVHJLUDWRULDH[WUDtEOH\VRSRUWHGHEDVHJLUDWRULD
3DUDTXHQRVHURPSDQRSRQJDHOSODWRJLUDWRULRHQDJXDMXVWRGHVSXpVGHFRFLQDU/tPSLHOR
FRQFXLGDGRHQDJXDWLELDFRQMDEyQRHQHOODYDYDMLOODV(OSODWRJLUDWRULR\
HOVRSRUWHSXHGHQURPSHUVHVLVHFDHQ5HFXHUGHQRKDFHUIXQFLRQDUHOKRUQRHQHO
PRGRPLFURRQGDVVLQHOGLVSRVLWLYRJLUDWRULR\HOVRSRUWHFRORFDGRVHQVXOXJDU
(VWDQWHV
/tPSLHORFRQDJXD\MDEyQVXDYHRHQHOODYDYDMLOODV
1RODOLPSLHVLWLHQHXQKRUQRDXWROLPSLDEOH
&yPROLPSLDUHOH[WHULRU
1RUHFRPHQGDPRVHOXVRGHOLPSLDGRUHVFRQDPRQLDFRRDOFRKRO\DTXHSXHGHQGDxDU
HODVSHFWRGHOKRUQRPLFURRQGDV6LRSWDSRUXVDUXQOLPSLDGRUFDVHURSULPHURDSOLTXHHO
OLPSLDGRUGLUHFWDPHQWHHQXQSDxROLPSLROXHJROLPSLHHOiUHDVXFLD
/DFDMD
/LPSLHODSDUWHH[WHUQDGHOKRUQRGHPLFURRQGDVFRQXQSDxRKXPHGHFLGRFRQDJXD
MDERQRVD(QMXiJXHOD\OXHJRVpTXHOD3iVHOHXQSDxRKXPHGHFLGROLPSLRDODYHQWDQDSDUD
OLPSLDUOD
(OSDQHOGHFRQWURO
3iVHOHXQSDxRKXPHGHFLGRSDUDOLPSLDU6HTXHFRPSOHWDPHQWH1RXVHHVSUD\VOLPSLDGRUHV
JUDQGHVFDQWLGDGHVGHGHWHUJHQWH\DJXDDEUDVLYRVXREMHWRVILORVRVVREUHHOSDQHO\DTXHOR
SRGUtDGDxDU$OJXQDVWRDOODVGHSDSHOSRGUtDQWDPELpQGDxDUHOSDQHOGHFRQWURO
3DQHOGHSXHUWD
$QWHVGHOLPSLDUHOSDQHOGHSXHUWDIURQWDODVHJ~UHVHGHTXHVDEHTXpWLSRGHSDQHOWLHQH
&RQVXOWHHORFWDYRGtJLWRGHOQ~PHURGHPRGHOR´6µHVDFHURLQR[LGDEOH´/µHV&OHDQ6WHHO\´%µ
´:µR´&µVRQFRORUHVSOiVWLFRV
$FHURLQR[LGDEOHHQDOJXQRVPRGHORV
(OSDQHOGHDFHURLQR[LGDEOHSXHGHOLPSLDUVHFRQ6WDLQOHVV6WHHO0DJLFRXQSURGXFWRVLPLODU
XWLOL]DQGRXQSDxRVXDYH\OLPSLR$SOLTXHHOOLPSLDGRUGHVXSHUILFLHVGHDFHURLQR[LGDEOH
FXLGDGRVDPHQWHSDUDHYLWDUWRFDUODVSLH]DVGHSOiVWLFRTXHURGHDQDODFHUR1RXWLOLFHFHUD
SXOLPHQWROHMtDQLSURGXFWRVTXHFRQWHQJDQFORULQDHQDFDEDGRVHQ
DFHURLQR[LGDEOH
*($SSOLDQFHVFRP
3DQHOHVSOiVWLFRVGHFRORU
8WLOLFHXQSDxRVXDYHOLPSLR\OLJHUDPHQWHKXPHGHFLGR\DFRQWLQXDFLyQVHTXH
ELHQWRGDOD]RQD
/RVVHOORVGHODSXHUWD
(VLPSRUWDQWHPDQWHQHUHOiUHDGRQGHODSXHUWDVHVHOODFRQHOKRUQRGHPLFURRQGDVOLPSLD
6RODPHQWHXVHGHWHUJHQWHVQRDEUDVLYRVVXDYHVDSOLFDGRVFRQXQDHVSRQMDOLPSLD
RFRQXQSDxRVXDYH(QMXDJXHELHQ
(OIRQGR
/LPSLHODJUDVD\HOLPLQHHOSROYRGHOIRQGRDPHQXGR8VHXQDVROXFLyQGHDJXDFiOLGD
\GHWHUJHQWH
&DPELRGHERPELOODV
4XLWHHOWRUQLOOR
/X]GHHQFLPHUDOX]QRFWXUQD
$VHJ~UHVHTXHODERPELOODHVWiIUtDDQWHV
&iPELHODSRUXQDERPELOODKDOyJHQDGH
YROWLRVZDWWPD[3LGD:%;
GHVXVXPLQLVWUDGRU*(
(QURVTXHODQXHYDERPELOODOXHJR
3DUDFDPELDUODOX]GHHQFLPHUDOX]
QRFWXUQDSULPHURGHVFRQHFWHODFRUULHQWH
GHOIXVLEOHSULQFLSDORGHOSDQHOGH
GLIHUHQFLDORHVWLUHGHOHQFKXIH
GHUHWLUDUOD5RPSDHOVHOORDGKHVLYR
GHVHQURVFDQGRFRQFXLGDGRODERPELOOD
OHYDQWHODFXELHUWD\YXHOYDDSRQHUHO
WRUQLOOR&RQHFWHHOKRUQRDODFRUULHQWH
HOpFWULFD
4XLWHHOWRUQLOORGHOODWHUDOGHODFXELHUWD
GHOFRPSDUWLPLHQWRGHODERPELOOD\EDMH
ODFXELHUWDKDVWD
TXHSDUH
/DIXQFLyQGHH[WUDFWRU
)LOWURGHFDUEyQYHJHWDO
HQDOJXQRVPRGHORV
9HQWLODGRUH[WUDFWRU
(OYHQWLODGRUH[WUDFWRUWLHQHGRVILOWURVGH
PHWDOUHXWLOL]DEOHV
/RVPRGHORVTXHKDFHQUHFLUFXODUHODLUH
GHQXHYRDODKDELWDFLyQXVDQXQILOWURGH
FDUEyQYHJHWDO
)LOWURVGHH[WUDFWRUUHXWLOL]DEOHV
HQWRGRVORVPRGHORV
)LOWURVGHH[WUDFWRUUHXWLOL]DEOHV
/RVILOWURVPHWiOLFRVDWUDSDQODJUDVD
OLEHUDGDSRUODFRPLGDHQODFRFLQDHQFLPHUD
7DPELpQHYLWDQTXHODVOODPDV
GHODFRFLQDHQFLPHUDSXHGDQGDxDUHQ
LQWHULRUGHOKRUQR
3RUHVWDUD]yQORVILOWURVGHEHQHVWDU
VLHPSUHHQVXOXJDUFXDQGRVHHVWpXVDQGR
ODFDPSDQD/RVILOWURVGHOH[WUDFWRUGHEHQ
OLPSLDUVHXQDYH]DOPHVRVHJ~QVHD
QHFHVDULR
&yPRTXLWDU\OLPSLDUORVILOWURV
3DUDTXLWDUORVXVDQGRODVOHQJHWDV
GHVOtFHORVKDFLDDWUiV(VWLUHKDFLDDEDMR\
DIXHUD
3DUDOLPSLDUORVILOWURVGHOH[WUDFWRU
HPSiSHORV\SiVHORVGHXQODGRDRWURHQ
DJXDFRQGHWHUJHQWH1RXVHDPRQLDFR
QLSURGXFWRVTXHORFRQWHQJDQ\DTXH
RVFXUHFHUtDQHOPHWDO6HSXHGHQFHSLOODU
OLJHUDPHQWHSDUDTXLWDUVXFLHGDGSHJDGD
$FOiUHORVVDF~GDORV\GpMHORVVHFDUDQWHVGH
YROYHUORVDSRQHU
3DUDYROYHUDFRORFDUORVGHVOLFHORVILOWURV
HQORVPDUFRVSRUODSDUWHWUDVHUDGHFDGD
DSHUWXUD3UHVLRQHKDFLDDUULED\KDFLDOD
SDUWHIURQWDOSDUDDMXVWDUORVHQVXOXJDU
*($SSOLDQFHVFRP
)LOWURVGHFDUEyQYHJHWDO
(OILOWURGHFDUEyQYHJHWDOQRSXHGH
OLPSLDUVH'HEHFDPELDUVHSRURWUR
3LGDHOUHFDPELR1R:%;GHVX
VXPLQLVWUDGRU*(
6LHOPRGHORQRUHDOL]DODH[WUDFFLyQDO
H[WHULRUHODLUHUHFLUFXODUiDWUDYpVGHXQILOWUR
GHFDUEyQYHJHWDOQRUHXWLOL]DEOHTXHD\XGDD
TXLWDURORUHV\KXPRV
(OILOWURGHFDUEyQYHJHWDOGHEHUtDFDPELDUVH
FXDQGRHVWiYLVLEOHPHQWHVXFLR
RGHVFRORULGRQRUPDOPHQWHWUiVR
PHVHVVHJ~QHOXVR&RQVXOWH´.LWV
RSFLRQDOHVµHQODSiJLQDSDUDREWHQHUPiV
LQIRUPDFLyQ
&yPRTXLWDUHOILOWURGHFDUEyQYHJHWDO
3DUDTXLWDUHOILOWURGHFDUEyQYHJHWDO
SULPHURGHVFRQHFWHODFRUULHQWHGHOIXVLEOH
SULQFLSDORGHOSDQHOGHGLIHUHQFLDORHVWLUHGHO
HQFKXIH5HWLUHODSDUULOODVXSHULRUTXLWDQGR
ORVGRVWRUQLOORVTXHORVXMHWDQ
5HWLUHODSDUULOODVXSHULRUTXLWDQGR
ORVGRVWRUQLOORVTXHORVXMHWDQ
/HYDQWHHOILOWURGHODSDUWHLQIHULRUKDVWD
TXHVHOLEHUHGHODVSHVWDxDV'HVOLFHHOILOWUR
KDFLDDEDMR\KDFLDIXHUD
3XHGHVHUTXHQHFHVLWHDEULUODVSXHUWDVGHO
DUPDULRSDUDTXLWDUORVWRUQLOORV
&yPRLQVWDODUHOILOWURGHFDUEyQYHJHWDO
3DUDLQVWDODUXQQXHYRILOWURGHFDUEyQ
YHJHWDOUHWLUHHOSOiVWLFR\FXDOTXLHURWUR
HQYROWRULRGHOQXHYRILOWUR
,QWURGX]FDODSDUWHVXSHULRUGHOILOWURKDFLD
DUULED\GHQWURGHORVKXHFRVHQODSDUWH
LQWHULRUGHODDSHUWXUDVXSHULRU$SULHWHOD
SDUWHLQIHULRUGHOILOWURKDFLDGHQWURKDVWDTXH
VHFRORTXHWUDVODVSHVWDxDV
$QWHVGHOODPDUDOVHUYLFLRGHUHSDUDFLRQHV«
5HVROXFLyQGH3UREOHPDV
£$KRUUHWLHPSR\GLQHUR5HYLVHODVWDEODVHQODVSiJLQDV
VLJXLHQWHV\WDOYH]QRQHFHVLWHOODPDUDOVHUYLFLRGHUHSDUDFLyQ
3UREOHPD
3RVLEOHVFDXVDV
4XpKDFHU
(OKRUQRQRVHSRQHHQ
PDUFKD
3XHGHTXHVHKD\DIXQGLGR
XQIXVLEOHGHVXFDVDRTXHKD\D
VDOWDGRHOGLIHUHQFLDO
‡ &DPELHHOIXVLEOHRUHFRQHFWHHOGLIHUHQFLDO
$SDJyQGHFRUULHQWH
‡ 'HVHQFKXIHHOKRUQRPLFURRQGDVGHODFRUULHQWH\
YXpOYDORDHQFKXIDU
(OHQFKXIHQRHVWiFRPSOHWDPHQWH‡ $VHJ~UHVHGHTXHHOHQFKXIHGHFODYLMDVGHOKRUQRHVWp
LQVHUWDGRHQODWRPDGHFRUULHQWH FRPSOHWDPHQWHLQVHUWDGRHQODWRPDGHFRUULHQWHGHOD
GHODSDUHG
SDUHG
/DSXHUWDQRHVWiFHUUDGDGHOWRGR‡ $EUDODSXHUWD\FLpUUHODSRUFRPSOHWR
(OSDQHOGHFRQWUROHVWi
HQFHQGLGRSHURHOKRUQR
QRVHSRQHHQPDUFKD
/DSXHUWDQRHVWiFHUUDGDGHOWRGR‡ $EUDODSXHUWD\FLpUUHODSRUFRPSOHWR
<DVHKDUHDOL]DGRRWUDVHOHFFLyQ ‡ 3UHVLRQH&/($52))
HQHOKRUQR\QRVHSUHVLRQy
&/($52))SDUDFDQFHODUOD
1RVHLQWURGXMRXQWLHPSR
‡ $VHJ~UHVHGHLQWURGXFLUXQWLHPSRGHFRFFLyQWUDV
GHFRFFLyQWUDVDSUHWDU7,0(&22. SUHVLRQDU7,0(&22.
6HSUHVLRQy&/($52))VLQTXHUHU‡ 9XHOYDDSURJUDPDUODFRFFLyQ\SUHVLRQH67$573$86(
1RVHLQWURGXMRHOSHVRWUDV
VHOHFFLRQDU$872'()5267
R)$67'()5267
1RVHLQWURGXMRHOWLSRGH
‡ $VHJ~UHVHGHHQWUDUXQWLSRGHFRPLGD
FRPLGDWUDVDSUHWDU$872&22.
&21752/%/248($'2
SDUD
&21752//2&.('
DSDUHFHHQODSDQWDOOD
(OFRQWUROKDVLGREORTXHDGR
‡3UHVLRQH\PDQWHQJD&/($52))GXUDQWHVHJXQGRV
GHVEORTXHDUHOFRQWURO
1RVHSUHVLRQyHOERWyQ
67$573$86(WUDVVHOHFFLRQDU
HOPRGRGHFRFFLyQ
‡ 3UHVLRQH67$573$86(
‡ $VHJ~UHVHGHLQWURGXFLUHOSHVRGHODFRPLGDWUDV
VHOHFFLRQDU$872'()5267R)$67'()5267
$SDUHFHHQSDQWDOOD29(1 6HSXOVyXQRGHORVERWRQHV
722+27)256(1625
GHFRFFLyQSRUVHQVRUFXDQGR
&22.,1*²86,1*
ODWHPSHUDWXUDLQWHULRUGHOKRUQR
HUDVXSHULRUDORVž)
$/7(51$7(0(7+2'
+RUQRGHPDVLDGRFDOLHQWH
SDUDFRFLQDUSRUVHQVRU
6HHVWiXWLOL]DQGRRWUR
PpWRGR
‡(VWDVIXQFLRQHVQRSRGUiQHMHFXWDUVHFXDQGRHOKRUQR
(OKRUQRFDPELDUiDXWRPiWLFDPHQWHDFRFLQDUSRU
WLHPSRVLJDODVLQGLFDFLRQHVGHODSDQWDOODRXQDYH]
TXHHOKRUQRHVWpORVXILFLHQWHPHQWHIUtRODVIXQFLRQHV
GHOVHQVRUVHHMHFXWDUiQQRUPDOPHQWH
(OVXHORGHOKRUQRHVWi
WHPSODGRLQFOXVRFXDQGR
HOKRUQRQRVHKDXVDGR
‡(VWRHVQRUPDO
/DOX]GHODHQFLPHUDHVWi
VLWXDGDEDMRHOVXHORGHOKRUQR
&XDQGRODOX]HVWiSXHVWD
HOFDORUTXHSURGXFHSXHGH
FDOHQWDUHOVXHORGHOKRUQR
6HHVFXFKDXQSLWLGR
+DLQWHQWDGRFDPELDUHOQLYHO
FRQXQWRQRLQXVXDOPHQWH QLYHOGHSRWHQFLDFXDQGRQR
EDMR
HVWDEDSHUPLWLGR
‡0XFKDVGHODVIXQFLRQHVGHOKRUQRHVWiQ
SUHVHOHFFLRQDGDV\QRSXHGHQFDPELDUVH
3UREOHPD
*($SSOLDQFHVFRP
3RVLEOHVFDXVDV
4XpKDFHU
(OKRUQRGHVSUHQGHXQRORU6HHVWiQTXHPDQGRDFHLWHV
‡(VWRHVQRUPDO
DKXPR\VDOHKXPRJULV HQODFDYLGDGGHDFHURLQR[LGDEOH
GHVSXpVGHXVDUODIXQFLyQGHVSXpVGHXVDUODIXQFLyQGH
GHKRUQHDGR
+RUQHDGRODVSULPHUDVYHFHV
/DFRPLGDVHGRUDPXFKR /DSDUULOODVHILMyHQODSRVLFLyQ
PiVUiSLGRHQODSDUWHGH DOWD
DUULEDTXHHQODSDUWHGH
DEDMR
‡6LHPSUHXVHODSDUULOODHQODSRVLFLyQEDMD
/DWHPSHUDWXUDGHOKRUQR
IOXFW~DGXUDQWHODFRFFLyQ
‡ (VWRHVQRUPDO
(OHOHPHQWRGHFRFLQDSDVDGH
HQFHQGLGRDDSDJDGRSDUD
PDQWHQHUODWHPSHUDWXUDGHO
KRUQRHQORVQLYHOHVGHVHDGRV
(OH[WUDFWRUGHOKRUQRVH (OH[WUDFWRUVHHQFLHQGH
‡(VWRHVQRUPDO
HQFLHQGHDXWRPiWLFDPHQWHDXWRPiWLFDPHQWHSDUDSURWHJHU
HOPLFURRQGDVVLSHUFLEHTXHKD\
GHPDVLDGRFDORUHQODHVWXIDGHEDMR
GHpVWH
'XUDQWHORVQLYHOHVGH%DNH
‡(VWRHVQRUPDO
KRUQHDGRR)DVW%DNH
KRUQHDGRUiSLGRGHVSXpV
GHSUHFDOHQWDGRHOH[WUDFWRU
GHOKRUQRVHHQFHQGHUiSDUD
HQIULDUORVFRPSRQHQWHVGHOKRUQR
$SDUHFHHQODSDQWDOOD
6(1625(5525
(UURUGHVHQVRU
6HDEULyODSXHUWDPLHQWUDVVH
‡1RDEUDODSXHUWDKDVWDTXHVHSHUFLEDHOYDSRU\
XWLOL]DEDODIXQFLyQGHVHQVRUDQWHV DSDUH]FDHQSDQWDOODODFXHQWDGHWLHPSRUHJUHVLYD
DQWHVGHTXHSXGLHUDGHWHFWDUVH
HOYDSRU
(OYDSRUQRVHGHWHFWyHQOD
FDQWLGDGGHWLHPSRPi[LPD
‡8WLOLFH7LPH&RRN7LHPSRGHFRFFLyQSDUDFDOHQWDU
GXUDQWHPiVWLHPSR
$QWHVGHOODPDUDOVHUYLFLRGHUHSDUDFLRQHV«
&RVDVQRUPDOHVGHVXKRUQRPLFURRQGDV
„+XPHGDGHQODSXHUWD\SDUHGHVGHOKRUQR „$OXVDUKRUQHDGRSRUFRQYHFFLyQDVDGR
DOFRFLQDU)URWHODKXPHGDGFRQXQD
SRUFRQYHFFLyQXKRUQHDGRUiSLGR
WRDOOLWDGHSDSHORXQSDxRVXDYH
FRPELQDGRFRQXQSUHFDOHQWDPLHQWR
ODSXHUWDGHOKRUQRGHEHVHUDELHUWD\HO
„+XPHGDGHQWUHORVSDQHOHVGHODVSXHUWDV
WLHPSRGHFRFFLyQHVWDEOHFLGRGHVSXpV
GHOKRUQRDOFRFLQDUGHWHUPLQDGRV
GHOSUHFDOHQWDGRRHOKRUQRDSDJDUiHO
DOLPHQWRV/DKXPHGDGVHGLVLSDUiSRFR
HOHPHQWRGHFRFFLyQGHVSXpVGHKRUD
GHVSXpVGHWHUPLQDUGHFRFLQDU
„6HSXHGHQRWDUXQDLQWHUIHUHQFLDGH
„(OYDSRUVHHVFDSDSRUODSXHUWD
WHOHYLVLyQ\UDGLRPLHQWUDVVHXVDHOKRUQR
GHPLFURRQGDV6LPLODUDODLQWHUIHUHQFLD
„8QDOX]GHUHIOH[LyQDOUHGHGRUGHODSXHUWD
FDVDGDSRURWURVHOHFWURGRPpVWLFRVOR
RHQODSHULIHULDGHODFDMDGHOKRUQR
FXDOQRLQGLFDXQSUREOHPD&RQHFWHHO
„/DOX]GHOKRUQRVHGHELOLWD\HOVRQLGRGHO
KRUQRGHPLFURRQGDVHQXQWRPDFRUULHQWH
VRSODGRUFDPELDFXDQGRVHXVDQQLYHOHV
GHXQFLUFXLWRGLIHUHQWHPXHYDOD
GHSRWHQFLDGLIHUHQWHVDODOWR
WHOHYLVLyQRHOUDGLRWDQOHMRVGHOKRUQR
GHPLFURRQGDVFRPRVHDSRVLEOHR
„8QVRQLGRVRUGRGHJROSHFXDQGRHOKRUQR
LQVSHFFLRQHODSRVLFLyQGHODDQWHQDGHOD
GHPLFURRQGDVHVWiHQRSHUDFLyQ
WHOHYLVLyQRHOUDGLR
„(OYHQWLODGRURSHUDPLHQWUDVHOKRUQRGH
PLFURRQGDVHVWiRSHUDQGR(OYHQWLODGRU
QRVHDSDJDUiQLVHSXHGHDSDJDUKDVWD
TXHHOKRUQRGHPLFURRQGDVVHDSDJXH
„&DOHQWDUKRUQHDGRSRUFRQYHFFLyQ
DVDGRSRUFRQYHFFLyQ\KRUQHDGR
UiSLGRFRPELQDGRWLHQHQXQWLHPSR
GHFRFFLyQPi[LPRGHPLQXWRV
KRUDV\PLQXWRV&XDQGRHOWLHPSR
GHFRFFLyQPi[LPRVHDOFDQ]DHOKRUQR
DXWRPiWLFDPHQWHLQGLFDUiTXHODFRFFLyQ
ILQDOL]y\DSDJDUiHOHOHPHQWRGHFRFFLyQ
1RWDV
*($SSOLDQFHVFRP
1RWDV
*DUDQWtDGH+RUQR0LFURRQGDV*(
7RGRVORVVHUYLFLRVGHJDUDQWtDORVSURSRUFLRQDQQXHVWURV&HQWURV
GH5HSDUDFLyQGH)iEULFDRQXHVWURVWpFQLFRV&XVWRPHU&DUH Š
DXWRUL]DGRV3DUHFRQFHUWDUXQDFLWDGHUHSDUDFLyQHQOtQHD
KRUDVDOGtDYLVLWH*($SSOLDQFHVFRPROODPHDO*(&$5(6
&XDQGROODPHSDUDVROLFLWDUVHUYLFLRSRUIDYRU
WHQJDDPDQRHOQ~PHURGHVHULH\HOQ~PHURGHPRGHOR
'XUDQWHHOSHUtRGRGH
*UDSHDTXtVXUHFLER6H
UHTXLHUHIDFLOLWDUSUXHEDGHOD
IHFKDGHFRPSUDRULJLQDOSDUD
REWHQHUXQVHUYLFLREDMROD
JDUDQWtD
*(UHHPSOD]DUi
8QDxR
'HVGHODIHFKDGHOD
FRPSUDRULJLQDO
&XDOTXLHUUHFDPELRGHOKRUQRPLFURRQGDVTXHIDOOHGHELGRDXQGHIHFWRHQVXVPDWHULDOHVRHQ
VXIDEULFDFLyQ'XUDQWHHVWDJDUDQWtDOLPLWDGDGHXQDxR*(SURSRUFLRQDUiVLQFRVWRDGLFLRQDO
PDQRGHREUD\VHUYLFLRUHODFLRQDGRSDUDUHHPSOD]DUODVSDUWHVGHIHFWXRVDV
&LQFRDxRV
'HVGHODIHFKDGHOD
FRPSUDRULJLQDO
(OPDJQHWUyQHOWXERPDJQHWUyQIDOODVHGHELGRDXQGHIHFWRHQVXVPDWHULDOHVRHQVX
IDEULFDFLyQ'XUDQWHHVWRVFLQFRDxRVDGLFLRQDOHVGHJDUDQWtDOLPLWDGDXVWHGVHUiUHVSRQVDEOH
GHFXDOTXLHUFRVWRGHPDQRGHREUDRVHUYLFLRDGRPLFLOLR
/RTXH*(QRFXEULUi
„9LDMHVGHUHSDUDFLyQDVXKRJDUSDUDHQVHxDUOHFyPR
XVDUHOSURGXFWR
„5HHPSOD]RGHIXVLEOHVGHVXKRJDURUHDMXVWHGHORV
GLIHUHQFLDOHV
„,QVWDODFLyQRHQWUHJDLQDSURSLDGDRPDQWHQLPLHQWR
LPSURSLR
„'DxRDOSURGXFWRFDXVDGRSRUDFFLGHQWHIXHJR
LQXQGDFLRQHVRDFWRVGH'LRV
„3URGXFWRQRDFFHVLEOHSDUDIDFLOLWDUHOVHUYLFLRUHTXHULGR
„'DxRLQFLGHQWDORFRQVHFXHQFLDODVXSURSLHGDGFDXVDGR
SRUSRVLEOHVGHIHFWRVFRQHODSDUDWR
„)DOORVGHOSURGXFWRVLKD\DEXVRPDOXVRSRUHMHPSOR
FKLVSDVGHQWURGHKRUQRPLFURRQGDVGHOHVWDQWH
PHWiOLFRSDSHOGHDOXPLQLRRXVRSDUDRWURVSURSyVLWRV
TXHORVSURSXHVWRVRVLVHXVDFRQILQHVFRPHUFLDOHV
„&DXVDUGDxRVGHVSXpVGHODHQWUHJD
„5HHPSOD]RGHERPELOODVGHODOX]GHODHVWXID
(;&/86,Ï1'(*$5$17Ë$6,03/Ë&,7$6³6X~QLFR\H[FOXVLYRGHUHFKRHVODUHSDUDFLyQGHOSURGXFWR
WDO\FRPRVHLQGLFDHQHVWD*DUDQWtDOLPLWDGD&XDOTXLHUJDUDQWtDLPSOtFLWDLQFOX\HQGRODVJDUDQWtDV
LPSOtFLWDVGHFRPHUFLDELOLGDGRDGHFXDFLyQSDUDXQILQGHWHUPLQDGRHVWiQOLPLWDGDVDXQDxRRHO
SHUtRGRGHWLHPSRPiVEUHYHSHUPLWLGRSRUODOH\
(VWDJDUDQWtDVHH[WLHQGHDOFRPSUDGRURULJLQDO\FXDOTXLHUFRPSUDGRUSRVWHULRUGHSURGXFWRVFRPSUDGRVSDUD
XVRUHVLGHQFLDOGHQWURGH(VWDGRV8QLGRV6LHOSURGXFWRHVWiVLWXDGRHQXQiUHDTXHQRGLVSRQHGHVHUYLFLR
SRUSDUWHGHXQSURYHHGRUGHVHUYLFLRDXWRUL]DGRGH*(SRGUtDWHQHUTXHKDFHUVHFDUJRGHORVFRVWHVGHHQYtR
RELHQSRGUtDVROLFLWiUVHOHTXHOOHYHHOSURGXFWRDXQDFHQWURGHVHUYLFLRGH*(DXWRUL]DGRSDUDUHDOL]DUOD
UHSDUDFLyQ(Q$ODVNDODJDUDQWtDH[FOX\HHOFRVWRGHHQYtRRODVYLVLWDVGHVHUYLFLRDVXFDVD
$OJXQRVHVWDGRVQRSHUPLWHQODH[FOXVLyQROLPLWDFLyQGHGDxRVLQFLGHQWDOHVRFRQVHFXHQFLDOHV(VWDJDUDQWtD
OHSURSRUFLRQDGHUHFKRVOHJDOHVHVSHFtILFRV\SXHGHWHQHURWURVGHUHFKRVTXHSXHGHQYDULDUGHXQHVWDGRD
RWUR3DUDFRQRFHUORVGHUHFKRVOHJDOHVGHVXHVWDGRFRQVXOWHFRQVXRILFLQDORFDOGHDVXQWRVGHOFRQVXPLGRUR
DOSURFXUDGRUJHQHUDOGHVXHVWDGR
*DUDQWL]DGRU*HQHUDO(OHFWULF&RPSDQ\/RXLVYLOOH.<
$\XGDDOFOLHQWH
3iJLQD:HEGH*($SSOLDQFHV
*($SSOLDQFHVFRP
¢7LHQHDOJXQDSUHJXQWDVREUHVXHOHFWURGRPpVWLFR"£3UXHEHODSiJLQD:HEGH*($SSOLDQFHVKRUDVDOGtD
FXDOTXLHUGtDGHODxR3DUDPD\RUFRQYHQLHQFLD\VHUYLFLRPiVUiSLGR\DSXHGHGHVFDUJDUORV0DQXDOHVGHORV
3URSLHWDULRVSHGLUSLH]DVRLQFOXVRKDFHUXQDFLWDHQOtQHDSDUDTXHYHQJDQDUHDOL]DUXQDUHSDUDFLyQ7DPELpQ
SXHGH´$VN2XU7HDPRI([SHUWVŒµ3UHJXQWDUDQXHVWURHTXLSRGHH[SHUWRV
VREUHFXDOTXLHUFXHVWLyQ\PXFKRPiV«
6ROLFLWHXQDUHSDUDFLyQ
*($SSOLDQFHVFRP
(OVHUYLFLRGHH[SHUWRV*(HVWiDWDQVyORXQSDVRGHVXSXHUWD£(QWUHHQOtQHD\VROLFLWHVXUHSDUDFLyQFXDQGR
OHYHQJDELHQKRUDVDOGtDFXDOTXLHUGtDGHODxR2OODPHDO*(&$5(6GXUDQWHKRUDV
QRUPDOHVGHRILFLQD
5HDO/LIH'HVLJQ6WXGLR
(VWXGLRGHGLVHxRSDUDODYLGDUHDO
*($SSOLDQFHVFRP
*(DSR\DHOFRQFHSWRGH'LVHxR8QLYHUVDO³SURGXFWRVVHUYLFLRV\DPELHQWHVTXHSXHGHQXVDUJHQWHGHWRGDV
ODVHGDGHVWDPDxRV\FDSDFLGDGHV5HFRQRFHPRVODQHFHVLGDGGHGLVHxDUSDUDXQDJUDQJDPDGHKDELOLGDGHV
\GLILFXOWDGHVItVLFDV\PHQWDOHV3DUDPiVGHWDOOHVFREUHODVDSOLFDFLRQHVGH*('LVHxR8QLYHUVDOLQFOX\HQGR
LGHDVGHGLVHxRSDUDODFRFLQDSDUDSHUVRQDVFRQGLVFDSDFLGDGHVPLUHQXHVWUDSiJLQD:HEKR\PLVPR3DUD
SHUVRQDVFRQGLILFXOWDGHVDXGLWLYDVIDYRUGHOODPDUDO7''*($&
*DUDQWtDVDPSOLDGDV
*($SSOLDQFHVFRP
&RPSUHXQDJDUDQWtDDPSOLDGD\REWHQJDGHWDOOHVVREUHGHVFXHQWRVHVSHFLDOHVGLVSRQLEOHVPLHQWUDVVXJDUDQWtD
HVWiD~QDFWLYD3XHGHFRPSUDUODHQOtQHDHQFXDOTXLHUPRPHQWRROODPDUDOGXUDQWHKRUDV
QRUPDOHVGHRILFLQD*(&RQVXPHU+RPH6HUYLFHVHVWDUiD~QDKtFXDQGRVXJDUDQWtDWHUPLQH
3LH]DV\DFFHVRULRV
*($SSOLDQFHVFRP
$TXHOORVLQGLYLGXRVFRQODFDOLILFDFLyQQHFHVDULDSDUDUHSDUDUVXVSURSLRVHOHFWURGRPpVWLFRVSXHGHQ
SHGLUTXHVHOHVPDQGHQODVSLH]DVRDFFHVRULRVGLUHFWDPHQWHDVXVKRJDUHVDFHSWDPRVODVWDUMHWDV
9,6$0DVWHU&DUG\'LVFRYHU+DJDVXSHGLGRHQOtQHDKR\KRUDVFDGDGtDROODPDUSRUWHOpIRQR
DOGXUDQWHKRUDVQRUPDOHVGHRILFLQD
/DVLQVWUXFFLRQHVGHVFULWDVHQHVWHPDQXDOFXEUHQORVSURFHGLPLHQWRVDVHJXLUSRUFXDOTXLHUXVXDULR&XDOTXLHU
RWUDUHSDUDFLyQGHEHUtDSRUUHJODJHQHUDOUHIHULUVHDSHUVRQDOFDOLILFDGRDXWRUL]DGR'HEHHMHUFHUVHSUHFDXFLyQ
\DTXHODVUHSDUDFLRQHVLQFRUUHFWDVSXHGHQFDXVDUFRQGLFLRQHVGHIXQFLRQDPLHQWRLQVHJXUDV
3yQJDVHHQFRQWDFWRFRQQRVRWURV
*($SSOLDQFHVFRP
6LQRHVWiVDWLVIHFKRFRQHOVHUYLFLRTXHUHFLEHGH*(SyQJDVHHQFRQWDFWRFRQQRVRWURVHQQXHVWUDSiJLQD
:HELQGLFDQGRWRGRVORVGHWDOOHVDVtFRPRVXQ~PHURGHWHOpIRQRRHVFUtEDQRVD
*HQHUDO0DQDJHU&XVWRPHU5HODWLRQV
*($SSOLDQFHV$SSOLDQFH3DUN
/RXLVYLOOH.<
5HJLVWUHVXHOHFWURGRPpVWLFR
*($SSOLDQFHVFRP
£5HJLVWUHVXQXHYRHOHFWURGRPpVWLFRHQOtQHD³FXDQGRXVWHGSUHILHUD(OUHJLVWUDUVXSURGXFWRDWLHPSROH
SURSRUFLRQDUiVLVXUJLHUDODQHFHVLGDGXQDPHMRUFRPXQLFDFLyQ\XQVHUYLFLRPiVUiSLGREDMRORVWpUPLQRVGH
VXJDUDQWtD7DPELpQSXHGHHQYLDUVXWDUMHWDGHUHJLVWURSUHLPSUHVDTXHVHLQFOX\HHQHOPDWHULDOGHHPEDODMH
RUHFRUWH\XVHHOIRUPXODULRGHHVWH0DQXDOGHO3URSLHWDULR
,PSUHVRHQ&RUHD
CR424BL
3.0" x 24.0" x 20.5" (H x W x D)
24" wide 4-burner electric cooktop in smooth black
ceramic glass finish
Highlights:
24" width is ideally sized for many hard-to-fill cutouts
Smooth black finish in Schott Ceran glass offers easy cleanup
Four 1200W burners made by E.G.O. in Germany
304 grade stainless steel trim adds durable support with
professional style
24" width
Designed to fit 22.13" W x 18.63" D cutouts
E.G.O. burners
Considered by many to be the industry's best cooking technology, this unit features four 1200W 6 1/2" burners
made in Germany by E.G.O.
Schott Ceran
surface
Smooth ceramic glass cooking surface in a sleek black finish
Push-to-turn
knobs
Controls require a gentle push to help prevent cooking accidents
Stainless steel
trim
Stainless steel border adds an extra touch of style
Indicator lights
Each burner includes an indicator light to show when the unit is on
Specifications:
Cutout Width
22.13"
Cutout Height
2.5"
Cutout Depth
18.63"
Height
3.0"
Width
24.0"
Depth
20.5"
Countertop Cutout Width
22.13"
Countertop Cutout Depth
18.63"
US Electrical Safety
UL
Amps
21.0
Voltage/Frequency
220 V AC/60 Hz
Canadian Electrical Safety
ULC
Burner Type
Glasstop
Number of Burners
4
Heating Type
Radiant
Burner Temperature Control
Dial
Surface Type
Glass
Parts/Labor Warranty
1 Year
INSTRUCTION MANUAL
for 4-Burner Electric Cooktop
Model CR424
Felix Storch, Inc.
Summit Appliance Division
770 Garrison Avenue
Bronx, NY 10474
www.summitappliance .com
Page 1
Please read these instructions in their entirety before installation and use of your
cooktop. SAVE THIS MANUAL FOR FUTURE REFERENCE.
Table of Contents
Technical Information ........................................................................................ 1
Safety Instructions.........................................................................................2 - 3
Installation Instructions ................................................................................4 - 9
Unpacking the Cooktop ............................................................................. 4
Checking the Electrical Supply Requirements ........................................... 4
Preparing the Countertop .....................................................................5 - 6
Installing the Cooktop ................................................................................ 7
Electrical Connection and Wiring Diagram ................................................ 8
Final Preparations Prior to Use ................................................................. 9
Operation......................................................................................................9 - 10
Cookware ................................................................................................... 9
Heating Elements................................................................................9 - 10
Controls & Indicators................................................................................ 10
Cleaning ................................................................................................... 10
Warranty ............................................................................................................ 11
Technical Information
Model Number
Description
Electrical Requirements
Power Rating of Burners
Diameters of Burners
Overall Dimensions
Cutout Dimensions
CR424
4-burner ceramic glass electric cooktop
230V AC, 21A, 60Hz
4 @ 1200W: Total of 4800W
4 burners @ 6.5"
24"W x 20½"D x 3¾"H (not including knobs)
22⅛" x 18⅝" with ¼" radius
For future reference, please record the Serial Number
of your cooktop here:
________________________________________
Page 2
SAFETY INSTRUCTIONS
Read this section BEFORE operating the cooktop.
This cooktop, like all appliances, has the potential to create safety
problems through careless and improper use. Please observe all of
the following safety precautions.

Proper Installation
Be sure your appliance is properly installed and grounded by a qualified
technician.

Never use your appliance for warming or heating the room.

Do not leave children alone.
Children should never be left alone or unattended in the area where the
appliance is in use. They should never be allowed to sit or stand on any part
of the appliance.

CAUTION: Do not store items of interest to a child in cabinets above
cooktop.
Children climbing on the cooktop to reach such items could be seriously
injured.

Wear proper clothing/apparel.
Loose-fitting or hanging garments should never be worn while using the
appliance.

User Servicing
Do not repair or replace any part of the appliance. If service ever becomes
necessary, this appliance should be serviced by AUTHORIZED
PERSONNEL ONLY or call SUMMIT Customer Service at 1-800-932-4267.

Keep flammable materials away from the cooktop.

Do not store plastic material (such as plastic utensils) in storage areas
beneath cooktop.
Plastic items with low melting temperatures should not be stored under, over
or near the cooktop.

Do not soak removable heating elements.
Heating elements should never be immersed in water.

Do not use water on grease fires.
Smother fire or flame or use dry chemical or foam-type extinguisher.

Use only dry potholders.
Damp potholders on hot surfaces may result in burns from steam. Do not let
Page 3
potholder touch the heating elements on the appliance. Do not use a towel
or other bulky cloth in place of a potholder.

Do not cook on a broken cooktop.
If your cooktop should break, cleaning solutions and spillovers may penetrate
the broken cooktop and create a risk of electric shock. Immediately contact
an authorized service center or call the SUMMIT Customer Service at 1-800932-4267.

Clean cooktop with caution.
If a wet sponge or cloth is used to wipe spills on a hot cooking surface, be
careful to avoid steam burns. Some cleaners produce noxious fumes if
applied to a hot surface. Read the cleaner label for details prior to use.

DO NOT TOUCH HEATING ELEMENTS.
The heating elements on the cooktop may be hot even if they are dark in
color. These areas may be hot enough to cause burns. Never touch heating
elements until they have had sufficient time to cool. Likewise, never allow
clothing or flammable materials to come in contact with heating elements or
the cooktop surface until they have had sufficient time to cool. Other
surfaces of the appliance may become hot enough to cause burns.

Use proper pan size.
This appliance is equipped with four surface units, each with a diameter of
6.5". Select utensils having flat bottoms large enough to cover the surface
unit heating element. The use of undersized utensils will expose a portion of
the heating element to direct contact and may result in ignition of clothing.
Proper relationship of utensil to burner will also improve efficiency.

Never leave surface units unattended at high heat settings.
Boil-over causes smoking and greasy spillovers that may ignite.

Utensil handles should be turned inward and not extend over adjacent
surface units.
To reduce the risk of burns, ignition of flammable materials, and spillage due
to unintentional contact with the utensil, the handle of a utensil should be
positioned so that it is turned inward, and does not extend over adjacent
surface units.

Glazed cooking utensils
Only certain types of glass, glass/ceramic, ceramic, earthenware, or other
glazed utensils are suitable for range-top service without breaking due to
sudden changes in temperature.
- SAVE THESE INSTRUCTIONS -
Page 4
Installation Instructions
IMPORTANT!
!
Save this manual for review by local inspector.
This appliance must be properly installed and
grounded by a qualified technician.
1. Unpacking the Cooktop
Carefully unpack the cooktop from its shipping container. If possible, keep the
original shipping carton and protective packaging in the event the unit has to be
returned for service.
Verify the package contents. If the ceramic glass cooktop appears to be
damaged or parts are missing, call SUMMIT immediately.
Important! Do not remove the clear plastic covering
film on the ceramic glass until the cooktop is ready
to be installed.
!
2. Checking the Electrical Supply Requirements
This product must be installed in accordance with national, state and local
electric codes. Here are the electrical requirements:
Model Number
Maximum Connected Load
Required Power Supply Input
CR424
4800 watts
230V AC / 21A / 60Hz
The supply must be from an individual grounded circuit that is protected by a
circuit breaker and rated per the specifications as shown above.
!
Warning: If the electric power supply does not meet
the product specifications, consult with a licensed
electrician before proceeding with installation.
Page 5
3. Preparing the countertop
Please read this section prior to making a cutout in your counter for the
cooktop.
It is important to plan ahead for installation of the cooktop, keeping the following
dimensions in mind. (Please refer to Fig. A.)
A. Maximum depth of overhead
cabinets should be 13 inches.
B. Minimum height of the countertop
above the floor should be 36
inches.
C. Minimum flat countertop surface
that the cooktop will rest upon must
be equal to or greater than the
overall cooktop dimensions. (Refer
to page 1 for these dimensions.)
D. Minimum clearance between the
top of the cooking surface and the
bottom of an unprotected wood or
metal cabinet should be 30 inches.
When the bottom of a wood or
metal cabinet is protected by not
less than ¼ inch thick flameretardant millboard covered with
not less than No. 28 MSG sheet
steel, 0.015-inch-thick stainless
steel, 0.024-inch-thick aluminum or
0.020-inch-thick copper, the minimum clearance should be 24 inches.
E. The distance from the backsplash of the countertop to the edge of the
ceramic glass of the cooktop should be a minimum of 2 inches. The distance
from a side wall to the edge of the ceramic glass of the cooktop should be a
minimum of 1 inch. (Refer to page 1 for overall cooktop dimensions).
Do not install the cooktop closer than 1 inch (25 mm) from any adjacent
surface.
!
Warning: To eliminate the risk of burns when
reaching over heated surface units, avoid having
cabinet storage space located above surface units.
If cabinet storage is to be provided, the risk can be
reduced by installing a range hood that projects
horizontally a minimum of 5" beyond the bottom of
the cabinets.
Page 6
Before making the countertop cutout, check for clearance. See if the cooktop will
clear the front and side walls of the base cabinet. It is also important to provide
enough ventilation.
Adequate ventilation of the space below the countertop must be provided to
ensure proper operation of the cooktop. Heat transferred from the cooktop
bottom pan during operation will overheat an improperly ventilated area.
Allow a 2" (51mm) minimum clearance between the bottom of the metal pan of
the cooktop and any combustible surface located below, e.g., the upper edge of
a drawer installed below the cooktop. Failure to provide proper clearances and
ventilation may result in a fire hazard.
Countertop cutout dimensions are shown in the figure below.
Note: When making the countertop, put a radius at the corners of the cutout (a
radius of ¼" is typical). This will keep the countertop from cracking.
Follow the countertop manufacturer's instructions regarding the minimum
corner radius and reinforcement of corners.
Page 7
4. Installing the Cooktop
The cooktop should be bedded to the countertop using a soft bedding compound
that will prevent damage if later removal for service is necessary. A very small
bead of silicone sealant should be laid around the edges of the cutout.
Installation of the
cooktop into the
countertop
Place the cooktop in the cutout opening and press firmly on all sides to seal the
frame into the bedding compound. The sealant will hold the cooktop firmly in
place on the countertop.
Page 8
5. Electrical Connection
Before proceeding further, verify that the power supply is disconnected. Verify
that the appropriate electrical supply requirements have been met. Please refer
to the table on page 4 for appropriate electrical requirements. The cooktop is
supplied with a 48-inch long conduit for a connection to an accessible junction
box. The conduit consists of three insulated wires. There are two hot lead
conductors (black and red insulated-tinned copper) and one insulated ground
conductor (green insulated-tinned copper). (See Wiring Diagram for model
CR424 below and on bottom of cooktop.)
(4) @ 1200W = 4800W
Wiring Diagram
Attach conductor wires to residence wiring in accordance with national, state and
local electric codes.
!
Warning – Grounding
The entire appliance must be grounded at all times
when the electrical power supply is on. Do not
ground the appliance with the neutral house supply
wire (white). A separate ground must be used.
Page 9
6. Final Preparations Prior to Use
Remove the plastic film from the cooktop. Clean the cooktop before you use it
for the first time. A thorough cleaning with a recommended cooktop cleaner will
provide a clean, shiny coating on the cooktop surface.
The next sections of the manual cover cooktop use, maintenance and service
information.
Please keep these instructions with your cooktop for future reference.
Operation
READ SAFETY INSTRUCTIONS BEFORE OPERATING YOUR APPLIANCE.
The cooking surface areas of your glass ceramic cooktop are identified by
permanent patterns in the cooktop. The appliance is easy to maintain and easy
to clean. Keeping the cooktop at its top performance levels can be achieved by
following the simple guidelines for use and cleaning below:
Cookware
Chances are that your existing cookware will work just fine with your glass
ceramic cooktop. Cooking on a glass ceramic cooktop does not require special
pots or pans. Since cookware plays an important role in cooking efficiency and
convenience, keep in mind the following information when selecting your
cookware.
The cookware should have a flat bottom. Although glass and other types of
cookware can be used, metal cookware with thick, smooth, flat bottoms will
generally conduct the heat well. Aluminum and stainless steel cookware usually
work best. Avoid cookware with shaped and rounded bottoms as well as utensils
that warp when heated.
Use cookware of the correct diameter only. The base of the pot or pan should be
about as wide as the cooking zone on which it is used – not much wider or much
narrower. By using utensils with the correct diameter, you should achieve
maximum heating efficiency in the shortest possible time.
Be certain that both the cooktop surface and the bottom of your pots and pans
are clean and dry before use. By doing so, you will help prevent scratches and
stains.
Heating Elements
This cooktop contains radiant heating elements. The radiant elements will “light
up” about 4-5 seconds after being turned on. The special design of these
elements directs the heat up through the ceramic glass, providing efficient
cooking. Temperature limiters are included in each element to ensure that the
safe operating temperature of the ceramic glass top is not exceeded. The
Page 10
temperature limiter will cycle the radiant element on and off to prevent exceeding
the maximum safe surface temperature.
Controls & Indicators
Each of the cooking area controls has an infinite selection of heat settings. The
control settings begin at low and increase heat output by cycling the heating
elements between OFF and full power as you turn the knob clockwise. The
heating elements will stay at full power for longer periods and at zero power for
shorter periods as you turn the knob clockwise, thus increasing the heat output.
There is a light associated with each of the control knobs that provides an
indication of burner operation and a hot surface. When a control is in the ON
position, the red light is lit indicating which burner is on and is therefore too warm
to touch. Do not place articles other than cookware on the cooking surface while
this light is glowing.
Cleaning
To help ensure that your cooktop stays clean, follow these easy-care tips:
 Clean the cooktop before you use it for the first time. A thorough cleaning with
a recommended cooktop cleaner will provide a coating on the cooktop prior to
its first use.
 Always remove food spills, grease spatters and metal rub-off from cookware.
A razor blade scraper or the equivalent works well to remove spillovers.
 Clean the cooktop with a paper towel or a clean, soft cloth and a
recommended cleaner. After cleaning, always wipe the cooktop with a clean,
damp cloth to avoid cooked-on cleaner residue. Wipe the cooktop dry.
 Do not use a dish towel or sponge to wipe off the cooktop. A film may be left
by the detergent and may cause discoloration of the cooktop surface.
 Avoid abrasive scouring cleaners of any kind. Also avoid using plastic, nylon
or metal cleaning pads. They may scratch or melt onto the cooktop.
 Avoid chemical cleaners such as chlorine bleach, ammonia, hydrofluoric acid
or chemical oven cleaners. They can etch or discolor the surface.
 Do not let anything that melts – plastic, aluminum foil, sugar, etc. – come into
contact with the cooktop surface when it is hot. Should something melt onto
the surface, immediately move it to a cool area of the cooktop with a razor
blade scraper and then remove it from the cooktop as soon as possible.
Page 11
ONE-YEAR LIMITED WARRANTY
Within the 48 contiguous United States, for one year from the date of purchase, when this
appliance is operated and maintained according to instructions attached to or furnished with the
product, warrantor will pay for factory-specified parts and repair labor to correct defects in materials
or workmanship. Service must be provided by a designated service company. Outside the 48
states, all parts are warranted for one year from manufacturing defects. Plastic parts, shelves and
cabinets are warranted to be manufactured to commercially acceptable standards, and are not
covered from damage during handling or breakage.
ITEMS WARRANTOR WILL NOT PAY FOR:
 Service calls to correct the installation of your appliance, to instruct you how to use your
appliance, to replace or repair fuses or to correct wiring or plumbing.
 Service calls to repair or replace appliance light bulbs or broken glass shelves. Consumable
parts (such as filters) are excluded from warranty coverage.
 Damage resulting from accident, alteration, misuse, abuse, fire, flood, acts of God, improper
installation, installation not in accordance with electrical or plumbing codes, or use of products
not approved by warrantor.
 Replacement parts or repair labor costs for units operated outside the United States.
 Repairs to parts or systems resulting from unauthorized modifications made to the appliance.
 Expenses for travel and transportation for product service in remote locations.
 The removal and reinstallation of your appliance if it is installed in an inaccessible location or is
not installed in accordance with published installation instructions.
DISCLAIMER OF IMPLIED WARRANTIES; LIMITATION OF REMEDIES
CUSTOMER’S SOLE AND EXCLUSIVE REMEDY UNDER THIS LIMITED WARRANTY SHALL
BE PRODUCT REPAIR AS PROVIDED HEREIN. IMPLIED WARRANTIES, INCLUDING
WARRANTIES OF MERCHANTABILITY OR FITNESS FOR A PARTICULAR PURPOSE, ARE
LIMITED TO ONE YEAR. WARRANTOR SHALL NOT BE LIABLE FOR INCIDENTAL OR
CONSEQUENTIAL DAMAGES. SOME STATES DO NOT ALLOW THE EXCLUSION OR
LIMITATION OF INCIDENTAL OR CONSEQUENTIAL DAMAGES, OR LIMITATIONS ON THE
DURATION OF IMPLIED WARRANTIES OF MERCHANTABILITY OR FITNESS, SO THESE
EXCLUSIONS OR LIMITATIONS MAY NOT APPLY TO YOU. THIS WARRANTY GIVES YOU
SPECIFIC LEGAL RIGHTS AND YOU MAY ALSO HAVE OTHER RIGHTS, WHICH VARY FROM
STATE TO STATE.
Call customer service toll free in the U.S.A. @ 1-800-932-4267, Monday to Friday 9:00 am. - 5:00 p.m. (ET).
Order parts online at www.summitappliance.com/support
Felix Storch, Inc.
770 Garrison Avenue
Bronx, NY 10474
Phone: (718) 893-3900
Fax: (718) 842-3093
Web Site:
www.summitappliance.com
www.summitappliance.com How To Clean Your Glass Cooktop
To maximize the lifespan and maintain the great look of your smoothtop electric
cooktop or range, follow these quick and simple steps to keep the cooktop
surface clean:

Make sure the cooktop surface has completely cooled down before cleaning

Wipe the cooktop surface using a paper towel and a glass cooktop cleaning solution,
such as Weiman® Glass Cook Top Daily Cleaner

For tougher spills and stains, apply a stronger solution (such as Weiman® Glass Cook
Top Heavy Duty Cleaner & Polish) to the soiled area, rubbing it into the residue until the
stain is completely removed from the surface

After cleaning, always buff the surface with a paper towel or soft cloth to give your
cooktop an attractive shine.
Helpful Tips

Clean the cooktop surface frequently to ensure a protective coating is applied. This helps
prevent scratches and abrasions on your glass cooktop.

When cooking items with high sugar content, be sure to clean up any spills immediately
to avoid permanently damaging the surface.
Don’t Forget!

Always clean up spills and food residue as soon as the cooking surface has cooled down.
Allowing spills (especially those containing sugar or acid) to dry will make it much more
difficult to clean the cooktop

Your cooktop is not a countertop! Placing foreign items on the cooktop for storage could
damage or scratch the surface, especially if this habit is repeated over time.

Use pots and pans with a smooth, flat bottom and avoid sliding cookware across the
cooktop’s surface

Keep the surface clean of gritty particles (such as crumbs or dirt) and make sure such
material does not get between the cooktop and cookware.
Follow these tips and you can enjoy the appearance and
convenience of your smooth glass cooktop for years of easy
cooking!
12/1/13
SANYO :: LCD Televisions :: 42" Diagonal LCD FULL HDTV 1080p
SANYO Manufacturing C orporation
42" Diagonal LCD FULL HDTV 1080p
DP42840
Overview
Features
Downloads
SANYO 42" Diagonal Full HD 1080p LCD Model DP42840 with integrated ATSC Digital and NTSC Analog
Tuner is the latest technology for the digital age.The digital tuner is Digital Clear QAM capable of
receiving unscrambled digital cable. In a high gloss black finish it blends into the background when the
lights are dimmed for your movies, sports and favorite programs in your den or living room. Having a
full array of HDMI, Component Audio/Video, Composite Audio/Video and RF inputs, you have plenty of
options for DVD, VCR, Cable, Satellite and external antenna hookups. A coaxial digital audio output
allows hookup to a home entertainment receiver amplifier system for theater like sound. The PC (VGA)
input permits alternative use as a PC monitor while the new USB input and Photo Viewer feature
allows display of your digital camera photos for all to easily see. With a thin space saving design and
small footprint, it can be positioned anywhere. The detachable pedestal base stand allows it to be wall
mounted with an optional wall mount kit (not included).
42" Diagonal Full HD 1080p LCD
Wide screen 16:9 Aspect Ratio
us.sanyo.com/LCD-Televisions/42-Diagonal-LCD-FULL-HDTV-1080p
1/3
12/1/13
SANYO :: LCD Televisions :: 42" Diagonal LCD FULL HDTV 1080p
Native Panel Resolution: 1920 x 1080 pixels
Wide Viewing Angles:178 H x 178 V Degrees
Integrated Digital Clear QAM ATSC + Analog NTSC Tuner
191 Total channels
Receives ATSC signal formats (including 480i/p, 720p and 1080i/p) converted to 1080p
display
3D Y/C Digital Comb Filter
MTS/SAP Stereo & Digital Audio
Two 6 x 12 cm speakers
Picture Shapes: 1-7 (w/remote control PIX Shape Key)
Picture Menu: 3 Preset (Vivid, Mild, Standard)and Manual(Detailed Settings)
Sound Menu: Auto, Dynamic, Mild, Standard and Manual (Detailed Settings)
XDS-Extended Data Service capability
V-Guide Parental Control
Trilingual Menus: English, Spanish, French
Closed Caption Compliant: NTSC-608, ATSC-708CC
Sleep Timer: 1/2 - 3 hours
Auto Channel Search
3 HDMI (High Definition Multimedia Interface) input
2 Component (Y-Pb-Pr with R/L audio) inputs
1 Composite Input (V,L/R)
PC/Mac capable (VGA D-Sub 15 pin) with mini Audio input
1 USB input
1 Coaxial Digital Audio Output
1 Fixed Analog Audio Out (R/L)
1 RF Input ( Analog/Digital Antenna In)
Detachable Stand / Vesa 400 x 400 Wall Mountable (with optional kit not supplied)
Dimensions w/stand: 39.8"W x 27.7"H x 12.1"D, 39.5 lbs.
Energy Star Qualified: On Mode Watts 114
us.sanyo.com/LCD-Televisions/42-Diagonal-LCD-FULL-HDTV-1080p
2/3
12/1/13
SANYO :: LCD Televisions :: 42" Diagonal LCD FULL HDTV 1080p
HDMI, the HDMI logo and High-Definition Multimedia Interface are trademarks or registered trademarks
of HDMI Licensing LLC in the United States and other countries.
Design and specifications subject to change without notice, errors, and omissions.
C opyright © 2013 Sanyo North Am e rica C orporation, All rights re se rve d.
us.sanyo.com/LCD-Televisions/42-Diagonal-LCD-FULL-HDTV-1080p
3/3
12/1/13
SANYO :: LCD Televisions :: 42" Diagonal LCD FULL HDTV 1080p
SANYO Manufacturing C orporation
42" Diagonal LCD FULL HDTV 1080p
DP42840
Overview
Features
Downloads
Native Panel Resolution: 1920 x 1080p pixels(WXGA)
Picture Brightness: 500 cd/m2
Contrast Ratio: 4000:1
Response Time: 6.5 ms
Viewing Angle: H:178 x V:178
Digital Scanning Display: Receives ATSC signal formats (including 480i/p, 720p and
1080i/p) converted to 1080p display
Television Systems: NTSC, ATSC and Clear QAM
191 Total Channels
Aspect ratio (Pix Shape): 7 (Pix 1-7)
us.sanyo.com/LCD-Televisions/42-Diagonal-LCD-FULL-HDTV-1080p
1/3
12/1/13
SANYO :: LCD Televisions :: 42" Diagonal LCD FULL HDTV 1080p
7-Picture Menu:(5 Preset, Manual, Advanced Manual)
Comb Filter: 3D Y/C
Digital Noise Reduction
Signal Balancer
Dynamic Contrast (adjustment in Menu)
Expanded DNR
V Sharpness
Edge Enhancer
White Balance
3:2 Pull down
XDS Extended Data Service
Clock On Timer
On Screen Help Menu
RF Antenna Input: Analog/Digital-75 ohm
Speakers: Two (front) 6 x 12 cm
Sound Amplifier: Built in 10 W/ch
MTS/SAP Stereo Sound
Digital Audio Service (other languages if available)
4-Sound Menu: (Auto Preset, Standard Preset, Manual, Advanced Manual)
Bass/Treble Control
4-Band Equalizer
Closed Caption Compliant: NTSC-608, ATSC-708CC
1 PC-VGA D-Sub 15 pin with Mini Audio input
3 HDMI (High Definition Multimedia Interface) input
2 HD Component (Y-Pb-Pr with R/L audio) inputs
1 Composite Input (V,L/R)
1 USB (with Photo Viewer)
us.sanyo.com/LCD-Televisions/42-Diagonal-LCD-FULL-HDTV-1080p
2/3
12/1/13
SANYO :: LCD Televisions :: 42" Diagonal LCD FULL HDTV 1080p
1 Coaxial Digital Audio Output
1 Fixed Analog Audio Out (R/L)
Detachable Stand / Vesa 400 x 400 Wall Mountable (with optional kit not supplied)
Power: 120v AC, 60hz
Power Rating: 178 Watts UL Rated
Dimensions w/stand: 39.8"W x 27.7"H x 12.1"D, 39.0 lbs.
Dimensions w/o stand: 39.8"W x 25.7"H x 4.7"D, 37.0 lbs.
Energy Star Qualified: On Mode Watts 114
*Design features and specifications subject to change without notice, errors and ommissions.
C opyright © 2013 Sanyo North Am e rica C orporation, All rights re se rve d.
us.sanyo.com/LCD-Televisions/42-Diagonal-LCD-FULL-HDTV-1080p
3/3
CAUTION
THIS SYMBOL INDICATES THAT DANGEROUS VOLTAGE CONSTITUTING A
RISK OF ELECTRIC SHOCK IS PRESENT WITHIN THIS UNIT.
RISK OF ELECTRIC SHOCK DO NOT OPEN!
CAUTION: TO REDUCE THE RISK OF ELECTRIC SHOCK, DO NOT REMOVE COVER (OR
BACK). NO USER-SERVICEABLE PARTS INSIDE. REFER SERVICING TO QUALIFIED SERVICE PERSONNEL.
THIS SYMBOL INDICATES THAT THERE ARE IMPORTANT OPERATING AND
MAINTENANCE INSTRUCTIONS IN THE LITERATURE ACCOMPANYING THIS
UNIT.
WARNING: TO REDUCE THE RISK OF FIRE OR ELECTRIC SHOCK, DO NOT EXPOSE THIS APPLIANCE TO
RAIN OR MOISTURE.
IMPORTANT SAFETY INSTRUCTIONS
1.
2.
3.
4.
5.
6.
7.
8.
9.
10.
11.
12.
13.
14.
2
Read these instructions.
Keep these instructions.
Heed all warnings.
Follow all instructions.
Do not use this apparatus near water.
Clean only with dry cloth.
Do not block any ventilation openings. Install in
accordance with the manufacturer’s instructions.
Do not install near any heat sources such as radiators,
heat registers, stoves, or other apparatus (including
amplifiers) that produce heat.
Do not defeat the safety purpose of the polarized or
grounding-type plug. A polarized plug has two blades with
one wider than the other. A grounding-type plug has two
blades and a third grounding prong. The wide blade or the
third prong are provided for your safety. If the provided
plug does not fit fully into your outlet, consult an electrician for replacement of the obsolete outlet.
Protect the power cord from being walked on or
pinched particularly at plugs, convenience receptacles,
and the point where they exit from the apparatus.
Only use attachments/accessories specified by the
manufacturer.
Use only with the cart, stand, tripod,
bracket, or table specified by the manufacturer, or sold with the apparatus.
When a cart is used, use caution when
moving the cart/apparatus combination
to avoid injury from tip-over.
Unplug this apparatus during lightning storms or when
unused for long periods of time.
Refer all servicing to qualified service personnel.
Servicing is required when the apparatus has been
damaged in any way, such as power-supply cord or
plug is damaged, liquid has been spilled or objects have
fallen into the apparatus, the apparatus has been
exposed to rain or moisture, does not operate normally,
or has been dropped.
Need help?
www.sanyoctv.com
15. If an outside antenna is connected to the television
equipment, be sure the antenna system is grounded so
as to provide some protection against voltage surges
and built up static charges. In the U.S. Selection 810-21
of the National Electrical Code provides information with
respect to proper grounding of the mast and supporting
structure, grounding of the lead-in wire to an antenna
discharge unit, size of grounding conductors, location of
antenna discharge unit, connection to grounding electrodes, and requirements for the grounding electrodes.
16. An outside antenna system should not be located in the
vicinity of overhead power lines or other electrical light
or power circuits, or where it can fall into such power
lines or circuits. When installing an outside antenna
system, extreme care should be taken to keep from
touching such power lines or circuits as contact with
them might be fatal.
EXAMPLE OF ANTENNA GROUNDING ACCORDING
TO NATIONAL ELECTRICAL CODE, ANSI/NFPA 70
“Note to CATV system installer:
This reminder is provided to call the CATV system installer’s
attention to Article 820-40 of the NEC that provides guidelines for
proper grounding and, in particular, specifies that the cable
ground shall be connected to the grounding system of the building, as close to the point of cable entry as practical.”
17. Wall or Ceiling Mounting—The product should be
mounted to a wall or ceiling only as recommended by
the manufacturer.
18. Apparatus shall not be exposed to dripping or splashing
and no objects filled with liquids, such as vases, shall be
placed on the apparatus.
19. When the MAINS plug is used as the disconnect device,
the disconnect device shall remain readily operable.
1-800-877-5032
FCC INFORMATION
This equipment has been tested and found to comply with the limits for a Class B digital device, pursuant to Part 15
of the FCC Rules. These limits are designed to provide reasonable protection against harmful interference in a
residential installation. This equipment generates, uses and can radiate radio frequency energy and, if not installed
and used in accordance with the instructions, may cause harmful interference to radio communications. However,
there is no guarantee that interference will not occur in a particular installation. If this equipment does cause
harmful interference to radio or television reception, which can be determined by turning the equipment off and on,
the user is encouraged to try to correct the interference by one or more of the following measures:
– Reorient or relocate the receiving antenna.
– Increase the separation between the equipment and receiver.
– Connect the equipment into an outlet on a circuit different from that to which the receiver is connected.
– Consult the dealer or an experienced radio/TV technician for help.
CAUTION: FCC Regulations state that improper modifications or unauthorized changes to this unit may void
the user’s authority to operate the unit.
PC RESOLUTION CHART
TRADEMARKS
Manufactured under license from Dolby Laboratories.
“Dolby” is a trademark of Dolby Laboratories.
HDMI, the HDMI Logo and HighDefinition Multimedia Interface are
trademarks or registered trademarks
of HDMI Licensing LLC in the United
States and other countries.
As an Energy Star ® Partner, Sanyo
Manufacturing Corporation has determined that this product meets the Energy
Star® guidelines for energy efficiency.
This symbol on the nameplate means
the product is Listed by Underwriter’s
Laboratories Inc. It is designed and manufactured to meet rigid U.L. safety standards against risk of fire, casualty and
electrical hazards.
This Class B digital apparatus complies with Canadian
ICES-003.
Manufactured under license from
Audyssey Laboratories. U.S. and
foreign patents pending. Audyssey
Dynamic VolumeTM is a trademark of
Audyssey Laboratories.
Need help?
www.sanyoctv.com
1-800-877-5032
3
CONTENTS
SPECIFICATIONS
IMPORTANT SAFETY INSTRUCTIONS . . . . . . . . . . . . . . . 2
FCC INFORMATION . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .3
TRADEMARKS . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .3
PC RESOLUTIONS . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .3
CONTENTS . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .4
SPECIFICATIONS . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .4
PROTECTING THE LCD SCREEN . . . . . . . . . . . . . . . . . . . . .4
HANDLING PRECAUTIONS . . . . . . . . . . . . . . . . . . . . . . . . .4
POSITIONING THE LCD HDTV . . . . . . . . . . . . . . . . . . . . . . .5
STAND REMOVAL / WALL MOUNTING . . . . . . . . . . . . . . .5
GETTING STARTED—
Remote Control Battery Installation . . . . . . . . . . . . . . . .5
Antenna Connections for off-air or cable . . . . . . . . . . .5
BACK PANEL JACKS . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .6
A/V CONNECTIONS . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .7
POWER CONNECTION / INITIAL CHANNEL SEARCH . . .8
REMOTE CONTROL OPERATION . . . . . . . . . . . . . . . . . . . . .9
ON-SCREEN MENU OPERATION—
Channel Setting . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .10
Channel Search . . . . . . . . . . . . . . . . . . . . . . . . . . . . .10
Channel Scan Memory . . . . . . . . . . . . . . . . . . . . . . .10
Input Setting . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .10
Video2 Setting . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .11
Setup . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .11
Menu Language . . . . . . . . . . . . . . . . . . . . . . . . . . . . .11
Digital Caption . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .11
Energy Saver . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .11
Clock Timer . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .12
Light Sensor . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .12
HDMI Linking . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .12
V-Chip . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .13
Picture . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .14
Manual Picture Settings . . . . . . . . . . . . . . . . . . . . . .14
Sound . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .15
aaManual Sound Settings . . . . . . . . . . . . . . . . . . . . . . .15
PC CONNECTIONS . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .16
PC MENU OPERATION . . . . . . . . . . . . . . . . . . . . . . . . . . . .16
PHOTO VIEWER . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .17
WARRANTY . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .18
Power Requirement: Source: AC 120V, 60Hz
AC Power Consumption:
DP42840 178 watts
DP46840 213 watts
Dimensions:
MODEL
WIDTH
DP42840
w/o stand
www.sanyoctv.com
39.8
27.7
25.7
12.0
4.7
43.7
30.7
28.1
12.7
4.7
Please read before
operating your HDTV!
PROTECTING THE LCD SCREEN
CAUTION: The screen can be damaged if it is not
maintained properly.
•
Do not use hard objects such as hard cloth or
paper to clean the screen.
•
Do not use excessive pressure when cleaning the
screen;
excessive
pressure
can
cause
permanent discoloration or dark spots.
•
NEVER spray liquids on the screen.
HANDLING PRECAUTIONS
•
•
•
•
Handle by the cabinet only.
Handling by two or more people is recommended.
Never touch the screen when handling.
Handling damage is not covered under warranty.
CONTAINS MERCURY LAMPS,
DISPOSE OF PROPERLY
Need help?
DEPTH
NOTE: Dimensions are in inches
“The Amercian Academy of Pediatrics discourages
television viewing for children younger than two
years of age”
4
HEIGHT
w/o stand
DP46840
Weight:
39.5 lbs.
44.1 lbs.
1-800-877-5032
POSITIONING THE LCD
HDTV
GETTING STARTED
BATTERY INSTALLATION
• Always
use a firm and flat surface when
positioning your HDTV.
• Do not position the unit in a confined area.
• Allow adequate space for proper ventilation.
• Do not position the HDTV where it is easily
reachable by small children and may present
risk of injury.
STAND REMOVAL AND WALL
MOUNTING (OPTIONAL)
Tools Needed: Phillips screwdriver
IMPORTANT NOTE: Place HDTV face down
on a padded or cushioned flat surface to
protect the screen and finish.
Wall mounting of the HDTV must be performed
by a skilled person.
Install two (2) “AAA” batteries in the remote
control. (Not included)
To ensure safe operation, please observe the
following precautions:
• Replace both batteries at the same time. Do not use a
new battery with a used battery.
• There’s a risk of explosion if a battery is replaced by
an incorrect type.
• Do not expose the Remote Control unit to moisture
or heat.
• Be sure to match the “+” and “–” signs on the
batteries with marks inside the remote control.
ANTENNA CONNECTION FOR
OFF-AIR SIGNALS OR CABLE
Hook up your antenna or your cable service to
the HDTV’s ANT terminal with the use of a 75
OHM coaxial cable.
NOTE: Keep your indoor antenna at least 3 ft. away
from the television set and any other electronic
equipment.
ANTENNA
1
Remove the four (4) screws securing the foot
stand. CAUTION: Hold the stand firmly as you
remove the last screw.
2
Use the screws you removed when detaching
the stand to secure the HDTV to a wall
mounting kit (not included.)
ANALOG / DIGITAL
ANTENNA IN
CABLE
VESA standard interface: 400 x 400
The tuner in this HDTV can receive:
Mounting screws measurements:
M6 (6mm) Diameter, Length—12mm (maximum)
• Digital and Analog off air signals from an antenna
• Analog or ClearQAM cable channels from a direct
Cable TV connection.
Need help?
www.sanyoctv.com
1-800-877-5032
5
GETTING STARTED
HDTV INPUT/OUTPUT REFERENCE
5
1
1 Digital Audio Output (Coaxial)
2 Component AV Input (VIDEO2 or VIDEO3)
Green (Y), blue (Pb), and red (Pr) Video inputs plus the
white and red Audio inputs.
NOTE: A composite connection is possible via VIDEO
INPUT2 using the Y (VIDEO) jack and the L/R audio
jacks. (See Video2 Setting on page 11.)
6
2
7
3 PC Input and Stereo Audio (Mini)
• MONITOR RGB (D-SUB)
• AUDIO R/L (Stereo Mini Jack)
3
4 Analog / Digital Antenna Input
5 S-Video Input (VIDEO1)
NOTE: An S-Video connection will replace and override a
connection to the Video1 (yellow) input jack.
6 Composite AV Input (VIDEO1)
8
4
Yellow (Video), plus white and red (Audio) input jacks.
7 Stereo Audio Out (L/R) Jacks
8 USB Input
9
View pictures stored in a USB flash drive.
9 HDMI (INPUT1, INPUT2, & INPUT3)
An all digital AV interface that can accept
uncompressed video signals up to 1080p for the
very best picture possible.
HDTV BACK PANEL
NOTE: A DVI conection is possible via the HDMI (DVI)
INPUT1 using an appropriate adapter and connecting
the audio to the VIDEO3 Audio jacks.
Standard Definition
High Definition
Optimum
High Definition
Component
(or DVI to HDMI
cable/adapter)
Composite
HDMI
S-Video
NOTE: Composite, S-Video, Component, and DVI video connections need their appropriate white and
red audio connections. High Definition image available from HD signals and HD equipment.
6
Need help?
www.sanyoctv.com
1-800-877-5032
GETTING STARTED
AUDIO / VIDEO CONNECTIONS
Digital Audio Output is used to hookup a
multichannel receiver with the use of a phonotype digital audio cable.
COMPOSITE connections are used to hookup
your analog equipment such as a VCR or an
older DVD player.
COMPONENT connections will accept SDTV,
EDTV and HDTV video signals. Use them for
great image quality from digital devices such
as a DVD player or Video Game system.
NOTE: Always match the color of your device’s output
jack, the connector and the HDTV’s input jack.
S-Video connection can replace the yellow
Video connection for enhanced video.
MULTICHANNEL
RECEIVER
VCR
(or analog device)
DVD PLAYER
(or similar device)
STEREO
AMPLIFIER
DVI
Audio Output L/R are used to hookup an
external stereo Amplifier. (Do not connect
external speakers directly to the HDTV)
PC INPUT is used to hook up your PC or
Laptop and use your HDTV as a computer
monitor. See page 16 for details.
USB FLASH
DRIVE
SATELLITE RECEIVER
(or similar device)
USB input jack is used to
connect a USB mass storage
device to watch digital
images (JPEG only.)
HDMI (DVI) INPUT1 can be used to
hookup a DVI device with the use of
an appropriate DVI to HDMI cable or
adapter. (VIDEO3 Audio In L/R jacks
need to be hooked up to the DVI
device as well.)
Use HDMI INPUT1, 2 & 3 to hookup
HD digital devices such as a Blu-ray
player, HD Cable Box, HD Satellite
Receiver or Video-game System.
NOTE: Audio/Video cables are not supplied
Need help?
www.sanyoctv.com
1-800-877-5032
7
GETTING STARTED
INITIAL CHANNEL SEARCH
Before proceeding, please make sure to hook up
your antenna or cable connection and all AV
equipment correctly to your HDTV.
PLUG IN AC POWER CORD
120V AC, 60Hz
TURN ON TV (PRESS POWER BUTTON)
Wait for on-screen instructions to set an
Initial Energy Saving Mode, and perform an
Initial Channel/Signal Search.
INITIAL ENERGY SAVING
MODE SCREEN
TV SET LOCATION SELECTION:
Select “Home Mode” by pressing the CH key to set
the HDTV’s backlight to an Energy Star qualified level,
or select “Store Mode” by pressing CH to set the
backlight to a retail display level.
CHANNEL AND AV SIGNAL SEARCH:
Press the CH key to perform a channel
search from an Antenna or a direct Cable
connection, and a signal search from devices
hooked up to the HDTV’s AV input jacks.
INITIAL CHANNEL/SIGNAL SEARCH
SETUP SCREEN
ON SCREEN HELP (OPTIONAL)
Press the CH key if you wish to access an
on screen trouble shooting guide.
NOTE: On screen help is also accesible via the
main menu.
CHANNEL AND SIGNAL SETUP SCREEN
The final setup screen displays analog and digital
channels found as well as AV inputs detected. Pressing
the CH key finalizes the setup process.
CHANNEL SEARCH PROGRESS SCREEN
NOTE: To repeat the initial setup process press VOL
AV INPUT SELECTION
Press the INPUT key to select the correct AV
input for the video source you wish to watch.
CHANNEL/SIGNAL LIST SCREEN
8
Need help?
www.sanyoctv.com
1-800-877-5032
REMOTE CONTROL OPERATION
• POWER Key—Turns your HDTV On or Off.
• USB Key—Selects the USB input directly.
• ECO Key—Modifies the Energy Saver level (see
page 11.)
• PIX SHAPE Key—Cycles through the available
aspect ratios. The different settings either
stretch, zoom, or fill the image on your screen.
Bars may appear on top and bottom of your
screen (or on left and right sides) depending on
the broadcasted signal or program.
• AUDIO Key—Selects the desired Audio mode.
Stereo, Mono, or SAP (when available.)
• ON TIMER Key—Displays the current switch on
time (see Clock Timer on page 12.)
• CAPTION Key—Cycles through the available
Caption modes.
• RESET Key—Pressing it twice restores your
HDTV to its factory settings. All user customized
settings will be cleared.
NOTE: Pix6-7 are setup as Pix1-2 in PC mode. Use of
Pix6-7 in TV mode is not recommended.
• MENU—Displays or hides the on-screen menu.
• HELP—Displays on-screen Help menu.
• INFO Key—Displays the Channel Information
banner.
• SLEEP Key—Displays the “Off” Timer. While Off
Timer is on-screen, press the “0” key to Set the
amount of time (in 30 minute increments) at
which the HDTV will turn off.
• EXIT Key—Exits the on-screen menu.
• PICTURE Key—Cycle through the picture modes.
• Cursor (LEFT) (RIGHT) keys—Move the onscreen cursor left and right.
• SOUND Key—Cycle through the sound modes.
• NUMERICAL Keys—Select channels directly.
NOTE: For channels 100 and up, press and hold the
first number, then enter the remaining two numbers.
• Cursor (UP) (DOWN) keys—Move the onscreen cursor up and down.
• ENTER Key—Set or select the highlighted option
on the screen.
– (sub ch) key —Allows for the direct selection
of digital chanels and subchannels. For example: to select channel 39.1 press the 3 and 9
keys followed by the dash –, and 1 keys.
The PLAY, PAUSE, STOP, REW, FF, W, T, CAMERA,
and XACTI MENU keys control playback features
on a Sanyo Xacti digital camera when the HDMICEC feature has been activated on both the HDTV
and the Xacti camera (see HDMI Linking feature
on page 12.)
• INPUT Key—Selects the video source to view.
Holding down the key displays the Input List.
NOTE: These playback keys may or may not react with
other devices other than the Xacti camera.
•
• Volume + – keys—Increases or decreases the
audio level.
• Channel keys—Scan through the channels
in the memory database.
• MUTE Key—Mute or restore the sound.
• RECALL Key—Switch between current channel
and last selected channel.
• DYN VOL Key—Modifies the Dyanmic Volume
feature settings.
Need help?
www.sanyoctv.com
1-800-877-5032
9
ON-SCREEN MENU OPERATION
CHANNEL SETTING ___________
Display the On Screen menu and use the
CURSOR keys to select Channel Setting.
Press ENTER.
Channel Search
Auto – Searches the detected mode, Cable or Air.
Cable – Searches for analog and unscrambled
(ClearQAM) digital cable channels.
Air (Antenna) – Searches for analog and digital off-air
channels.
Digital Add-On – Searches digital off-air channels
adding newly found digital channels to the channel
map database.
MAIN MENU SCREEN
NOTE: Digital Add-On option is not available when the current mode is Cable.
Channel Scan Memory
Channel Scan Memory lists all Analog and Digital
channels found. It also lists Analog channels that were
not found, which can be added.
CHANNEL SETTING SCREEN
Use the CURSOR keys to move the channel select
bar throuh all enabled and disabled channels, or use
the CH keys to skip all disabled channels.
Press ENTER to enable or disable the selected channel.
NOTE:
For information on local digital channels, visit
www.antennaweb.org
IMPORTANT FACT: This HDTV maintains only one database of
digital channels. Therefore, when you search for cable channels, the database of antenna digital channels will be deleted.
You will only be able to receive those ClearQAM channels your
cable company provides.
CHANNEL SCAN MEMORY SCREEN
Input Setting
Input Setting feature allows the removal of unused
inputs from the AV input loop.
Use the CURSOR keys to select an AV input. Press
ENTER to disable (uncheck) or enable (check) the highlighted input.
NOTE: At least one input must and will remain checked.
:Skip is for reference only.
10
Need help?
www.sanyoctv.com
1-800-877-5032
INPUT SETTING SCREEN
ON-SCREEN MENU OPERATION
Video2 Setting
Use this feature to establish either a Component or
Composite connection to the VIDEO INPUT 2 jacks on
your HDTV.
Use the CURSOR keys to select the type of connection you’ll use in VIDEO INPUT 2.
Press ENTER, a blue mark will appear next to the
selected option.
VIDEO2 SETTING SCREEN
SETUP ________________________
Display the On Screen menu and use the
CURSOR keys to select Setup.
Press ENTER.
Menu Language
Choose between English, Spanish and French for your
On Screen menu’s display language.
Press ENTER on the desired language.
MENU LANGUAGE SCREEN
Digital Caption
Captioning is textual information transmitted along
with the picture and sound. Turning Captioning ON (by
pressing the CAPTION key during normal TV viewing)
causes the HDTV to open these captions (digital or
analog) and superimpose them on the screen.
NOTE: Local broadcasters decide which caption signals to
transmit.
Use the CURSOR and keys to modify Font,
Background, and Foreground of digital caption text.
DIGITAL CAPTION SCREEN
Energy Saver
Energy Saver settings control the LCD backlight
brightness to reduce power consumption.
• Level 1: Energy Saver feature is off.
• Level 2: Low power consumption.
• Level 3: Lowest power consumption.
Press ENTER on the desired level.
NOTE: ECO key may also be used as a shortcut to modify the
Energy Saver settings.
Need help?
ENERGY SAVER SCREEN
www.sanyoctv.com
1-800-877-5032
11
ON-SCREEN MENU OPERATION
SETUP _________________________
Clock timer
This feature allows you to set a Current Time for your
HDTV and enable a Switch On Time for the HDTV to
turn on at a specific time of day.
When On Timer Function is set to ON, the TV will
automatically turn on at the previously set Switch on
Time.
CLOCK TIMER SCREEN
Light sensor
This feature detects ambient room light brightness
and uses that reading to control the panel brightness
level and picture parameters to reduce the HDTV’s
power consumption.
NOTE: When room lighting is dark, the panel brightness
and/or the picture setting parameters such as brightness and cotrast are lowered. When room lighting is
bright, parameters are affected opposite.
LIGHT SENSOR SCREEN
HDMI Linking
NOTE: Designed for use with a Sanyo Xacti Digital
VIdeo/Movie Camera, and may not support all HDMICEC functions of other equipment.
Use the HDMI-CEC Function to enable or disable all
available CEC functions.
HDMI Power ON Sync and Power OFF Sync enable
specific features including the automatic power ON
process and power OFF process.
HDMI LINKING SCREEN
Xacti-LINK
With a Sanyo Xacti Digital Video/Movie
Camera hooked up to your HDTV’s
HDMI input, setting the HDMI-CEC
Function to ON enables you the use of
keys on your GXEA remote to operate
your Xacti camera.
NOTE: The HDMI-CEC function of the Xacti must also be
turned ON to enable the Xacti-Link.
12
Need help?
www.sanyoctv.com
1-800-877-5032
ON-SCREEN MENU OPERATION
SETUP _________________________
V – Chip
(Parental control)
Use this feature to automatically block programs with
content you deem as inappropriate for viewing by
your children.
NOTE: This feature is designed to comply with the United
States of America’s FCC V-Chip regulations. Therefore,
it may not function with broadcasts that originate in
other countries.
V-CHIP SETUP SCREEN
ADJUSTING THE V-CHIP RATINGS
Select ON and press ENTER.
Select Adjust (Standard) and press ENTER.
Use the CURSOR and keys to navigate and
the ENTER key to Block or Unblock a selected rating. A
lock symbol will appear beside the selected rating
option indicating that it is blocked.
NOTE: Blocking a rating will automatically block all higher
ratings. Unblocking a rating automatically unblocks
all lower ratings.
ADJUST (STANDARD) SCREEN
ADVANCED V-CHIP SYSTEM (RRT5)
RRT5 (V-Chip Regional Ratings 5) is an advanced V-Chip
ratings system for digital channels that are received
with an antenna.
When the HDTV detects compatible RRT5 data, it’s
downloaded & stored in memory, and the Setup
V-Chip screen is then modified to show the Adjust
(Advanced) option.
Use the CURSOR and keys to highlight the
different options, and use the ENTER key to block or
unblock the selected rating.
V-CHIP SETUP SCREEN WITH ADJUST
(ADVANCED) OPTION
NOTE:There may be more ratings than can be displayed on
one screen. When vertical scroll bars appear, press
CURSOR to gain access to the additional ratings.
MORE INFORMATION
Additional information about MPAA (Motion Picture
Association of America) and V-Chip rating can be
found at: www.mpaa.org and www.v-chip.org,
respectively.
ADJUST (ADVANCED) SCREEN
Need help?
www.sanyoctv.com
1-800-877-5032
13
ON-SCREEN MENU OPERATION
PICTURE ____________________
Display the On Screen menu and use the
CURSOR keys to select Picture. Press ENTER.
You may choose between Vivid, Mild, , and Standard,
which have predetermined fixed picture parameter
values, or choose the Manual option for customized
personal settings.
NOTE: Each AV input can have its own picture mode (predetermined or manual.) Current input’s selected
option is indicated by a blue marker.
MAIN MENU SCREEN
MANUAL PICTURE SETTINGS
Manual parameters to adjust include:
• Color
• Tint
• Contrast
• Brightness
• Sharpness
• Dynamic Contrast
The Detailed Setting option allows for the adjustment
of 7 additional parameters such as:
• Signal Balancer
• Noise Reduction
• White Balance
• Edge Enhancer
• V-Size
PICTURE SCREEN (MANUAL)
• Vertical Sharpness
• H-Size
NOTE: Default Picture option returns all picture parameters to
their original factory settings.
ADJUSTING A PICTURE SETTING
Use the CURSOR keys to highlight the picture
parameter you wish to adjust. Press the ENTER key to
enter the value adjustment screen. Modify the selected
parameter’s value by pressing the CURSOR keys.
PARAMETER SELECTION SCREEN
NOTE: CURSOR keys select the next/previous parameter without returning to the previous menu screen.
Once adjustments are complete, press the EXIT key to
return to normal TV viewing.
VALUE ADJUSTMENT SCREEN EXAMPLES
14
Need help?
www.sanyoctv.com
1-800-877-5032
ON-SCREEN MENU OPERATION
SOUND _____________________
Display the On Screen menu and use the
CURSOR keys to select Sound. Press ENTER.
Choose an option for your sound settings:
Auto – Sound settings are linked to the current Picture
option and parameters are adjusted accordingly.
Dynamic, Mild, Standard – Predetermined sound
parameters not linked with any Picture option.
MAIN MENU SCREEN
MANUAL SOUND SETTINGS
The Manual option provides different parameters that
can be personally adjusted:
• Bass & Treble
• Bass Extension
• Audyssey Dynamic Volume 1
• Detailed Setting
– 4-Band Equalizer: Personalize audio highs and lows.
NOTE: Default Sound option returns all sound parameters to
their original factory settings.
MANUAL PARAMETER SCREEN
ADJUSTING A SOUND SETTING
Use the CURSOR keys to highlight the sound
parameter you wish to adjust. Press the ENTER key to
enter the value adjustment screen. Modify the selected
parameter’s value by pressing the CURSOR keys.
NOTE: CURSOR keys select the next/previous parameter without returning to the previous menu screen.
Once adjustments are complete, press the EXIT key to
return to normal TV viewing.
DETAILED SETTING SCREEN
1 Audyssey Dynamic Volume solves the problem of large
variations in volume level between television programs,
commercials, and between the soft and loud passages of
movies. Audyssey Dynamic EQ is integrated into Dynamic
Volume so that as the playback volume is adjusted automatically, the perceived bass response, tonal balance,
surround impression and dialog clarity remain the same.
Need help?
VALUE ADJUSTMENT SCREEN EXAMPLES
www.sanyoctv.com
1-800-877-5032
15
PC INPUT
Use your HDTV as a computer monitor by hooking
up your PC or Laptop to the TV with the use of an
appropriate monitor cable (not included.)
Before connecting any cables, disconnect the
AC power cords of both the HDTV and PC from
the AC outlets.
Power on the HDTV and any other peripheral
equipment before powering on the computer.
To avoid an “Out of Range” condition please set
your PC’s output resolution to one compatible with
your HDTV. See PC Resolution chart on page 3.
RGB OUTPUT
JACK
Auto Adjustment – Automatically adjusts display
position, dot clock and phase.
Dot Clock – Adjust the Dot frequency to match
your computer’s Dot frequency.
Phase – Adjust this parameter when the picture
appears to flicker or is blurred.
H-Position – Move the image horizontally
V-Position – Move the image vertically
Power Saving – Enable the HDTV to turn to
Standby Mode when computer is not in use.
NOTE: If computer has only DVI Output, a DVI to RGB
adapter will be required, or, a DVI to HDMI cable
and RCA audio cables (see HDMI (DVI) INPUT1 on
page 7.)
HDTV BACK
PC Setting
DVI OUTPUT
JACK
Stereo mini
audio cable
PC SETTING SCREEN
PC OR LAPTOP
RGB Monitor
cable
PC Picture and Sound
Sanyo recommends using a
monitor cable that includes
a Ferrite Core.
Standard – Sets predetermined values to the
Picture or Sound parameters.
Manual – Adjust Contrast, Brightness, and Color
Temperature screen settings, and the Bass and
Treble audio settings.
Laptop Display
When using your Sanyo HDTV to display a
Laptop’s screen display, holding down the Fn (or
FN) key while pressing the appropriate function
key (F5, F7, F8, etc) should cycle through different
display modes between the laptop and the HDTV.
Modes may include displaying only on the laptop
screen, on both the laptop and the HDTV, or
displaying only on the HDTV.
Hold down
and press
PC PICTURE AND SOUND SCREENS
NOTE: Fn key and function key symbols on the laptop’s
keyboard may vary from one brand to another.
16
Need help?
www.sanyoctv.com
NOTE: These settings do not affect normal TV viewing.
1-800-877-5032
USB INPUT
PHOTO VIEWER _____________
View pictures on your HDTV with the use of a USB
mass storage device (not included.)
USB FLASH
DRIVE
THUMBNAIL VIEW SCREEN
NOTE: The HDTV switches to
USB Input when a USB
flash drive is detected.
NOTE: A thumbnail hide icon will appear if a
picture cannot be decoded or if no
thumbnail data is available.
USING THE PHOTO VIEWER
Press ENTER on a thumbnail photo to enable the
Rotate, Full View and Start Slideshow functions.
Once in Full View mode:
Use the CURSOR keys to change picture.
Press ENTER to show the full view options menu.
SLIDE SHOW
In the Slideshow Setup menu you may turn the Shuffle
and Quick Change options ON or OFF.
FULL VIEW
OPTIONS MENU
SLIDE SHOW
SETUP MENU
Press ENTER on Start Slideshow from the Thumbnail
View Screen or from the full view options menu to
start the slideshow from the current picture.
JPEG VIEWER USB MENU
Press MENU when in Full View or Slideshow mode to
display the USB On screen menu.
Picture Setting – Adjust Color, Tint, Contrast,
Brightness, Sharpness and Dynamic Contrast.
NOTE: Picture Settings are separate configurations from the
settings in TV and AV inputs.
USB MAIN MENU SCREEN
Need help?
www.sanyoctv.com
1-800-877-5032
17
ONE-YEAR LIMITED PARTS AND LABOR WARRANTY
THIS LIMITED PARTS AND LABOR WARRANTY IS VALID ONLY ON SANYO TELEVISIONS PURCHASED AND USED IN
THE UNITED STATES OF AMERICA, CANADA, AND PUERTO RICO, EXCLUDING ALL OTHER U.S. TERRITORIES AND
PROTECTORATES. THIS LIMITED WARRANTY APPLIES ONLY TO THE ORIGINAL RETAIL PURCHASER, AND DOES NOT
APPLY TO PRODUCTS USED FOR INDUSTRIAL OR COMMERCIAL PURPOSES.
WARRANTY APPLICATION
FOR ONE YEAR from the date of original retail purchase Sanyo Manufacturing Corporation (SMC) warrants this TV to
be free from manufacturing defects in materials and workmanship under normal use and conditions for parts and labor.
For the FIRST 90 DAYS from the date of original retail purchase, Sanyo Manufacturing Corporation will replace any
defective TV via exchange at the retailer. To ensure proper warranty application, keep the original-dated-sales receipt
for evidence of purchase. Return the defective TV to the retailer along with the receipt and the included accessories,
such as the remote control. The defective TV will be exchanged for the same model, or a replacement model of equal
value, if necessary. Replacement model will be contingent on availability and at the sole discretion of Sanyo
Manufacturing Corporation.
THE FOREGOING WARRANTY IS EXCLUSIVE AND IN LIEU OF ALL OTHER WARRANTIES OF MERCHANTABILITY OR
FITNESS FOR A PARTICULAR PURPOSE.
OBLIGATIONS
For one year from the date of purchase, Sanyo Manufacturing Corporation warrants this product to be free from
defects in material and workmanship under normal use and conditions. During the first 90 days under this warranty
for any manufacturing defect or malfunction Sanyo Manufacturing Corporation will provide a new TV via exchange at
the retailer.
HOW TO MAKE A CLAIM UNDER THIS WARRANTY
Please call 1-800-877-5032. Please be prepared to give us the television’s model number and serial number when you
call. The model number and serial number are printed on a label attached to the back of the unit.
For customer assistance, call toll free 1-800-877-5032.
This warranty expresses specific contractual rights; retail purchasers may have additional statutory rights which vary
from state to state.
(EFFECTIVE: March 1, 2007)
Your Sanyo HDTV is registered at the time of purchase, please keep sales receipt for future reference.
For your protection in the event of theft or loss of this product, please fill in the information requested
below and KEEP IN A SAFE PLACE FOR YOUR OWN PERSONAL RECORDS.
Model No.______________________________
Date of Purchase _________________________
Serial No.______________________________
Purchase Price ___________________________
(Located on back of unit)
Where Purchased_________________________
Sanyo Manufacturing Corp.
3333 Sanyo Road, Forrest City, AR 72335
18
Need help?
www.sanyoctv.com
1-800-877-5032
PRECAUCIÓN
RIESGO DE CHOQUE ELÉCTRICO ¡NO ABRIR!
ESTE SÍMBOLO INDICA QUÉ VOLTAJES PELIGROSOS QUE CONSTITUYEN UN RIESGO DE CHOQUE ELÉCTRICO ESTÁN PRESENTES DENTRO DE ESTA UNIDAD.
PRECAUCIÓN: PARA REDUCIR EL RIESGO DE CHOQUE ELÉCTRICO, NO QUITE LA CUBIERTA
(O LA TAPA TRASERA). NO HAY PARTES ADENTRO QUE LAS PUEDA REPARAR EL USUARIO.
REFIÉRASE A PERSONAL CALIFICADO PARA REPARAR EL APARATO.
ESTE SÍMBOLO INDICA QUE HAY INSTRUCCIONES IMPORTANTES DE
OPERACIÓN Y MANTENIMIENTO EN LA LITERATURA QUE SE ANEXA A
ESTA UNIDAD.
ADVERTENCIA: PARA REDUCIR EL RIESGO DE FUEGO O CHOQUE ELÉCTRICO, NO EXPONGA ESTE
APARATO A LLUVIA O HUMEDAD.
IMPORTANTES MEDIDAS DE SEGURIDAD
1. Lea estas instrucciones.
2. Guarde estas instrucciones.
3. Preste atención a los avisos.
4. Siga todas las instrucciones.
5. No use este aparato cerca del agua.
6. Limpie sólo con un trapo seco.
7. No obstruya las aperturas para ventilación. Instale de
acuerdo a las instrucciones del fabricante.
8. No se instale cerca de ninguna fuente de calor como
radiadores, registros de calor, estufas, u otros aparatos
(incluyendo amplificadores) que produzcan calor.
9. Por seguridad, no elimine la conexión de tierra de la
clavija. Una clavija polarizada tiene una hoja más ancha
que la otra. Una clavija de tipo conexión a tierra, tiene dos
hojas y un tercer conector mas prolongado. La hoja ancha
o el conector prolongado están provistas para su seguridad. Si la clavija proveída no asienta correctamente en el
contacto eléctrico, consulte a un electricista para que esa
toma de ac obsoleta sea remplazada.
15. Si una antena externa se ha conectado al televisor,
asegúrese que el sistema de tierra de la antena esté de
forma que provea alguna protección contra fugas de voltaje o cargas electrostáticas. En la sección 810-21 del código
eléctrico nacional de los Estados Unidos se menciona información con respecto a la manera adecuada de instalar el
sistema de tierra al mástil principal, aterrizaje del cableado
para la unidad de descarga de la antena, tamaño de los conductores de tierra, localización de la unidad de descarga
de la antena, conexión a los electrodos de tierra, y
requerimientos de los electrodos de tierra.
16. Un sistema de antena externo no debe instalarse cerca de
líneas de electricidad o circuitos de potencia o alumbrado, o
donde puedan caer sobre líneas de energía eléctrica o
circuitos cuyo contacto con ellos puede ser fatal.
EJEMPLO DE ATERRIZAMIENTO DE ANTENA DE ACUERDO
AL CÓDIGO ELÉCTRICO NACIONAL
(National Electrical Code, ANSI/NFPA 70)
10. Proteja el cordón de potencia de que sea pisado o
perforado, particularmente en las hojas y del punto donde
éste sale del aparato.
11. Sólo use anexos o accesorios especificados por el
fabricante.
12. Use únicamente con el carro, estante, tripie,
soporte o mesa especificada por el fabricante, o
vendida con el aparato. Cuando se use un carro,
tenga precaución cuando mueva la combinación
de carro/aparato para evitar lesiones en caso de
que se caiga.
13. Desconecte este aparato en caso de tormenta eléctrica o
cuando no se use por un periodo de tiempo prolongado.
14. Refiera todas las reparaciones a personal de servicio calificado. Se requiere de servicio cuando el aparato se ha dañado de cualquier forma, como si el cordón de potencia se
dañara de alguna forma, se ha derramado líquido sobre el
aparato o algún objeto le ha caído encima, el aparato se ha
expuesto a la lluvia o humedad, que no opere normalmente
o que se haya caído.
¿Necesita ayuda?
“Nota al instalador del sistema de cable CATV :
Este recordatorio es dado para llamar la atención del instalador
del sistema de cable CATV al Artículo 820-40 del NEC que
provee guías para el aterrizamiento adecuado y, en particular,
especifica que el cable de tierra deberá de estar conectado al
sistema de tierra del edificio, tan cercano al punto de entrada
del cable como sea práctico.”
17. Montaje en pared o techo—Este producto deberá de ser
montado en la pared o techo siguiendo las recomendaciones
del fabricante.
18. Este aparato no deberá de ser expuesto a ser mojado, y no
se deberán de colocar recipientes con líquido encima de él.
19. Si el conector del cable de AC se usa como artículo de
desconexión principal, entonces éste deberá de
permanecer accesible todo el tiempo.
www.sanyoctv.com
1-800-877-5032
19
INFORMACIÓN FCC
Este equipo ha sido probado y se encontró en acuerdo a los límites para un aparato digital Clase B, en acorde
a la Parte 15 de las Reglas FCC. Estos límites están diseñados para proveer una protección razonable contra
interferencia nociva en una instalación residencial. Este equipo genera, usa y puede irradiar energía de radio
frecuencia y si no es instalado o usado de acuerdo a las instrucciones, puede llegar a causar interferencia nociva a
radio comunicaciones. Sin embargo, no es completamente seguro que no ocurrirá interferencia alguna en una
instalación en particular. Si este equipo llega a causar interferencia nociva a la recepción de radio o televisión, la cual
puede ser determinada por medio de apagar y encender el equipo, se recomienda al usuario intentar corregir la
interferencia mediante una o varias de las siguientes medidas:
- Reorientar o mover la antena de recepción.
- Aumentar la separación entre el equipo y el receptor.
- Conectar el equipo a un enchufe en un circuito diferente al cual esté conectado el receptor.
- Consultar al vendedor o a un técnico de radio y televisión con experiencia para más ayuda.
PRECAUCIÓN: Regulaciones de la FCC advierten que modificaciones inadecuadas o cambios no autorizados a
esta unidad pueden anular la autorización del usuario para operar la unidad.
MARCAS REGISTRADAS
RESOLUCIONES DE PC
Manufacturado bajo licencia de Dolby Laboratories.
“Dolby ” es una marca registrada de Laboratorios
Dolby.
HDMI, el logo HDMI y “High-Definition
Multimedia Interface” son marcas registradas de HDMI Licensing LLC en los
Estados Unidos y otros países.
Como un Asociado de ENERGY STAR®,
Sanyo Manufacturing Corporation, ha
determinado que este producto cumple
con los lineamientos en eficiencia
energética de ENERGY STAR®.
Este símbolo impreso, significa que
el producto está listado por
Underwriters Laboratories Inc. El diseño y manufactura de este producto,
reúne los rígidos estándares de U.L.,
contra riesgos de incendio, accidentes
o descargas eléctricas.
Manufacturado bajo licencia de
Audyssey Laboratories. Patentes de
E.U.A. y foráneas pendientes.
Audyssey Dynamic VolumeTM es una
marca de Audyssey Laboratories.
20
¿Necesita ayuda?
www.sanyoctv.com
1-800-877-5032
CONTENIDO
ESPECIFICACIONES
IMPORTANTES MEDIDAS DE SEGURIDAD . . . . . . . . .19
INFORMACIÓN FCC . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .20
MARCAS REGISTRADAS . . . . . . . . . . . . . . . . . . . . . . . . . .20
RESOLUCIONES DE PC . . . . . . . . . . . . . . . . . . . . . . . . . . . .20
CONTENIDO . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .21
PRECAUCIONES DE DESECHO . . . . . . . . . . . . . . . . . . . . .21
ESPECIFICACIONES . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .21
PRECAUCIONES DE MANEJO Y PANTALLA . . . . . . . . . .21
COLOCACIÓN DE LA HDTV . . . . . . . . . . . . . . . . . . . . . . . . .22
QUITAR LA BASE / MONTAJE EN PARED . . . . . . . . . . . .22
PARA COMENZAR—
Instalación de baterías al control . . . . . . . . . . . . . . . . .22
Conexión de antena aire/cable . . . . . . . . . . . . . . . . . . .22
Operación del control remoto . . . . . . . . . . . . . . . . . . . .23
CONECTORES DEL PANEL TRASERO . . . . . . . . . . . . . . . .24
CONEXIONES DE AUDIO/VIDEO . . . . . . . . . . . . . . . . . . . .25
CONEXIÓN A CORRIENTE . . . . . . . . . . . . . . . . . . . . . . . . . .26
BÚSQUEDA INICIAL DE CANALES . . . . . . . . . . . . . . . . . .26
OPERACIÓN DEL MENÚ EN PANTALLA—
Establecer canales . . . . . . . . . . . . . . . . . . . . . . . . . . . . .27
Búsqueda de canales . . . . . . . . . . . . . . . . . . . . . . . .27
Memoria de canales . . . . . . . . . . . . . . . . . . . . . . . . .27
Establecer entradas . . . . . . . . . . . . . . . . . . . . . . . . .27
Configuración de Video2 . . . . . . . . . . . . . . . . . . . . .28
Configuración . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .28
Lenguaje del menú . . . . . . . . . . . . . . . . . . . . . . . . . .28
Subtítulos digitales . . . . . . . . . . . . . . . . . . . . . . . . . .28
Ahorrador de energía . . . . . . . . . . . . . . . . . . . . . . . .28
V-Chip . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .29
Reloj temporizador . . . . . . . . . . . . . . . . . . . . . . . . . . .30
Sensor de luz . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .30
Enlace HDMI . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .30
Imagen . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .31
Configuración manual de imagen . . . . . . . . . . . . . .31
Sonido . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .32
aaConfiguración manual de sonido . . . . . . . . . . . . . .32
REPRODUCTOR DE IMÁGENES . . . . . . . . . . . . . . . . . . . . .33
CONEXIONES DE PC . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .34
CONFIGURACIÓN DE PC . . . . . . . . . . . . . . . . . . . . . . . . . . .34
GARANTÍA . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .35
Requerimiento de Potencia: AC 120V, 60Hz
“La Academia Americana de Pediatras no
recomienda permitir a niños menores de 2
años ver televisión”
Consumo de Potencia:
DP42840 178 watts
DP46840 213 watts
Peso:
18 kg.
20 kg.
Dimensiones:
MODELO
ANCHO
ALTO
PROFUNDO
DP42840
101
70,4
65,3
30,7
12,1
111
77,9
71,4
32,4
12,1
sin base
DP46840
sin base
NOTA: Las dimensiones están en centímetros.
Favor de leer antes de
operar su HDTV!
PROTEGER LA PANTALLA LCD
PRECAUCIÓN: La pantalla podría dañarse si no se
le da un mantenimiento adecuado.
• NO use objetos duros como trapos gruesos o
papel para limpiar la pantalla.
• NO utilice presión excesiva cuando se limpie la
pantalla de LCD; esto podría causar decoloración permanente o puntos negros en la
misma.
• NUNCA aplique líquidos en aerosol a la pantalla.
PRECAUCIONES DE
MANEJO
• Manéjese sólo por el gabinete.
• Se recomienda manejar el televisor por dos o
más personas.
• Nunca toque la pantalla cuando esté manejando la HDTV.
• Daño por manejo no está cubierto por la
garantía.
CONTIENE LÁMPARAS DE
MERCURIO, DESECHAR
DE MANERA APROPIADA
¿Necesita ayuda?
www.sanyoctv.com
1-800-877-5032
21
COLOCANDO LA HDTV DE
LCD
• Siempre utilice una superficie firme y plana al
colocar su HDTV.
• No se coloque la HDTV en áreas confinadas.
• Mantenga suficiente espacio para una buena
ventilación.
• No coloque la HDTV donde sea fácilmente accesible a niños pequeños y pueda presentar un
riesgo de accidente.
QUITAR LA BASE Y MONTAJE
EN PARED (OPCIONAL)
Herramienta necesaria: Desarmador de cruz.
NOTA IMPORTANTE:
Coloque la HDTV con la pantalla hacia
abajo sobre una superficie plana y acolchonada para proteger la pantalla y el
acabado de la HDTV.
Una persona con experiencia debe realizar el
montaje en pared.
PARA COMENZAR
INSTALACIÓN DE BATERÍAS
Instale las baterías al control remoto.
( 2 “AAA”, no incluídas)
Para una operación segura, favor de observar
las siguientes precauciones:
• Reemplace ambas baterías al mismo tiempo.
No utilice una batería nueva con una usada.
• Existe riesgo de explosión si las baterías son remplazadas con unas de tipo incorrecto.
• No exponga el Control Remoto a calor o humedad.
• Asegúrese que las marcas “+” y “–” de las baterías
correspondan con las del control remoto.
CONEXIÓN DE ANTENA PARA
SEÑALES DE AIRE O CABLE
Conecte su antena o servicio de cable a la
entrada ANT de su HDTV utilizando un cable
coaxial (75 OHM).
NOTA: Mantenga su antena para interiores al menos
a un (1) metro de distancia tanto de su HDTV
como de cualquier otro aparato electrónico.
ANTENA
ENTRADA DE ANTENA
ANÁLOGA / DIGITAL
1
Quite los cuatro (4) tornillos del pedestal de
soporte. PRECAUCIÓN: Sujete firmemente la
base al quitar el último tornillo.
2
Use los tornillos que remueva al quitar la base
y úselos para montar la TV al estuche de
pared (no incluído)
Interfase estándar VESA: 400 x 400
Medida de los tornillos:
Diámetro M6, Longitud – 12mm (máximo)
22
¿Necesita ayuda?
www.sanyoctv.com
CABLE
Esta HDTV puede sintonizar:
• Señales aéreas digitales y análogas de una antena.
• Canales de Cable análogos o sin codificar de una
conexión directa de TV por Cable.
1-800-877-5032
OPERACIÓN DEL CONTROL REMOTO
• Tecla POWER—Prende o apaga su HDTV.
• Tecla MUTE—Cancelar o restaurar el audio.
• Tecla ECO—Modifica el nivel del Ahorrador de
Energía. (Ver pág. 28).
• Tecla RECALL—Cambiar entre el canal actual y
el último accesado.
• Tecla AUDIO—Selecciona el tipo de audio,
Estéreo, Mono, o SAP (de estar disponible).
• Tecla DYN VOL—Modifica los valores de la
función de Dynamic Volume
• Tecla ON TIMER—Despliega en pantalla la hora
de encendido actual (ver Reloj Temporizador en
la pág. 30).
• Tecla USB—Selecciona la entrada de USB.
• Tecla CAPTION—Elegir entre los diferentes
modos de subtítulos digitales.
• Tecla RESET—Presione dos veces seguidas para
restaurar la TV a configuraciones de fábrica. Se
borrarán las modificaciones del usuario.
• Tecla SLEEP—Despelgar el reloj de apagado.
Mientras el reloj se encuentre en pantalla, presione la tecla “0” para establecer el tiempo (en
incrementos de 30 minutos) al cual se apagará
automáticamente la HDTV.
• Tecla PICTURE—Selecciona uno de los diferentes
modos de imagen.
• Tecla SOUND—Selecciona uno de los diferentes
modos de Sonido.
• Tecla PIX SHAPE—Elegir entre las relaciones de
aspecto disponibles. Las diferentes configuraciones estiran, agrandan o llenan la imagen en
la pantalla. Pueden aparecer en pantalla barras
en la parte superior e inferior, o lado izquierdo
y derecho, dependiendo en la señal o programa
transmitido.
NOTA: Pix6-7 están configurados como Pix1-2 de
modo PC. El utilizar Pix6-7 en modo de TV no
es recomendado.
• Tecla MENU—Mostrar el menú en pantalla.
• Tecla HELP—Mostrar en pantalla el menú de
ayuda.
• Tecla INFO—Desplegar el banner de información de canal.
• Tecla EXIT—Salir del menú en pantalla.
• Teclas NUMÉRICAS—Elegir canales directamente.
• Teclas Cursor (arriba) (abajo)—Mover el
cursor en pantalla hacia arriba y abajo.
NOTA: Para canales mayores al 99, mantenga presionado el primer número, suéltelo y presione los
dos números restantes.
• Teclas Cursor (izq.) (der.)—Mover el cursor
en pantalla hacia la izquierda y derecha.
• Tecla – (sub ch)—Permite la selección directa de
canales y subcanales digitales. Por ejemplo:
para seleccionar el canal 39.1, presione las
teclas 3, 9, seguidas del guión –, y 1.
• Tecla ENTER—Ejecutar la opción seleccionada
en pantalla.
• Tecla INPUT—Elegir la entrada de video deseada Mantenga presionada la tecla para mostrar
el menú de entradas.
• Tecla de volumen VOL+ – —Aumentar o disminuir el nivel del volumen.
Las teclas PLAY, PAUSE, STOP, REW, FF, W, T,
CAMERA y XACTI MENU controlan funciones de
una cámara digital Xacti de Sanyo al estar habilitada la función HDMI-CEC tanto en la HDTV como la
cámara (ver función de Enlace HDMI en la pág. 30).
NOTA: Las teclas de reproducción y funciones podrían
no activar otros aparatos aparte de la cámara
Xacti.
• Teclas de canal CH —Navegar los canales
en la base de datos de la memoria.
¿Necesita ayuda?
www.sanyoctv.com
1-800-877-5032
23
PARA COMENZAR
REFERENCIA DE ENTRADAS Y SALIDAS
5
1
1 Salida de Audio Digital (Coaxial)
2 Entrada de video Componente (VIDEO2 ó VIDEO3)
Entradas verde (Y), azul (Pb) y roja (Pr) de video; además de
las entradas de audio roja y blanca.
6
NOTA: Una conexión Compuesta es posible por medio de VIDEO
INPUT2 usando la entrada Y (VIDEO) y las de Audio L/R.
(Ver Configuración de Video2 en la pág. 28).
2
7
3 Entrada para PC y estéreo audio (mini)
• MONITOR RGB (D-SUB)
• AUDIO R/L (conector estéreo mini)
4 Entrada de antena análoga / digital
3
5 Entrada S-Video (VIDEO1)
NOTA: Una conexión a S-Video deshabilitará la conexión en la
entrada de VIDEO1 (amarillo)
8
6 Entrada de Video Compuesto (VIDEO1)
4
Entrada amarilla (video) y entradas roja y blanca (audio).
7 Salida de Audio Análogo (L/R)
8 Entrada USB
Despliegue fotos en pantalla desde su memoria USB.
9
9 Entradas HDMI (INPUT1, INPUT2 ó INPUT3)
Interfase completamente digital que acepta señales
de video sin compresión hasta de 1080p para
obtener la mejor calidad de imagen posible.
PANEL TRASERO
DE LA HDTV
NOTA: Una conexión DVI es posible por medio de la entrada
HDMI (DVI) INPUT1 utilizando un adaptador apropiado y
conectando el audio a las entradas de audio de VIDEO3.
Definición estándar
Alta definición
Óptima alta
definición
Compuesto
HDMI
S-Video
Componente
(o cable/adaptador
DVI a HDMI)
NOTA: Conexiones de video Compuesto, S-Video, Componente y DVI necesitan sus conexiones de audio
roja y blanca correspondientes. Imagen en Alta Definición es posible de señales y equipo HD.
24
¿Necesita ayuda?
www.sanyoctv.com
1-800-877-5032
PARA COMENZAR
CONEXIONES DE AUDIO Y VIDEO
La salida de Audio Digital es utilizada para
conectar un receptor multicanal con el uso de
un cable de audio digital.
Conexiones de COMPONENTE aceptan señales
de video SDTV, EDTV y HDTV. Utilícelas para
obtener una muy buena calidad de imagen de
dispositivos digitales tales como un reproductor DVD o consola de video juegos.
La conexión COMPUESTA es utilizada para
conectar equipo análogo tal como una videocasetera o un reproductor DVD que no cuente
con salidas de Componente.
NOTA:Siempre haga coincidir el color de las salidas de
su aparato externo con las entradas de su HDTV.
S-Video puede ser utilizada en lugar del
conector amarillo de video para una mejor
imagen de aparatos análogos.
RECEPTOR
MULTICANAL
VIDEOCASETERA
(o aparato análogo)
REPRODUCTOR DVD
(o aparato similar)
AMPLIFICADOR
ESTÉREO
DVI
La Salida de Audio Análogo (L/R) se utiliza
para conectar un amplificador estéreo
externo. (No conecte bocinas externas
directamente a la HDTV)
MEMORIA USB Utilice la entrada USB para
conectar una memoria USB
para desplegar imágenes JPEG
en la HDTV.
HDMI (DVI) INPUT1 puede ser usado para
conectar un aparato DVI utilizando un
cable DVI a HDMI o un adaptador apropiado.
Las entradas de Audio de VIDEO3 también
deben estar conectadas al aparato DVI.
RECEPTOR SATELITAL
(o aparato similar)
HDMI INPUT1, 2 & 3 se utilizan para
conectar aparatos digitales HD
como: reproductor Blu-ray, decodificador de Cable HD, receptor satelital
HD o consola de video juegos.
NOTA: Cables de Audio y Video
no vienen incluídos.
¿Necesita ayuda?
www.sanyoctv.com
1-800-877-5032
25
PARA COMENZAR
BÚSQUEDA DE CANALES INICIAL
Antes de continuar, asegúrese de conectar
correctamente su antena o conexión de TV por
cable y todos los dispositivos a su HDTV.
CONECTE EL CABLE DE CORRIENTE
120V AC, 60Hz
PANTALLA INICIAL DE MODO DE
AHORRO DE ENERGÍA
ENCIENDA LA TV
Siga instrucciones en pantalla para configurar
el Modo de Ahorro de Energía inicial y realizar
la Búsqueda Inicial de Canales/Señales.
ELEGIR DÓNDE SE USARA LA HDTV
Seleccione “Home Mode” al presionar la tecla CH
para establecer el nivel de brillo de las lámparas a un
nivel de Energy Star, o seleccione “Store Mode” al presionar CH para establecer el brillo de las lámparas a
uno adecuado para mostrador de exhibición.
BÚSQUEDA DE CANALES Y SEÑALES AV:
Presione la tecla CH para realizar una
búsqueda de canales de una Antena o una
conexión directa de Cable, y una búsqueda
de señales de dispositivos conectados a las
entradas de la HDTV.
PANTALLA DE CONFIGURACIÓN INICIAL
DE BÚSQUEDA DE CANALES
AYUDA EN PANTALLA (OPCIONAL)
Presione la tecla CH si desea accesar una
guía de ayuda en pantalla.
NOTA: Este menú de ayuda en pantalla también es
accesible desde el menú principal.
PANTALLA DE AVANCE DE BÚSQUEDA
PANTALLA DE LISTADO DE CANALES Y SEÑALES
La última pantalla de configuración despliega el
número de canales análogos y digitales encontrados,
así como entradas de video detectadas. Presionar la
tecla CH finaliza el proceso de configuración.
NOTA: Para repetir el proceso puede presionar VOL
SELECCIÓN DE ENTRADA AV
Presione la tecla INPUT para elegir correctamente la entrada de video que desea.
26
¿Necesita ayuda?
www.sanyoctv.com
PANTALLA DE LISTADO DE
CANALES Y SEÑALES
1-800-877-5032
OPERACIÓN DEL MENÚ EN PANTALLA
ESTABLECER CANALES ________
Despliegue el menú en pantalla. Utilice las
teclas CURSOR para seleccionar
Establecer canales. Presione ENTER.
Búsqueda de canales
Auto – Busca en el modo detectado, Cable o Aire.
Cable – Busca canales análogos y canales digitales de
Cable no codificados.
Aire (Antena) – Busca canales análogos y digitales de
transmisión aérea.
Adición digital – Busca canales digitales de transmisión aérea, agregando canales recientemente
encontrados a la base de datos de canales.
PANTALLA DE MENÚ PRINCIPAL
NOTA: La función de Adición Digital no es disponible si el
modo de TV es Cable.
Memoria de Canales
Esta función enlista todos los canales encontrados,
análogos y digitales. También muestra canales
Análogos que no se hallaron y pueden ser agregados.
PANTALLA DE ESTABLECER CANALES
Use el CURSOR para mover la barra de selección
por todos los canales habilitados y deshabilitados, o
use la tecla CH para saltarse los deshabilitados.
Presione ENTER para habilitar o deshabilitar el canal
seleccionado.
NOTA: Para información sobre canales digitales locales, visite
www.antennaweb.org
INFO. IMPORTANTE: Esta HDTV mantiene una sola base de datos
para canales digitales. Por lo tanto cuando busque canales de
Cable, la base de datos de canales digitales será borrada. Usted
sólo podrá recibir aquellos canales ClearQAM (decodificados)
provistos por su compañía de cable.
PANTALLA DE MEMORIA DE CANALES
Establecer entradas
Esta función permite quitar del ciclo de entradas
(INPUT) aquellas que no se estén utilizando.
Use el CURSOR para elegir una entrada. Presione
ENTER para habilitar (marcar) or deshabilitar (desmarcar) la entrada seleccionada.
NOTA: Al menos una entrada debe quedar habilitada.
:Saltar es sólo como referencia.
¿Necesita ayuda?
PANTALLA DE CONFIGURACIÓN DE ENTRADAS
www.sanyoctv.com
1-800-877-5032
27
OPERACIÓN DEL MENÚ EN PANTALLA
Configuración de Video 2
Utilice esta función para establecer una conexión ya
sea Componente o Compuesta a la entrada de VIDEO
INPUT 2 en su HDTV.
Use el CURSOR para seleccionar el tipo de
conexión que será usada en la entrada Video2.
Presione ENTER, aparecerá una marca azul junto a la
opción seleccionada.
PANTALLA DE CONFIG. DE VIDEO 2
CONFIGURACIÓN _____________
Despliegue el menú en pantalla. Use las teclas
CURSOR para seleccionar Configuración.
Presione ENTER.
Lenguaje del Menú
Elija entre el idioma inglés, español o francés para
desplegar el menú en pantalla.
Presione ENTER en el idioma deseado.
PANTALLA DE MENÚ DEL LENGUAJE
Subtítulos Digitales
Los Subtítulos Digitales son información de texto
oculta, transmitida junto con la imagen y sonido. El
activar la función (al presionar la tecla CAPTION al ver
televisión), la HDTV abre e interpreta esta información
(digital o análoga) y sobreimpone los textos en pantalla.
NOTA: Las transmisoras locales deciden que información
transmitir.
Use el CURSOR y para modificar la letra, el
fondo y el primer plano de los subtítulos digitales.
PANTALLA DE CONFIGURACIÓN DE
SUBTÍTULOS DIGITALES
Ahorrador de Energía
Control del brillo de las lámparas del panel para
reducir el consumo de energía.
• Nivel 1: Ahorrador de Energía apagado.
• Nivel 2: Bajo consumo de energía.
• Nivel 3: Consumo de energía aún más bajo.
Presione ENTER en el nivel deseado.
NOTA: La tecla ECO también puede ser utilizada para modificar
los valores sin entrar al menú.
28
¿Necesita ayuda?
www.sanyoctv.com
PANTALLA DE AHORRADOR
DE ENERGÍA
1-800-877-5032
OPERACIÓN DEL MENÚ EN PANTALLA
CONFIGURACIÓN ___________
V – Chip
(Control paternal)
Utilice esta función para bloquear automáticamente
programación con contenido que crea inapropiado
para ser visto por sus hijos.
NOTA: Esta función está diseñada para cumplir con regulaciones de la FCC para V-Chip en los Estados Unidos
de América. Esta función pudiera no activarse con
señales que originen de otros países.
PANTALLA DE CONFIGURACIÓN/V-CHIP
ADJUSTING THE V-CHIP SETTINGS
Elija Encendido y presione ENTER.
Elija Ajustar y presione ENTER.
Utilice las teclas de CURSOR y para navegar y la tecla ENTER para Bloquear o Desbloquear la
clasificación seleccionada. Aparecerá a un lado de la
clasificación el símbolo de un candado indicando que
está bloqueada.
NOTA: Bloquear una clasificación bloqueará todas las clasificaciones más altas. Desbloquear una clasificación,
desbloqueará todas las más bajas.
PANTALLA DE AJUSTAR (ESTÁNDAR)
SISTEMA AVANZADO V-CHIP (RRT5)
RRT5 (V-chip Regional Ratings 5) es un sistema avanzado de clasificación regional para canales digitales
recibidos desde una antena.
Cuando la HDTV detecta datos RRT5 compatibles, se
descargan y almacenan en memoria, entonces la pantalla de configuración V-Chip es modificada para
mostrar la opción de Ajustar (Avanzado).
La pantalla de Configuración/V-Chip se modifica para
mostrar la opción de Ajustar (avanzado).
Utilice las teclas CURSOR y para seleccionar
las diferentes opciones. Use ENTER para bloquear o
desbloquear la clasificación seleccionada.
NOTA:Puede haber más clasificaciones de las que se ven en
pantalla. Cuando aparezcan barras verticales, presione
CURSOR para accesar clasificaciones adicionales.
MÁS INFORMACIÓN
Puede consultar información adicional sobre las
clasificaciones V-Chip y MPAA en las páginas:
www.v-chip.org y www.mpaa.org
¿Necesita ayuda?
PANTALLAS DE AJUSTAR (AVANZADO)
www.sanyoctv.com
1-800-877-5032
29
OPERACIÓN DEL MENÚ EN PANTALLA
CONFIGURACIÓN _____________
Reloj Temporizador
Esta función permite establecer la Hora Actual en su
HDTV y habilitar una Hora de Encendido para que el
televisor se prenda a determinada hora.
Cuando la Función de encendido se habilita, la TV
automáticamente se encenderá a la hora establecida.
PANTALLA DE RELOJ TEMPORIZADOR
Sensor de luz
Esta función detecta la intensidad de luz ambiental
del cuarto y controla los parámetros de brillo e
imagen para reducir el consumo de energía de la TV.
NOTA: Cuando la habitación esté oscura, el brillo del panel y/o
los parámetros de imagen tales como brillo y contraste
son reducidos. Cuando la habitación es más iluminada,
los parámetros se afectan de manera contraria.
PANTALLA DE SENSOR DE LUZ
Enlace HDMI
NOTA: Diseñado para utilizarse con una cámara digital Xacti
de Video/Película marca Sanyo y puede no activar
todas las funciones HDMI-CEC de otros equipos.
Utilice la Función HDMI-CEC para habilitar y
deshabilitar funciones CEC disponibles.
Encendido Sinc. HDMI y Apagado Sinc. HDMI
habilitan funciones específicas como el proceso
automático de encendido y apagado.
PANTALLA DE ENLACE HDMI
Xacti-LINK
Con una cámara digital Xacti de
Video/Película marca Sanyo conectada a
la entrada HDMI de la HDTV, el configurar la Función HDMI-CEC a Encendido,
habilita el uso de las teclas del control
remoto GXEA para operar la cámara.
NOTA: La función HDMI-CEC de la cámara Xacti también
debe ser encendida para habilitar el Xacti-Link.
30
¿Necesita ayuda?
www.sanyoctv.com
1-800-877-5032
OPERACIÓN DEL MENÚ EN PANTALLA
IMAGEN ____________________
Despliegue el menú en pantalla. Utilice las
teclas CURSOR para seleccionar Imagen.
Presione ENTER.
Puede elegir entre Intenso, Moderado y Normal, los
cuales tienen valores fijos y predeterminados para los
diferentes parámetros.
O puede elegir la opción de Manual para ingresar
valores personalizados.
PANTALLA DE MENÚ PRINCIPAL
NOTA: Cada entrada de AV puede tener su propio modo de
imagen (predeterminado o manual). La opción seleccionada es indicada por una marca azul.
CONFIGURACIÓN MANUAL DE IMAGEN
Parámetros de ajuste Manual:
• Color
• Tinte
• Brillo
• Nitidez
• Contraste
• Contraste Dinámico
La opción de Configuración Detallada permite el ajuste
de 7 parámetros adicionales tales como:
• Balanceo de señal
• Reducción de ruido
• Balance de blanco
• Realce de orillas
• Tamaño-V
PANTALLA DE IMAGEN
• Nitidez Vertical
• Tamaño-H
NOTA: La opción de Valores originales regresa todos los
parámetros a sus niveles de fábrica.
AJUSTES A LOS PARÁMETROS DE IMAGEN
Utilice las teclas de CURSOR para seleccionar el
parámetro que desea ajustar. Presione la tecla ENTER
para accesar la pantalla de ajustes. Modifique los valores
del parámetro utilizando las teclas de CURSOR .
PANTALLA DE SELECCIÓN
DE PARÁMETROS
NOTA: Las teclas de CURSOR seleccionan al siguiente
o previo parámetro sin regresar a la pantalla anterior.
Una vez terminados los ajustes, presione la tecla EXIT
para salir del menú.
EJEMPLOS DE PANTALLA DE
AJUSTE DE PARÁMETROS
¿Necesita ayuda?
www.sanyoctv.com
1-800-877-5032
31
OPERACIÓN DEL MENÚ EN PANTALLA
SONIDO ____________________
Despliegue el menú en pantalla. Utilice las
teclas CURSOR para seleccionar Sonido.
Presione ENTER.
Elija una opción para su configuración de sonido:
Auto – Utiliza valores predeterminados de acuerdo al
modo actual de Imagen.
Dinámico, Tenue, Estándar – Valores predeterminados
para el sonido no ligados a las opciones de imagen.
PANTALLA DE MENÚ PRINCIPAL
CONFIGURACIÓN MANUAL DE SONIDO
La opción de Manual incluye varios parámetros que
pueden ser ajustados personalmente:
• Graves y Agudos
• Bass Extension
• Audyssey Dynamic Volume 1
• Configuración Detallada
– Ecualizador de 4 bandas: Personalice el espectro de
graves y agudos.
PANTALLA DE PARÁMETROS MANUALES
NOTA: La opción de Valores Originales regresa todos los
parámetros a su configuración original de fábrica.
AJUSTES A LOS PARÁMETROS DE SONIDO
Utilice las teclas de CURSOR para seleccionar el
parámetro que desea ajustar. Presione la tecla ENTER
para accesar la pantalla de ajustes. Modifique los valores
del parámetro utilizando las teclas de CURSOR .
NOTA: Las teclas de CURSOR seleccionan al siguiente
o previo parámetro sin regresar a la pantalla anterior.
PANTALLA DE PARÁMETROS
MANUAL (AVANZADO)
Una vez terminados los ajustes, presione la tecla EXIT
para salir del menú.
1 Audyssey Dynamic Volume soluciona el problema de diferen-
cias marcadas en el volumen entre programas de TV, anuncios
y entre las secciones de alto y bajo volumen de una película.
Audyssey Dynamic EQ está integrado a Dynamic Volume para
que al ajustarse el volumen automáticamente, la percepción
del bajo, balance, impresión de sonido envolvente y claridad
de diálogo permanezca igual.
32
¿Necesita ayuda?
www.sanyoctv.com
EJEMPLOS DE PANTALLA DE
AJUSTE DE PARÁMETROS
1-800-877-5032
ENTRADA USB
REPRODUCTOR DE IMÁGENES
Despliegue fotos en su HDTV con el uso de un
dispositivo de memoria USB.
MEMORIA
USB
PANTALLA DE VISTAS EN MINIATURA
NOTA: La HDTV se cambia a la
entrada USB cuando se
detecta una memoria en
el puerto USB.
NOTA: Aparecerá un ícono “tapando” la vista en
miniatura si una foto no puede ser decodificada o no contiene datos de vista previa.
FUNCIONAMIENTO
Presione ENTER sobre una foto en vista miniatura
para abrir las funciones de Rotar, Vista completa y Ver
presentación.
Una vez en Vista completa:
Use las teclas CURSOR para cambiar de foto.
Presione ENTER para mostrar el menú de opciones.
PRESENTACIÓN DE DIAPOSITIVAS
En el menú de Configuración puede habilitar o
deshabilitar las funciones de Aleatorio y Cambio rápido.
MENÚ DE OPCIONES
EN VISTA COMPLETA
AJUSTES A
PRESENTACIÓN
Presione ENTER en Ver presentación desde la pantalla
de vistas en miniatura o desde el menú de opciones en
vista completa para comenzar la presentación desde la
imagen seleccionada.
MENÚ DEL REPRODUCTOR
Presione MENU al estar en vista completa o en una
presentación de diapositivas para desplegar el menú
en pantalla.
Ajustes de imagen – Ajuste Color, Tinte, Contraste,
Brillo, Nitidez y Contraste Dinámico.
NOTA: Ajustes de imagen son configuraciones separadas a
las de TV y entradas AV.
PANTALLA DE MENÚ USB
¿Necesita ayuda?
www.sanyoctv.com
1-800-877-5032
33
CONEXIONES Y CONFIGURACION DE PC
Utilice su HDTV como monitor de computadora,
conectando su televisor a su PC o Laptop por
medio de un cable de monitor apropiado.
Antes de conectar algún cable, desenchufe de
la toma AC los cables de corriente tanto de la
HDTV como de la PC.
Encienda la HDTV y cualquier otro equipo
externo antes de encender la computadora.
Para evitar una condición “Fuera de Rango”,
establezca la resolución de video de su PC a una
resolución compatible con la HDTV. Ver pág. 20.
NOTA: Si la PC sólo cuenta con salida DVI, un adaptador DVI a RGB será requerido, o un cable DVI a
HDMI y unos cables RCA de audio (ver entrada
HDMI (DVI) INPUT1 en pág 25).
SALIDA
ANÁLOGA RGB
PANEL TRASERO HDTV
Configuración de PC
Auto Ajuste – Ajuste automático de posición de la
imagen, dot clock y fase.
Dot Clock – Ajusta la Frecuencia de Barrido para
igualarla a la de su PC.
Fase – Ajuste la Fase cuando la imagen aparenta
vibrar o estar borrosa.
Posición-H – Mueva la imagen horizontalmente.
Posición-V – Mueva la imagen verticalmente.
Ahorro de energía – Habilita a la HDTV entrar en
modo de espera mientras la PC no se utilice.
SALIDA
DIGITAL DVI
Cable estéreo
audio mini
PANTALLA DE
CONFIGURACIÓN PC
PC o LAPTOP
Cable de
monitor RGB
Imagen y Audio PC
Sanyo recomienda utilizar un cable de monitor
con ferrita.
Pantalla Laptop
Si utiliza su HDTV Sanyo para desplegar las
imágenes en pantalla de una laptop, el mantener
presionada la tecla Fn (o FN) mientras pesiona la
tecla de función (F5, F7, F8, etc.) apropiada deberá
ciclar los modos de despliegue entre la laptop y la
HDTV.
Estándar – Aplica valores predeterminados a los
parámetros de Imagen y Audio.
Manual – Ajuste los parámetros de Contraste,
Brillo y Temperatura de color de la pantalla, y los
Graves y Agudos del audio.
Los modos pueden incluir el desplegar la imagen
sólo en la laptop, tanto en la laptop como la
HDTV, o desplegar sólo en la HDTV.
Sostenga
y presione
PANTALLAS DE IMAGEN Y AUDIO (MANUAL)
NOTA: Los símbolos de las teclas Fn y de función en el
teclado de la laptop pueden variar entre una
marca y otra.
34
¿Necesita ayuda?
www.sanyoctv.com
NOTA: Estos parámetros no afectan los de TV normal.
1-800-877-5032
GARANTÍA LIMITADA DE UN AÑO EN PARTES Y MANO DE OBRA
ESTA GARANTÍA LIMITADA DE PARTES Y MANO DE OBRA ES VÁLIDA SÓLO EN TELEVISORES SANYO COMPRADOS
Y USADOS EN LOS ESTADOS UNIDOS DE AMÉRICA, CANADÁ Y PUERTO RICO, EXCLUYENDO CUALQUIER OTRO
TERRITORIO Y PROTECTORADO DE E.E.U.U. ESTA GARANTÍA LIMITADA APLICA SÓLO A COMPRADORES
MINORISTAS Y NO APLICA A PRODUCTOS UTILIZADOS CON FINES COMERCIALES O INDUSTRIALES.
APLICACIÓN DE LA GARANTÍA
POR UN AÑO, desde la fecha de la compra original, Sanyo Manufacturing Corporation (SMC) garantiza esta televisión
de estar libre de defectos de manufactura en materiales y mano de obra bajo uso y condiciones normales para partes
y trabajo.
Por los PRIMEROS 90 DÍAS, desde la fecha de la compra original, Sanyo Manufacturing Corporation remplazará
cualquier televisión defectuosa vía el vendedor original. Para asegurar la apropiada aplicación de la garantía,
conserve el recibo original de compra fechado como evidencia de compra. Regrese la TV defectuosa al vendedor
junto con su recibo de compra además de todos los accesorios incluídos, como el control remoto. La TV defectuosa
será cambiada por una del mismo modelo, o un modelo equivalente o de igual valor, si es necesario. El reemplazo
de la TV será en contingencia y disponibilidad y a la exclusiva discreción de Sanyo Manufacturing Corporation.
ESTA GARANTÍA ES EXCLUYENTE DE Y EN LUGAR DE TODAS LAS OTRAS GARANTÍAS DE COMERCIALIZACIÓN O USO
PARA UN PROPÓSITO ESPECÍFICO.
OBLIGACIONES
Por un año, desde la fecha de la compra original, Sanyo Manufacturing Corporation (SMC) garantiza esta televisión
de estar libre de defectos de manufactura en materiales y mano de obra bajo condiciones normales de uso. Durante
los primeros 90 días bajo esta garantía para cualquier defecto de manufactura o mal funcionamiento Sanyo
Manufacturing Corporation proveerá una nueva TV vía intercambio con el vendedor.
CÓMO HACER UN RECLAMO BAJO ESTA GARANTÍA.
Por favor llame al 1-800-877-5032. Por favor esté preparado para darnos el número de modelo de la televisión cuando llame. El número de modelo y el número de serie están impresos en la etiqueta agregada en la parte trasera
de la unidad.
Para asistencia al consumidor, llame sin costo al 1-800-877-5032
Esta garantía expresa derechos contractuales específicos; minoristas podrán tener derechos estatutarios
adicionales que pueden variar de estado a estado.
(EFECTIVO: Marzo 1, 2007)
Su HDTV Sanyo es registrada al momento de la compra, por favor guarde su recibo de compra.
Para su protección en caso de robo o pérdida de este producto, por favor llene la siguiente
información requerida y GUÁRDELA en un lugar seguro para su registro personal:
No. de Modelo__________________________
Fecha de compra ___________________________
No. de Serie ____________________________
Precio de compra ___________________________
(Localizado en la parte posterior de la TV)
Lugar de compra ___________________________
Sanyo Manufacturing Corp.
3333 Sanyo Road, Forrest City, AR 72335
¿Necesita ayuda?
www.sanyoctv.com
1-800-877-5032
35
MESURES DE SÉCURITÉ
AVERTISSEMENT: Afin d’éviter les risques
d’incendie ou de choc électrique, n’exposez pas
l’appareil à la pluie ni à l’humidité.
Afin d’éviter les risques de choc électrique,
n’enlevez pas le panneau arrière. L’appareil est
entièrement transistorisé et ne contient aucune
pièce remplaçable ou réparable par l’utilisateur.
En cas de problème, confiez l’appareil à un
réparateur qualifié.
Le téléviseur est muni d’un cordon d’alimentation CA à fiche polarisée dont une lame est plus
large que l’autre. MISE EN GARDE : pour éviter
le risque de choc électrique, faites correspondre
la lame large de la fiche à la fente large de la
prise, puis enfichez à fond. Ceci est une mesure
de sécurité conçue pour ne brancher la fiche que
d’une seule façon sur une prise électrique.
Lorsque vous utilisez le téléviseur avec des jeux
vidéo, ne saturez pas la luminosité ni le contraste.
Avec le temps, ceci pourrait causer l’impression
permanente de l’image du champ de jeu sur
l’écran. Ne placez pas cet appareil sur un chariot,
un support ou une table instable. Il risquerait de
tomber, de s’endommager et d’entraîner de
graves blessures.
Utilisez uniquement un chariot,
une table ou un support
recommandé par le fabricant
ou vendu avec l’appareil. Lors
de son installation, suivez les
instructions du fabricant et utilisez les accessoires d’installation recommandés. Prenez garde
lorsque vous déplacez le téléviseur s’il se trouve
sur un chariot. Des arrêts brutaux, une force
excessive et des surfaces inégales peuvent renverser le chariot et l’appareil.
L’appareil ne doit pas être exposé aux écoulements ou aux éclaboussures et aucun objet ne
contenant de liquide, tel qu’un vase, ne doit être
placé sur l’objet.
La prise du secteur est utilisé pour déconnecter
le système. La prise du secteur ne doit pas être
obstruée ou doit être facilement accessible
pendant son utilisation. Pour être complètement
déconnecté de l’alimentation d’entrée, la prise
doit être débranchée du secteur.
Lisez attentivement le présent manuel et
conservez-le.
INFORMATION FCC
Cet équipement a été testé et déclaré conforme aux limites fixées pour un appareil de Classe B, selon la Partie 15 du
règlement FCC. Ces limites sont destinées à assurer une protection raisonnable contre des interférences nocives
dans une installation résidentielle. Cet équipement génère, utilise et peut irradier une énergie de fréquence radio et
s’il n’est pas installé ou utilisé conformément aux instructions, il peut provoquer des interférences nuisibles aux communications radio. Cependant, il est impossible de garantir qu’aucune interférence ne soit créée suivant le type d’installation. Si cet équipement vient à générer une interférence nuisible à la réception de la radio ou de la télévision,
qui peut être mise en évidence en allumant et en éteignant l’appareil, on recommandera à l’utilisateur d’essayer de
corriger cette interférence au moyen d’une ou plusieurs méthodes :
- en réorientant ou en déplaçant l’antenne réceptrice.
- en augmentant la distance entre l’équipement et le récepteur.
- en connectant l’équipement à une prise d’un circuit électrique différent de celui sur lequel est connecté le récepteur.
- en demandant l’aide d’un vendeur ou d’un technicien de radio et télévision expérimenté.
PRÉCAUTION : Le règlement FCC avertit que des modifications inadéquates ou non autorisées sur cette unité
peuvent annuler l’autorisation de l’utilisateur pour opérer l’unité.
36
Besoin d’aide?
www.sanyoctv.com
1-800-877-5032
MARQUES DE COMMERCE
RÉSOLUTIONS DE PC
Fabriqué sous licence de Dolby Laboratories.
« Dolby » est une marque de commerce de Dolby
Laboratories.
HDMI, le logo HDMI et “High-Definition
Multimedia Interface” sont des marques déposées de HDMI Licensing, LLC
aux États-Unis et dans d’autres pays.
MD
En tant que partenaire d’ENERGY STAR ,
Sanyo Manufacturing Corporation a
déterminé que ce produit répond, pour
son rendement énergétique, aux
MD
normes d’ENERGY STAR .
Ce symbole sur la plaque d’identification indique que le produit est approuvé par Underwriters Laboratories Inc. Il
a été conçu et fabriqué selon les
normes strictes de sécurité UL contre
les risques d’incendie, de blessures et
de chocs électriques.
Fabriqué sous licence de Audyssey
Laboratories. En attendant des
brevets des Etats-Unis et étrangers.
Audyssey Dynamic VolumeTM est une
marque de Audyssey Laboratories.
Cet appareil numérique de la classe B est conforme à la
norme NMB-003 du Canada.
FICHE TECHNIQUE
Alimentation : AC 120V, 60Hz
Consommation :
DP42840 178 watts
DP46840 213 watts
GUIDE V (SURVEILLANCE PARENTALE)
Poids:
18 kg.
20 kg.
Dimensiones:
MODÉLE
DP42840
LARGEUR
sans base
PROFONDEUR
1012
704
653
307
121
1111
779
714
324
121
sans base
DP46840
HAUTEUR
REMARQUE : Cette fonction permet de respecter
la réglementation sur la puce V de la FCC des
États-Unis. Il se peut qu’elle ne fonctionne pas
avec les émissions originaires d’autres pays. CE
téléviseur n’est pas compatible avec le système
d’emission de Guide V canadien, donc, les instructions ne sont pas fournies pour cette fonction.
REMARQUE : toutes les dimensions sont millimètres
(mm).
Besoin d’aide?
www.sanyoctv.com
1-800-877-5032
37
TABLE DES MATIÈRES
MESURES DE SÉCURITÉ . . . . . . . . . . . . . . . . . . . . . . . . . . .36
INFORMATION FCC . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .36
MARQUES DE COMMERCE . . . . . . . . . . . . . . . . . . . . . . . .37
FICHE TECHNIQUE . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .37
RÉSOLUTIONS DE PC . . . . . . . . . . . . . . . . . . . . . . . . . . . . .37
TABLE DES MATIÈRES . . . . . . . . . . . . . . . . . . . . . . . . . . . .38
PRÉCAUTIONS DE MANIEMENT . . . . . . . . . . . . . . . . . . .38
PLACER LA TVHD ACL . . . . . . . . . . . . . . . . . . . . . . . . . . . . .38
ENLEVER LA BASE ET INSTALLER SUR LE MUR . . . . . .39
POUR COMMENCER—
Placez les piles dans la télécommande . . . . . . . . . . .39
Branchement d’antenne aérienne ou câble . . . . . . . .39
CONNECTEURS DU PANNEAU ARRIÈRE . . . . . . . . . . . . .40
BRANCHEMENTS DE AUDIO / VIDEO . . . . . . . . . . . . . . .41
BRANCHEMENT ÉLECTRIQUE . . . . . . . . . . . . . . . . . . . . . .42
RECH. DE CHAÎNES INITIALE . . . . . . . . . . . . . . . . . . . . . .42
UTILISATION DE LA TÉLÉCOMMANDE . . . . . . . . . . . . . .43
FONCTIONNEMENT DU MENU À L'ÉCRAN—
Établir chaînes . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .44
Recherche de chaînes . . . . . . . . . . . . . . . . . . . . . . .44
Memoir de chaînes . . . . . . . . . . . . . . . . . . . . . . . . . .44
Configuration d’entrée . . . . . . . . . . . . . . . . . . . . . . .44
Configuration Vidéo2 . . . . . . . . . . . . . . . . . . . . . . . . .45
Configuration . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .44
Langue du menu . . . . . . . . . . . . . . . . . . . . . . . . . . . . .45
Sous-titrage digital . . . . . . . . . . . . . . . . . . . . . . . . . .45
Économiseur d’énergie . . . . . . . . . . . . . . . . . . . . . . .45
Temporisateur d’horloge . . . . . . . . . . . . . . . . . . . . .46
Capteur de lumiére . . . . . . . . . . . . . . . . . . . . . . . . . .46
Liaison HDMI . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .46
Image . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .47
Réglages manuels de l’image . . . . . . . . . . . . . . . . .47
Son . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .48
aaRéglages manuels du son . . . . . . . . . . . . . . . . . . . .48
LECTEUR DES PHOTOS . . . . . . . . . . . . . . . . . . . . . . . . . . . .49
BRANCHEMENTS ET CONFIGURATION DU PC . . . . . . .50
GARANTIE . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .51
Veuillez lire avant d’utiliser votre HDTV!
PROTECTION DE L’ÉCRAN
D’AFFICHAGE ACL
PRECAUTION: L'écran est susceptible d'être
endommagé
s'il
n'est
pas
entretenu convenablement.
• NE PAS utiliser d'objets durs tels qu'un chiffon
rugueux ou du papier rigide.
• NE PAS appuyer trop fort en nettoyant l'écran
ACL; une pression excessive peut causer une
décoloration permanente ou des taches d'ombre.
• Ne jamais pulvériser de liquides sur l'écran.
PRÉCAUTIONS DE
MANIEMENT
•
•
Manipulez par le coffret seulement.
•
•
Ne touchez jamais l'écran pendant le maniement.
Il est recommandé que le téléviseur soit manipulé par plus de deux personnes.
Les dommages par maniement ne sont pas couverts par la garantie.
“L'Académie Américaine de Pédiatres ne recommande pas à des enfants plus petits de 2 années
de voir télévision.”
CONTIENT DES LAMPES AU
MERCURE, À JETER DE
FAÇON APPROPRIÉE
38
Besoin d’aide?
www.sanyoctv.com
1-800-877-5032
PLACER LA TVHD ACL
• Utilisez
toujours une surface plane et ferme
pour installer votre TVN.
• Ne placez pas le téléviseur dans un endroit trop
exigu.
• Laissez assez d’espace pour assurer une ventilation appropriée.
• Placez vore HDTV hors de la portée des jeunes
enfants pour éviter des accidents.
POUR COMMENCER
PLACEZ LES PILES
Placez les piles dans la télécommande
( 2 “AAA”, non comprises)
Pour un fonctionnement sécuritaire, veuillez
observer les mesures de précaution suivantes :
• Remplacez les deux piles en même temps. N'utilisez
pas une pile neuve avec une pile usagée.
• Il y a risque d’explosion si une pile est remplacée par
un modèle incorrect.
ENLEVER LA BASE ET
INSTALLER SUR LE MUR
• N'exposez pas la télécommande à l'humidité ou à la
chaleur.
(OPTIONAL)
• Les signes “+” et “–” des piles doivent correspondre
á ceux de l’intériur de la télécommande.
Outils requis : tournevis à vis cruciforme
REMARQUE IMPORTANTE:
Placez le téléviseur face en bas sur une
surface matelassée pour protéger l’écran
et le fini de l’appareil.
L’assemblage sur le mur doir être effectué par
une personne avec expérience.
BRANCHEMENT D’ANTENNE
AÉRIENNE OU CÂBLE
Branchez votre antenne ou service de câble, à
l'entrée ANT de votre HDTV en utilisant un
câble coaxial (75 OHM).
REMARQUE: Maintenez votre antenne pour
intérieurs au moins à un mètre de distance de votre
HDTV ou de tout autre appareil électronique.
ANTENNE RF
ENTRÉE D'ANTENNE
ANALOGIQUE ET NUMÉRIQUE
1
Enlevez les quatre (4) vis qui maintiennent la
base de support. PRECAUTION : maintenez
fermement le socle en enlevant la dernière vis.
2
Utilisez les vis que vous venez d’enlever de la
base pour installer le TVN en utilisant un kit
de mur (non fournis.)
CÂBLE
Le syntoniseur de cette TVN peut recevoir:
Norme d'interface VESA: 400 x 400
• Signaux numériques ou analogiques provenant d’une
antenne RF
Dimensions des vis de montage du ACL:
Diamètre M6, longueur—12mm (max.)
• Chaînes analogues que de câblé ClearQAM d'une connexion directe de TV par câble.
Besoin d’aide?
www.sanyoctv.com
1-800-877-5032
39
POUR COMMENCER
CONNECTEURS DU PANNEAU ARRIÈRE
5
1
1 Sortie audio numérique (Coaxial)
2 Entrée composant vidéo (VIDEO2 ou VIDEO3)
Entrées vidéo verte (Y), bleue (Pb) et rouge (Pr) ainsi
que les fiches blanche et rouge de l’audio.
REMARQUE: Vous pouvez utiliser l’entrée VIDEO INPUT2 pour
obtenir une conexion de vidéo Composite, en utilisant l’entré Y
(VIDEO) et L/R Audio. (Voir Configuration Vidéo 2 dans la p. 45).
6
2
7
3 Entrée pour PC et stéréo audio mini
• MONITOR RGB (D-SUB)
• AUDIO R/L (prise stéréo mini)
4 Entrée pour antenne analogique ou numérique
3
5 Entrée S-vidéo (VIDEO1)
REMARQUE: Les connexions S-vidéo remplaceront celles des
8
prises d’entrée Video1 (jaune).
6 Prises audio/vidéo (VIDEO1 Composite)
4
Jaune (vidéo), blanc et rouge (audio).
7 Sorties d'audio analogique (G/D)
8 Entrée USB
9
Voir des photos sauvegardées dans un dispositif USB.
9 Entrée HDMI 1, 2 & 3
Interface complètement numérique qui accepte des
signaux vidéos sans compression pour obtenir la
meilleure qualité d’image possible.
REMARQUE : Un branchement de DVI est possible en utilisant
l’entrée HDMI (DVI) INPUT1 avec un adaptateur approprié et en
utilisant l’entrée VIDEO3 pour l’audio.
Standard définition
Haute définition
Optimal haute
définition
Composite
HDMI
S-Video
Composant
(ou un adaptateur
DVI à HDMI)
REMARQUE: Les branchements de vidéo Composite, S-Vidéo, vidéo Composant et
DVI ont besoin de branchements blanc et rouge pour l’audio.
40
Besoin d’aide?
www.sanyoctv.com
1-800-877-5032
POUR COMMENCER
BRANCHEMENTS DE AUDIO / VIDEO
La Sortie d’Audio Numérique est utilisée pour
se brancher à un récepteur audionumérique en
utilisant un câble d’audio.
L’entrée de vidéo Composite est utilisée pour
brancher des équipements analogiques comme
VCR ou des vieux reproducteurs de DVD.
L’entrée de vidéo Composant accepte des signaux de vidéo SDTV, EDTV et HDTV.
Employez-les pour obtenir une bonne qualité
d'image en utilisant dispositifs numériques.
REMARQUE: Veuillez faire coïncider la couleur des sorties de votre appareil avec les entrées de
votre HDTV.
L’entrée de S-Vidéo peut
branchement de vidéo jaune.
RÉCEPTEUR À
CANAUX MULTIPLES
remplacer
le
VCR
(ou appareil analogique)
LECTEUR DE DVD
(ou autre dispositif)
AMPLIFICATEUR
STÉRÉOPHONIQUE
DVI
Les sorties d'Audio G/D sont utilisés pour
brancher un amplificateur stéréo externe
(ne branchez pas des haut-parleurs
externes directement à la TVHD).
DISPOSITIF
USB
RÉCEPTEUR
SATELLITE
L’entrée USB est utilisée pour
brancher une mémoire de
masse USB pour voir des
photos JPEG.
HDMI (DVI) INPUT1, il peut être utilisé pour
brancher un dispositif DVI avec l'utilisation
d'un adaptateur approprié. Il faut utiliser
l’entrée G/D d’audio à travers le VIDEO3.
(ou autre dispositif)
HDMI INPUT1, 2 & 3 ils sont utilisés pour brancher des dispositifs
numériques HD comme un reproducteur Blu-ray, Câble récepteurs
HD, Satellite récepteurs HD ou
consoles de jeux vidéo.
REMARQUE: Câbles de audio / video
non fournis.
Besoin d’aide?
www.sanyoctv.com
1-800-877-5032
41
POUR COMMENCER
RECH. DE CHAÎNES INITIALE
Avant de continuer, assurez-vous de brancher
correctement votre antenne ou connexion de TV
par câble, et tous les dispositifs à votre HDTV.
BRANCHEZ LE CORDON D’ALIMENTATION CA
120V CA, 60Hz
ALLUMER TV
Suivez les instructions dans l'écran pour configurer le mode Économiseur d'énergie initiale et effectuer la Recherche Initiale de
Chaînes/Signaux.
ÉCRAN INITIAL D'ÉCONOMISEUR
D'ÉNERGIE
CHOISIR OÙ ON VA UTILISER LA HDTV:
Choisissez "Home Mode" en appuyant sur la touche
CH pour établir le niveau de brillant des lampes à un
niveau d'Energy Star, ou choisissez "Store Mode" en
appuyant sur CH pour établir le brillant des lampes à
un niveau pour exposition.
RECHERCHE DE CHAÎNES ET SIGNAUX AV:
Appuyer sur la touche CH pour effectuer
une recherche de chaînes d'une Antenne ou
connexion directe de Câble, et une recherche
de signaux de dispositifs reliés aux entrées
de la HDTV.
ÉCRAN INITIAL DE RECHERCHE DE
CHAÎNES/SIGNAUX
L’ÉCRAN DE’AIDE (OPTIONAL)
Appuyer sur la touche CH si vous souhaitez
accéder à l'écran d'aide.
REMAREQUE: L'écran d'aide est aussi disponible
dans le menu principal.
ÉCRAN DE CONFIGURATION DE CHAÎNE ET SIGNAL
Le dernier écran de configuration montre les canaux
analogues et numériques trouvés, ainsi que les entrées
AV détectées. En appuyant sur la touche CH il finit
le processus de configuration.
ÉCRAN PROGRÈS DE RECHERCHE DE CHAÎNES
REMARQUE: Pour répéter la configuration initiale appuyez
sur la touche VOL
SÉLECTION D'ENTRÉE AV
Appuyer sur la touche INPUT pour choisir l'entrée de vidéo que vous souhaitez voir.
42
Besoin d’aide?
www.sanyoctv.com
1-800-877-5032
ÉCRAN DE LISTE DE CHAÎNES/SIGNAUX
UTILISATION DE LA TÉLÉCOMMANDE
• Touche POWER—Allumer ou éteindre la TV.
• Touche MUTE—Sourdine ou retourner le son.
• Touche ECO—Il modifie le niveau de l'Économiseur d'Énergie. (Voir p. 45)
• Touche RECALL—Changer entre les deux
dernières chaînes choisies.
• Touche AUDIO—Choisir la manière d’audio,
Stéréo, Mono ou SAP (s'il est disponible).
• Touche DYN VOL—Il modifie les valeurs de la
fonction Dynamic Volume.
• Touche ON TIMER—Montrer la fonction d'allumage. (Voir p. 46)
• Touche CAPTION—Changer entre les différentes
manières de sous-titrage.
• Touche RESET—Appuyer deux fois pour
retourner la TV aux valeurs de fabrique.
Toutes les modifications effectuées par l'utilisateur, seront éliminées.
• Touche SLEEP—Il montre le temporisateur
d'éteint. Tandis qu'on montre le temporisateur
d'éteint sur l'écran, appuyer sur la touche "0"
pour établir le temps de d'éteint automatique de
la HDTV (intervalles de 30 minutes).
• Touche PICTURE—Changer entre les différentes
manières d’image.
• Touche SOUND—Changer entre les différentes
manières de son.
• Touches NUMÉRICAS—Entrer
directement.
une
chaîne
REMARQUE: Pour des chaînes 100 et supérieures,
maintenir appuyée sur la touche numérique, et puis,
entrer les autres deux nombres.
• Touche – (sub ch)—Il permet de choisir directement une chaîne ou subchaîne numérique. Par
exemple: pour choisir le canal 39.1, appuyer sur
la touche 3, 9, –, et 1.
• Touche INPUT—Choisir l’entrée de vidéo.
Maintenez enfoncée la touche, pour montrer le
menu d'entrées.
• Touche de volume VOL+
réduire le niveau d’audio.
–
—Augmenter ou
• Touche USB—Il choisit l'entrée USB directement.
• Touche PIX SHAPE—Changer entre les différentes manières d’aspect ratio. Les différentes
configurations étirent, agrandissent out remplissent l'image sur l'écran. On peut apparaitre
des barres dans la partie supérieure et
inférieure de l'écran, out aus cotés gauche
et droit, en dédpendant du signal ou le programme transmis.
REMARQUE: Les Pix 6-7 sont configurè comment
Pix1-2 dans le mode PC. On ne recommande pas díutiliser Pix 6-7 dans le mode TV.
• Touche MENU—Montrer le menu dans l’écran.
• Touche HELP—Montrer l’écran d'aide.
• Touche INFO—Montrer l’information de la
chaîne.
• Touche EXIT—Sortir du menu.
• Touches Cursor (en haut) (vers le bas)—
Déplacer le curseur en haut et vers le bas dans
les menus.
• Touches Cursor (gauche) (droite)—Déplacer
le curseur gauche et droite dans les menus.
• Touche ENTER—Exécuter l'option choisie.
Les touches PLAY, PAUSE, STOP, REW, FF, W, T,
CAMERA et XACTI MENU, contrôlent des fonctions d'un appareil photo numérique Xacti Sanyo,
en habilitant la fonction HDMI-CEC de la HDTV et
de l'appareil photo numérique (voir Liaison HDMI
dans la p. 46)
• Touches de chaîne CH —Se déplacer entre
les chaînes sauvegardées dans la mémoire.
Besoin d’aide?
www.sanyoctv.com
1-800-877-5032
43
FONCTIONNEMENT DU MENU À L'ÉCRAN
ÉTABLIR CHAÎNES
Montre le Menu dans l’écran et utilise les
touches CURSEUR pour choisir Établir
chaînes. Appuyez sur ENTER.
Recherche de chaînes
Auto – Recherche la manière détectée, le câble ou l'air.
Câble – Recherche les chaînes analogiques et
numériques de câble déchiffrées (ClearQAM).
Aérienne (Antenne) – Recherche les chaînes analogiques et numériques d'air.
Ajouter numérique – Recherche les chaînes
numériques d'air et ajoute à la base de données les
nouvelles chaînes numériques trouvées.
ÉCRAN DE MENU PRINCIPAL
REMARQUE : L'option d'Ajouter numérique ne sera pas
disponible si la manière actuelle est de câble.
Mémoire de chaînes
La Mémoire de Chaînes liste toutes les chaînes
analogiques et numériques trouvées. Liste aussi les
chaînes analogiques qui n'ont pas été trouvées,
lesquelles peuvent être ajoutées.
ÉCRAN DE AJUSTEMENT DE CHAÎNES
Utilisez le CURSEUR pour déplacer la barre de sélection par tous les chaînes habilitées et déshabilitées, ou
utilisez la touche CH pour sauter les déshabilitées.
Appuyer sur ENTER pour habiliter ou déshabiliter le
canal choisi.
REMARQUE : pour s’informer sur les chaînes numériques
locales, visitez le site www.antennaweb.org
INFO. IMPORTANTE: ce téléviseur ne conserve qu’une seule base de
données des chaînes numériques. Lorsque vous recherchez des
chaînes numériques de câble, la base de données de chaînes
numériques par antenne sera donc effacée. Vous ne pourrez recevoir
que les chaînes ClearQAM fournis par votre câblodiffuseur.
ÉCRAN DE MÉMOIRE DES CHAÎNES
Configuration d’entrée
Cette fonction permet de supprimer les entrées AV non
utilisées du cycle d'entrées (INPUT).
Utilisez le CURSEUR pour choisir une entrée AV.
Appuyer sur ENTER pour habiliter (marquer) ou déshabiliter (démarquer) l'entrée choisie.
REMARQUE: Au moins une entrée doit être habilitée.
:Sauter est seulement pour référence.
44
Besoin d’aide?
www.sanyoctv.com
ÉCRAN DE CONFIGURATION D’ENTRÉE
1-800-877-5032
FONCTIONNEMENT DU MENU À L'ÉCRAN
Configuration Vidéo 2
Utilisez cette fonction pour établir une connexion de
vidéo Composite ou Composant dans l’entrée VIDEO
INPUT2 de votre HDTV.
Utilisez les CURSEUR pour choisir le type de connexion qui sera utilisé dans l'entrée Video2.
Appuyer sur ENTER, il apparaîtra une marque bleue à
côté de l'option choisie.
ÉCRAN DE CONFIGURATION VIDÉO2
CONFIGURATIÓN _____________
Montre le Menu dans l’écran et utilise les
touches CURSEUR pour choisir
Configuration. Appuyez sur ENTER.
Langue du menu
Choisit la langue entre Anglais, Espagnol et Français
pour le Menu en écran.
Appuyer sur ENTER pour choisir la langue souhaitée.
ÉCRAN DE LANGUE DU MENU
Sous-titrage digital
Le sous-titrage est l'information textuelle cachée transmise avec l'image et le son. Si le sous-titrage est activé,
(appuyer sur la touche CAPTION tandis que vous voyez
la télé), la TV ouvre ces sous-titres (numériques ou
analogiques) et les superpose à l'écran.
REMARQUE: Les diffuseurs locaux décident quels sous-titres
transmettre.
Utilisez les CURSEUR et < > pour modifier la police,
le fond et le premier plan des sous-titres numériques.
ÉCRAN DE SOUS-TITRAGE DIGITAL
Économiseur d’énergie
Le réglage de l’économiseur d'énergie contrôle l’éclat
des lampes du panneau pour réduire la consommation
de la puissance.
• Niveau 1: Économiseur d'énergie éteint.
• Niveau 2: Consommation d'énergie basse.
• Niveau 3: Consommation d'énergie plus basse.
Appuyer sur ENTER pour choisir le niveau souhaité.
Besoin d’aide?
ÉCRAN DE ÉCONOMISEUR D’ÉNERGIE
www.sanyoctv.com
1-800-877-5032
45
FONCTIONNEMENT DU MENU À L'ÉCRAN
CONFIGURATION _____________
Temporisateur d'horloge
Configurez l'Heure actuelle de votre TVHD. Établissez le
Heure d’allumer à utiliser avec la Fonction d’allumer.
Quand la Fonction d'allumer soit habilitée, la TV s’allumera automatiquement à l'heure fixée préalablement.
ÉCRAN DE TEMPORISATEUR D’HORLOGE
Capteur de lumiére
Cette fonction détecte l'intensité de lumière d’ambiance de la chambre et contrôle les paramètres de
luminosité et d’image pour réduire la consommation
d'énergie de la TV.
REMARQUE: Quand la chambre soit foncée, la luminosité du
panneau et/ou les paramètres d’image comme
la luminosité et le contraste seront réduits.
Liaison HDMI
ÉCRAN DE CAPTEUR DE LUMIÉRE
REMARQUE: Il est conçu pour être utilisé avec un appareil
photo numérique Xacti de vidéo/film. Quelques fonctions de
HDMI-CEC ne sont pas supportées par d'autres équipements.
Utilisez la Fonction HDMI-CEC pour activer et désactiver les fonctions CEC disponibles.
L’Allumage par HDMI et l’Éteint par HDMI activent des
fonctions spécifiques comme le processus automatique d'allumage et éteint.
Xacti-LINK
ÉCRAN DE LIAISON HDMI
Si vous avez un appareil photo
numérique Xacti de vidéo/film branché
à l'entrée HDMI de la TVHD, vous pouvez activer la Fonction HDMI-CEC pour
le contrôler en utilisant la télécommande GXEA.
REMARQUE: La fonction HDMI-CEC doit être allumée aussi
sur l’appareil photo numérique Xacti et établir
ainsi le Xacti-Link.
46
Besoin d’aide?
www.sanyoctv.com
1-800-877-5032
FONCTIONNEMENT DU MENU À L'ÉCRAN
IMAGE
Montre le Menu dans l’écran et utilise les
touches CURSEUR pour choisir Image.
Appuyer sur ENTER.
Vous pouvez choisir entre Vivant, Doux, et Normal,
lesquels ont des valeurs prédéterminées pour l'image.
Ou, on peut choisir l’option manuel avec des valeurs
personnalisées.
ÉCRAN DE MENU PRINCIPAL
REMARQUE : Chaque entrée AV peut avoir son propre mode
d'image (prédéterminé ou manuel). Un marqueur bleu
indique l'option actuellement choisie.
RÉGLAGES MANUELS DE L’IMAGE
Paramètres d'ajustement Manuel:
• Couleur
• Teinte
• Contraste
• Luminosité
• Netteté
• Contraste Dynamique
L'option de Configuration Détaillée permet d'ajuster 7
paramètres additionnels comme:
• Balance du signal
• Reduction du bruit
• Balance du blanc
• Renforceur des bords
• Taille-V
ÉCRAN DE IMAGE (MANUEL)
• Netteté vertical
• Taille-H
REMARQUE: L'option de valeurs par défaut d'image retourne
tous les paramètres à ses niveaux de fabrique.
AJUSTEMENT DE PARAMÈTRES D’IMAGE
Utilisez les touches de CURSEUR pour choisir le
paramèmtre à ajuster. Appuyez sur la touche ENTER pur
voir l’écran d’ajustements. Modifiez les valeurs du
paramètre en utilizant les touches de CURSOR .
ÉCRAN SÉLECTION DE PARAMÈTRES
REMARQUE : Les touches CURSEUR choisissent
le paramètre suivant/précédent sans
retourner à l’écran du menu précédent.
Si vous avez fini les ajustements, appuyez sur la
touche EXIT pour sortir du menu.
ÉCRAN EXEMPLES D'AJUSTEMENTS DE VALEUR
Besoin d’aide?
www.sanyoctv.com
1-800-877-5032
47
FONCTIONNEMENT DU MENU À L'ÉCRAN
SON
Montre le Menu dans l’écran et utilise les
touches CURSEUR pour choisir Son.
Appuyer sur ENTER.
Choisit une des deux options disponibles pour l'ajustement du son.
Auto – Les valeurs de son sont ajustées et associées
avec le mode actuel d'Image.
ÉCRAN DE MENU PRINCIPAL
Standard – Les paramètres prédéterminés de son ne
sont pas associés avec les options d'image.
RÉGLAGES MANUELS DU SON
Paramètres d'ajustement Manuel:
• Bas et Aigus
• Bass Extension
• Audyssey Dynamic Volume 1
• Ajustement en détail
– Égaliseur á 4-Bandes: Utilise un Égaliseur á 4Bandes pour personnaliser les ajustements de son.
ÉCRAN PARAMÈTRES MANUELS
REMARQUE: L'option de valeurs par défaut d'image retourne
tous les paramètres à ses niveaux de fabrique.
AJUSTEMENT DE PARAMÈTRES DE SON
Utilisez les touches de CURSEUR pour choisir le
paramèmtre à ajuster. Appuyez sur la touche ENTER pur
voir l’écran d’ajustements. Modifiez les valeurs du
paramètre en utilizant les touches de CURSOR .
REMARQUE : Les touches CURSEUR choisissent le
paramètre suivant/précédent sans retourner à
l’écran du menu précédent.
ÉCRAN PARAMÈTRES MANUELS AVANCÉS
Si vous avez fini les ajustements, appuyez sur la
touche EXIT pour sortir du menu.
1 Audyssey Dynamic Volume résout le problème de différences
marquées dans le volume entre des programmes de TV,
annonces et entre les sections de haut et sous volume d'un
film. Audyssey Dynamic EQ est intégré avec Dynamic Volume
pour adapter le volume automatiquement, et la perception de
réponse basse, la balance, impression Surround et la clarté de
dialogue reste égal.
48
Besoin d’aide?
www.sanyoctv.com
ÉCRAN EXEMPLES D'AJUSTEMENTS DE VALEUR
1-800-877-5032
ENTRÉE USB
LECTEUR DES PHOTOS
Voir des photos sur la TVHD en utilisant un dispositif
de mémoire de masse USB.
DISPOSITIF
USB
ÉCRAN VU MINIATURE
REMARQUE: La télé changera à
l'entrée USB, quand
elle détecte un dispositif USB relié.
REMARQUE: Une icône de vu miniature apparaîtra si la photo ne peut pas être
décodée ou si n'existent pas des
données de vue miniature.
UTILISATION DU LECTEUR DE PHOTOS
Appuyez sur ENTER sur le vu miniature de la photo
pour habiliter les fonctions de Tourner, Vu complète et
Voir présentation.
En étant sur le Vu complète :
Utilisez les touches CURSEUR pour changer de
photo.
Appuyez sur ENTER pour montrer le menu avec les
options de vu complète.
AJUSTEMENT PRÉSENTATION
Dans le menu d'ajustements de Présentation vous pouvez activer les fonctions d'Aléatoire et Changement
rapide.
MENU D'OPTIONS
DE VU COMPLÈTE
AJUSTEMENTS
COMMENCER LA
PRÉSENTATION
Appuyez sur ENTER sur Voir présentation depuis
l'écran de vu miniature ou depuis le menu d'options de
vue complète, pour commencer la présentation depuis
la photo choisie.
MENU DU REPRODUCTEUR
Pour montrer le menu USB, appuyez sur MENU en
étant sur Vu complète ou Voir présentation.
Ajustement Image – Ajustement Couleur, Teinte,
Contraste,
Luminosité,
Netteté
et
Contraste
dynamique.
REMARQUE: Les ajustements d'image sont indépendants des
ajustements des entrées TV et AV.
Besoin d’aide?
ÉCRAN DE MENU PRINCIPAL DE USB
www.sanyoctv.com
1-800-877-5032
49
BRANCHEMENTS ET CONFIGURATION DU PC
On peut utiliser votre TV HD comme un moniteur
d’ordinateur. Branchez l’ordinateur et le téléviseur
en utilisant un câble de moniteur approprié.
Avant de brancher le moindre câble,
débranchez les prises de courant du Téléviseur
TVN et de l’ordinateur.
Allumez le TVN et tout autre appareil externe
avant d’allumer l’ordinateur.
Pour éviter un état “Hors limite”, s'il vous plait,
changez la résolution de votre PC à une compatible
avec votre TVHD.
REMARQUE : Si l’ordinateur a seulement une sortie
DVI, un adaptateur DVI à RGB sera nécessaire. (adapta-
Configuration du PC
Auto-ajustement – Ajuste automatiquement la
position d'image, le dot clock et la phase.
Dot Clock – Ajustez la fréquence de balayage
pour la synchroniser à celle du PC.
Phase – Réglez la phase lorsque l’image devient
floue ou tremblante.
Position H – Déplace l’image horizontalement
Position V – Déplace l’image verticalement
Economie d’energie – Permet à la TVHD de se
tourner au mode d’attente quand l'ordinateur est
non utilisable.
teur non fournis)
BARRIÉRE DE LA TVN
SORTIE RGB
SORTIE DVI
Câble audio
stéreo mini
ÉCRAN DE CONFIGURATION DU PC
PC OU LAPTOP
Câble RGB
Sanyo recommande d’utiliser un câble RGB avec
de ferrite.
Écran PC portable
Si vous utilisez votre TV HD Sanyo pour voir l’image d’un PC portable, il faut d’appuyer sur la
touche Fn (ou FN) plus la touche de la fonction
appropriée (F5, F7, F8, etc.) dans le portable. Ceci
va faire changer entre les différentes manières de
montrer l’image du portable.
PC Image et Son
Standard – Charge les valeurs prédéterminées
d’Image et Son.
Manuel – Ajuste le Contraste, Luminosité et
Température de couleur de l'écran, ou Bas et
Aigus de la TVHD.
Les manières de montrer l’image dans le portable
peuvent être : image sur le PC portable, image sur
le PC portable plus la TV HD ou, image sur la TV HD.
Maintenez
et appuyez sur
REMARQUE: Les symboles des touches Fn et de la fonction dans le clavier du PC portable, peuvent varier entre une marque et une autre.
50
Besoin d’aide?
www.sanyoctv.com
ÉCRANS DE PC IMAGE ET SON (MANUEL)
REMARQUE : Ces arrangements n'affectent pas la vision
normale de la TV
1-800-877-5032
GARANTIE LIMITÉE D'UN AN POUR PIÈCE ET MAIN-D' ŒUVRE
CETTE GARANTIE LIMITÉE POUR PIÈCE ET MAIN-D'UVRE N'EST VALABLE QUE SUR LES TÉLÉVISEURS SANYO ACHETÉS ET
UTILISÉS AUX ÉTATS-UNIS D'AMÉRIQUE, AU CANADA, ET À PORTO RICO, À L'EXCLUSION DE TOUT AUTRE TERRITOIRE ET
PROTECTORAT DES ÉTATS-UNIS D'AMÉRIQUE.
CETTE GARANTIE LIMITÉE NE S'APPLIQUE QU'AU PREMIER ACHETEUR; ELLE NE S'APPLIQUE PAS AUX PRODUITS
UTILISÉS À DES FINS INDUSTRIELLES OU COMMERCIALES.
APPLICATION DE LA GARANTIE
PENDANT UN AN à compter de la date d'achat chez le revendeur d'origine, Sanyo Manufacturing Corporation (SMC)
garantit que ce téléviseur est exempt de tout défaut de pièce et main-d'œuvre dans des conditions d'utilisation normale, tant
pour les pièces que pour la main-d'œuvre.
Pendant les 90 PREMIERS JOURS à compter de la date d'achat chez le revendeur d'origine, Sanyo Manufacturing
Corporation remplacera tout téléviseur présentant des défauts par un échange chez le détaillant. Pour assurer une application correcte de la garantie, veuillez conserver l'original du reçu de vente faisant apparaître la date, comme preuve
d'achat. Retournez le téléviseur défectueux au détaillant accompagné du reçu et de tous les accessoires inclus, tels que
la télécommande. Le téléviseur défectueux sera échangé contre un appareil du même modèle ou d'un modèle de remplacement d'une valeur égale, s'il y a lieu. Le modèle de remplacement dépendra de la disponibilité, à la seule discrétion de
Sanyo Manufacturing Corporation.
LA GARANTIE EXPOSÉE AUX PRÉSENTES EST EXCLUSIVE EST REMPLACE TOUTE AUTRE GARANTIE DE QUALITÉ
MARCHANDE OU ADAPTÉE À UN BUT PARTICULIER.
OBLIGATIONS
Pendant un an à compter de la date d'achat, Sanyo Manufacturing Corporation (SMC) garantit que ce téléviseur est exempt
de tout défaut de pièce et main-d'œuvre dans des conditions d'utilisation normale. Au titre de cette garantie et au cours des
90 premiers jours, Sanyo Manufacturing Corporation fournira un nouveau téléviseur par un échange chez le détaillant pour
tout défaut ou dysfonctionnement.
COMMENT BÉNÉFICIER DE CETTE GARANTIE
Veuillez appeler le 1-800-877-5032. Munissez-vous du numéro de modèle du téléviseur et de son numéro de série lorsque
vous nous appelez. Les numéros de modèle et de série sont imprimés sur une étiquette figurant au dos de l'appareil.
Pour attention au client, appelez gratuitement à 1-800-877-5032
Cette garantie expose des droits contractuels spécifiques; les acheteurs au détail peuvent bénéficier de droits statutaires
qui varient d'un État ou d'une province à l'autre.
(Date d'entrée en vigueur : le 1er mars 2007)
Votre TVHD Sanyo est enregistré au moment de l’achat, svp gardez votre reçu d’achat.
À titre de protection en cas de vol ou de perte de ce produit, veuillez indiquer ci-dessous les renseignements demandés et GARDER CETTE FEUILLE EN LIEU SÛR, AVEC VOS PAPIERS PERSONNELS.
No de modèle ________________________________
Date d’achat ___________________________
No de série _________________________________
Prix d’achat ___________________________
(Indiqué à l’arrière de l’appareil)
Lieu d’achat ___________________________
Sanyo Manufacturing Corp.
3333 Sanyo Road, Forrest City, AR 72335
Besoin d’aide?
www.sanyoctv.com
1-800-877-5032
51
Frost-Free
Refrigerator/Freezer
Frost-Free
Réfrigérateur/
Congélateur
Frost-Free
Refrigerador/
Congelador
User Manual
Guide de l’Utilisateur
Manual del Usuario Modelo
HA10TG20S
English
GENERAL SAFETY RULES
WARNING: R
ead all of the instructions before using this appliance. When using this appliance, always exercise
basic safety precautions, including the following:
NOTE: If the refrigerator has been placed in a horizontal or tilted
position for any period of time wait 24 hours before
plugging the unit in.
1) U
se this appliance only for its intended purpose as described in this use
and care guide.
2) T his refrigerator must be properly installed in accordance with the
installation instructions before it is used. See grounding instructions in
the installation section.
3) T his refrigerator should not be recessed or built-in an enclosed cabinet.
It is designed for freestanding installation only.
4) N
ever unplug your refrigerator by pulling on the power cord. Always
grasp the plug firmly and pull straight out from the outlet.
5) R
epair or replace immediately, all electric service cords that have
become frayed or otherwise damaged. Do not use a cord that shows
cracks or abrasion damage along its length, the plug or the connector
end.
6) If your old refrigerator is not being used, we recommend that you
remove the doors. This will reduce the possibility of danger to children.
7) WARNING: After your refrigerator is in operation, do not
touch the cold surfaces in the freezer compartment, particularly when hands are damp or wet.
Skin may adhere to these extremely cold surfaces.
8) D
o not refreeze foods, which have been thawed completely. The United
States Department of Agriculture in Home and Garden Bulletin No. 69
reads: "…You may safely refreeze frozen foods that have thawed if
they still contain ice crystals or if they are still cold-below 40°F".
"…Thawed ground meats, poultry, or fish that have any off-odor or offcolor should not be refrozen and should not be eaten. Thawed ice
cream should be discarded. If the odor or color of any food is poor or questionable, discard it. The food may be dangerous to eat."
"…Even partial thawing and re-freezing reduce the eating quality of foods, particularly fruits, vegetables, and prepared foods. The eating quality of red meats is affected less than that of many other foods. Use refrozen foods as soon as possible, to save as much of they’re eating quality as you can."
1
English
9) Do not use any electrical device or any sharp instrument in defrosting your refrigerator.
10) Unplug your refrigerator before cleaning or before making any repairs.
Note: If for any reason this product requires service, we strongly recom
mend that a certified technician perform service.
11) Do not operate your refrigerator in the presence of explosive fumes.
SAVE THESE INSTRUCTIONS
DANGER
Risk of child entrapment. Before you throw away your old
refrigerator or freezer, take off the doors. Leave the shelves
in place so that children may not easily climb inside.
Staple your receipt to your manual.
You will need it to obtain warranty service.
2
English
Parts And Features
1
2
16
10
8
3
9
12
13
11
7
6
14
15
5
4
17
(Features may vary per model)
1. Ice Cube Trays
9. Interior Light
2. Full-Width Freezer Door Shelves
10.Freezer Shelf
3. Full-Width Door Shelf
11. Gallon Storage Compartment
4. Adjustable Front Leveling Legs
(not shown)
12. Can Storage
5. Clear Crisper
6. Clear Glass Crisper Cover
14. H
alf-Width Shelf, 2 Liter Bottle
Storage Compartment
7. Full-Width Glass Shelves
15. Crisper Humidity Control
8. Adjustable Temperature Control
16. Air Flow Control
13. 1/2 Width Shelf
17. Rear Casters (not shown)
3
English
Installing Your Refrigerator
Unpacking Your Refrigerator
1. Remove
all packaging material. This includes the foam base and all
adhesive tape holding the refrigerator accessories inside and outside.
2. Inspect and remove any remains of packing, tape or printed materials
before powering on the refrigerator.
Leveling Your Refrigerator
•Y
our refrigerator has two leveling legs which are located in the front
bottom corners of your refrigerator. After properly placing your
refrigerator in its final position, you can level your refrigerator.
• Leveling legs can be adjusted by turning them counterclockwise to
raise your refrigerator or by turning them clockwise to lower your
refrigerator. The refrigerator door will close easier when the leveling
legs are extended.
Proper Air Circulation
• T o ensure your refrigerator works at the maximum efficiency it was
designed for, you should install it in a location where there is proper
air circulation, plumbing and electrical connections.
• The following are recommended clearances around the refrigerator:
Sides……………3/4" (19mm)
Top....................2" (50mm)
Back..................2" (50mm)
4
English
WARNING: ELECTRICAL REQUIREMENT - SHOCK HAZARD
Electrical Requirement
•M
ake sure there is a suitable power outlet (120 volts, 15 amps outlet)
with proper grounding to power the refrigerator.
• Avoid the use of three prong adapters or cutting off the third
grounding prong in order to accommodate a two prong outlet. This is
a dangerous practice since it provides no effective grounding for the
refrigerator and may result in shock hazard.
WARNING: USE OF EXTENSION CORDS- POTENTIAL SAFETY HAZARD
Use of Extension Cords
•A
void the use of an extension cord because of potential safety hazards
under certain conditions. If it is necessary to use an extension cord,
use only a 3-wire extension cord that has a 3-blade grounding plug
and a 3-slot outlet that will accept the plug. The marked rating of the
extension cord must be equal to or greater than the electrical rating of
the appliance. DO NOT USE EXTENSION CORD LONGER THAN
12 FT.
Installation Limitations
•D
o not install your refrigerator in any location not properly insulated or
heated, e.g. garage, etc. Your refrigerator was not designed to operate
in temperature settings below 55˚ Fahrenheit.
• Select a suitable location for the refrigerator on a hard even surface
away from direct sunlight or heat source, e.g. radiators, baseboard
heaters, cooking appliances, etc. Any floor unevenness should be
corrected with the leveling legs located on the front bottom corners of
the refrigerator.
5
English
Door Alignment
Freezer Door: (see fig. # 1)
1.
2.
3.
4.
5.
Remove hinge cover screw.
Remove the top hinge cover.
Loosen the top hinge screws using a Phillips head screwdriver.
Adjust the door or put a spacer in between and then tighten the screws.
Replace the top hinge cover.
Hinge
cover
fig. # 1
Top hinge
Reversing the Door Swing
Left/right door opening method:
T his product allows you to reverse the door opening from left to right and
back. You can select your preference of door opening by following the
procedure to make the change.
Dismantling: (see fig. # 1 and fig. # 2)
1. Affix refrigerator and freezer door by sticking adhesive tape on both
sides to hold doors in place.
2. As shown in fig. 1, dismantle the hinge cover on the upper part of
freezer door with a Phillips head screwdriver. Then remove the three
screws that hold the hinge. Take out the hinge by pulling it vertically,
and keep it in a safe place.
3. Remove the adhesive tape on freezer door, lift it and take off the door,
and carefully put it aside.
4. Dismantle two screws of the central hinge, lift it and take off the central
hinge, and keep them in a safe place. (see fig # 2)
5. Remove the adhesive tape on refrigerator door, lift it and take
refrigerator door, and carefully put it aside.
6. Remove the doorstoppers from the refrigerator and freezer doors.
7. Insert left side doorstopper (provided in your packing) on the left side
bottom hole of the refrigerator door and on the left side bottom hole of
the freezer door. Fasten with screws provided.
6
English
screw holes
doorstopper (right side)
fig. # 2
middle pivot pin
central hinge
Reinstallation: (see fig. # 3 and fig. # 4)
1. Remove the lower pivot pin from the lower hinge by turning counter
clockwise. Move the pin to the opposite hole and tighten. (see below)
fig. # 3
bottom of unit
lower pivot pin
bottom hinge
2. Tilt refrigerator on a 45-degree angle to have access to the
bottom front.
CAUTION: Two People Required.
7
English
3. Remove both left and right front feet from bottom.
4. Loosen the screws holding the bottom hinge
and remove it.
5. Align the holes in the bottom hinge to the corresponding holes on the
opposite side of the cabinet. Insert and tighten the screws. Reinstall both
front feet.
6. To install refrigerator door: Line up the left bottom hole of the
refrigerator compartment door over the bottom hinge pin. Move
door forward to make it straight and align with central hinge.
Install the central hinge again, and turn the hinge axle until it
completely enters the door body. Secure it with the screws provided.
(see fig. 4)
NOTE: Remove plugs from doorframe and install on other side.
doorstopper (left side)
screw holes
fig. # 4
middle pivot pin
central hinge
7. To install freezer door: Lineup left bottom hole of the door over the
central hinge middle pin. Move door forward to make it straight
and align with freezer compartment. Place over left side the top hinge,
align holes with hole on the refrigerator top and tighten with the
screws provided.
8
English
Refrigerator Features And Use
General Features
Freezer Section
Adjustable temperature dial:
Your freezer compartment is equipped
with adjustable airflow control. For
your convenience, airflow is preset by
the factory to the colder setting. There
is also an option to adjust the settings,
either to cold or to coldest.
Your refrigerator will automatically
maintain the temperature level you
select. The temperature control dial has
7 settings plus OFF. 1 is the warmest. 7
is the coldest. Turning the dial to OFF
stops cooling in both the refrigeration
and freezer sections. At first, set the
dial to 4 and allow 24 hours to pass
before adjusting the temperature to your
needs.
To adjust the temperature range in the
cold setting, turn the temperature dial in
a clockwise direction. For normal
operating conditions, keep the dial
halfway between cold and coldest. For
your convenience, the factory presets the
control at normal operating conditions.
(Note: If the refrigerator has
been placed in a horizontal or
tilted position for any period
of time wait 24 hours before
plugging the unit in.)
Refrigerator Section
Interior Light:
Your refrigerator is equipped with an
interior light in the fresh food section for
you to easily locate your food.
Your refrigerator may be equipped with
slide control to raise or lower the
humidity levels or your crispers. This
feature will increase the storage life of
your fruits and vegetables. Simply adjust
the controls to the appropriate setting
for setting for items you are storing in
the crispers. Low settings allow moist air
to exit the crisper, for optimum storage
of fruit and/or vegetables that have
skins. High settings retains moist air in
the crisper, for optimum storage of fresh
vegetables.
Frost- Free Refrigerator-Freezer
Never need to defrost your freezer, as it automatically defrosts
any ice build up that may occur.
9
English
Refrigerator Interior Shelves
(Shelves May vary by Model)
The refrigerator shelves of your refrigerator were designed with you
in mind. Their varied adjustability allows you to satisfy your personal
storage needs.
To remove or adjust a full-width
slide-out shelf: (see fig. # 5)
1. Gently tilt the shelf up and slide forward until the shelf has been
completely removed.
2. To replace the shelf, select the desired setting and gently slide the
shelf back until it rests in the locking position.
fig. # 5
Crisper and Crisper Cover
To remove and install the crisper: (see fig. # 6)
1. Grip the crisper firmly and slide out completely.
2. Replace the crisper by placing the crisper properly in position and
gently sliding it back into place.
fig. # 6
Removing or replacing the crisper cover: (see fig. # 7)
1. Carefully grasp the crisper cover and slide out to remove.
fig. # 7
2. To replace, slide the rear of the crisper cover into the right and
left slots above the crisper area and gently slide back into place.
10
English
Food Storage Information
Fresh Food:
•W
hen storing fresh food, which is not prepackaged, be sure to wrap
or store food in airtight and moisture proof material unless otherwise
noted. This will ensure proper shelf life and prevent the transfer of odors
and tastes.
• Wipe containers before storing to avoid needless spills.
•E
ggs should be stored in an upright position in their original carton to
maximize shelf life.
• F ruit should be washed and dried then stored in a crisper set for low
humidity. If you do not have humidity controlled crisper place the items
in sealed plastic bags before storing in the crisper.
•V
egetables with skins should be stored in plastic bags or containers and
stored in crisper with low humidity setting.
• L eafy vegetables should be washed and drained and then stored in
plastic bags or containers in crisper with high humidity setting.
•H
ot food should be allowed to cool before storing in the refrigerator.
This will prevent unnecessary energy use.
• Fresh seafood should be used the same day as purchased.
•W
hen storing meats in the fresh food section, keep in the original
packaging or rewrap as necessary. Follow the suggestions below for
safe storage:
These are some suggestions for safe storage:
•
•
•
•
•
Chicken
Ground Beef
Cold Cuts
Steaks/Roasts
Smoked/Cured Meats
1-2 Days
1-2 Days
3-5 Days
3-5 Days
7-10 Days
For detailed storage chart visit FDA website:
www.cfsan.fda.gov/~dms/fttstore.html
11
English
Frozen Food
• Wipe containers before storing to avoid needless spills.
•H
ot food should be allowed to cool before storing in the freezer. This
will prevent unnecessary energy use.
•W
hen storing meats, keep in the original packaging or rewrap as necessary.
• P roper freezer storage requires correct packaging. All foods must be
in packages, which do not allow the flow of air or moisture in, or out.
Improper storage will result in odor and taste transfer and will result in
the drying out of the improperly packaged food.
• Follow package or container instructions for proper storage.
• Packaging Recommendations:
Plastic containers with air tight lids
Heavy duty aluminum foil
Plastic wrap made from saran film
Self-sealing plastic bags
• Do not refreeze defrosted/thawed foods.
• It is recommended that the freezing date be marked on the packaging.
These are some suggestions for safe storage:
• TV Dinners
3 - 4 Months
• Fresh Shrimp, scallops, crawfish
3 - 6 Months
• Hamburger & stew meats
3 - 4 Months
• Ground Turkey, veal, pork
3 - 4 Months
• Chops
4 - 6 Months
• Steaks
6 - 12 Months
• Chicken or turkey, whole
1 year
For detailed storage chart visit FDA website: www.cfsan.fda.gov/~dms/
fttstore.html
Normal Operating Sounds You May Hear
•B
oiling water, gurgling sounds or slight vibrations that are the result of
the refrigerant circulating through the cooling coils.
• The thermostat control will click when it cycles on and off.
12
English
Proper Refrigerator Care and Cleaning
Cleaning and Maintenance
Warning: To avoid electric shock always unplug your
r efrigerator before cleaning. Ignoring this warning
may result in death or injury.
Caution: Before using cleaning products, always read and
General:
follow manufacturer’s instructions and warnings to
avoid personal injury or product damage.
•Prepare a cleaning solution of 3-4 tablespoons of
baking soda mixed with warm water. Use sponge or
soft cloth, dampened with the cleaning
solution, to wipe down your refrigerator.
• Rinse with clean warm water and dry with a soft cloth.
• Do not use harsh chemicals, abrasives, ammonia,
chlorine bleach,concentrated detergents, solvents or
metal scouring pads. Some of these chemicals may
dissolve, damage and/or discolor your
refrigerator.
Door Gaskets:
•C
lean door gaskets every three months according to
general instructions. Gaskets must be kept clean and
pliable to ensure a proper seal.
•Petroleum jelly applied lightly on the hinge side of
gaskets will keep the gasket pliable and ensure a good
seal.
We recommend that you clean the rear of the refrigerator at least twice a year.
Some operating
environments may require more frequent cleaning.
•S
lowly pull the refrigerator straight out away from the wall.
Note: Do not move the refrigerator sideways as this may cause damage to the
floor covering of your refrigerator.
• Unplug the refrigerator.
• Use a vacuum or a brush to clean coils.
• When cleaning has been completed, plug the cord back into the outlet and slide
the refrigerator straight back to its original position.
Note: When pushing it back, be sure not to roll over the power cord.
13
English
Light Bulb Replacement
1.
2.
3.
4.
Switch off power to refrigerator.
Remove the highest shelf.
Allow light bulb to cool before removing.
Pinch the plastic cover between fingers and
thumb and gently pull to the left.
5. Remove the bulb by screwing it counter-clockwise.
6. Always replace with appliance-type light bulb rated at 15 watts
or lesser wattage.
7. Caution: Do not exceed the 15 watts rating at any time.
8. To replace cover, insert rear clips in first and gently push front
clip in until the cover snaps into place.
Power Interruptions
•O
ccasionally there may be power interruptions due to
thunderstorms or other causes. Remove the power cord from AC outlet
when a power outage occurs. When power has been restored, replug
power cord to AC outlet. If outage is for a prolonged period, inspect
and discard spoiled or thawed food in freezer and refrigerator. Clean
refrigerator before reusing.
Vacation and Moving Care
• For
long vacations or absences, empty food from refrigerator and
freezer, move the temperature to the OFF position and clean the
refrigerator and door gaskets according to "General cleaning"
section. Prop doors open, so air can circulate inside.When moving
always move the refrigerator vertically. Do not move with the unit lying
down. Possible damage to the sealed system could occur.
WARNING: IF OUTAGE IS FOR A PROLONGED PERIOD, INSPECT
AND DISCARD SPOILED OR THAWED FOOD IN
FREEZER. CLEAN FREEZER BEFORE REUSING.
14
English
Troubleshooting
Unit Does Not Operate
• Check if thermostat control is not in the “OFF” position.
• Check if refrigerator is plugged in.
• Check if there is power at the AC outlet, by checking the circuit breaker.
Food temperature appears too warm
• Frequent door openings.
•Allow time for recently added warm food to reach fresh food or
freezer temperature.
• Check gaskets for proper seal.
• Adjust temperature control to colder setting.
Food temperature is too cold
• If temperature control setting is too cold, adjust to a warmer
setting and allow several hours for temperature to adjust.
Compressor runs too frequently
• This
may be normal to maintain constant temperature during
high temperature and humid days.
• Doors may have been opened frequently or for an extended
period of time.
• Check gasket for proper seal.
• Check to see if doors are completely closed.
Moisture build-up on interior or exterior
of the refrigerator:
• This is normal during high humidity periods.
• Prolonged or frequent door openings.
• Check door gaskets for proper seal.
Refrigerator and Freezer Compartment has an odor:
• Interior needs cleaning.
• Foods improperly wrapped or sealed are giving off odors.
Refrigerator light does not work:
• Check power supply.
• Tighten bulb in socket.
• Replace burned-out bulb.
Refrigerator/Freezer door does not shut properly:
• Level the refrigerator.
• Realign refrigerator/freezer door.
• Check for blockages e.g. food containers, crisper cover,
shelves, bins etc.
15
English
Limited Warranty
What is covered and for how
long?
This warranty covers all defects in
workmanship or materials for a
period of:
12 months labor
(In-Home Service)
12 months parts
5 years sealed system
The warranty commences on the date
the item was purchased and the original
purchase receipt must be presented to
the authorized service center before
warranty repairs are rendered.
EXCEPTIONS: Commercial or
Rental Use warranty
90 days labor
90 days parts
No other warranty applies
What is covered.
1. T he mechanical and electrical parts,
which serve as a functional, purpose
of this appliance for a period of 12
months. This includes all parts except
finish, and trim.
2. T he components of the sealed system
e.g. hermetic compressor, condenser
and evaporator from manufacturing
defects for a period of 5 years from
the date of purchase. Any damages
to such components caused by
mechanical abuse or improper
handling or shipping will not be
covered.
What will be done?
1. W
e will repair or replace, at our
discretion any mechanical or
electrical part which proves to be
defective in normal usage during the
warranty period so specified.
2. T here will be no charge to the
purchaser for parts and labor on any
covered items during the initial 12
month period. Beyond this period only
parts are covered in the remaining
warranty. Labor is not provided and
must be paid by the customer.
3. C
ontact your nearest authorized
service center. For the name of the
nearest service center please call
1-877-337-3639.
THIS WARRANTY COVERS
APPLIANCES WITHIN THE
CONTINENTAL UNITED STATES,
PUERTO RICO AND CANADA.
IT DOES NOT COVER
THE FOLLOWING:
Damages from improper installation.
Damages in shipping.
Defects other than manufacturing.
Damage from misuse, abuse, accident,
alteration, lack of proper care and
maintenance or incorrect current or
voltage.
Damage from other than household use.
Damage from service by other than an
authorized dealer or service center.
Decorative trims or replaceable
light bulbs.
Transportation and shipping.
Labor (after the initial 12 months).
THIS LIMITED WARRANTY IS GIVEN
IN LIEU OF ALL OTHER WARRANTIES,
EXPRESSED OR, INCLUDING THE
WARRANTIES OF MERCHANTABILITY
AND FITNESS FOR A PARTICULAR
PURPOSE
The remedy provided in this warranty
is exclusive and is granted in lieu of all
other remedies.
This warranty does not cover incidental
or consequential damages, so the above
limitations may not apply to you. Some
States do not allow limitations on how
long an implied warranty lasts, so the
above limitations may not apply to you.
This warranty gives you specific legal
rights, and you may have other rights,
which vary, from state to state.
Haier America
New York, NY 10018
16
Français
CONSIGNES GÉNÉRALES DE SECURITÉ
ATTENTION: L ire l’ensemble des instructions avant d’utiliser
l’appareil. Lors de l’utilisation de cet appareil,
prendre toutes les mesures de sécurité de base, y
compris les suivantes:
REMARQUE: S
i le réfrigérateur a été placé en position horizontale ou
en position inclinée, que ce soit pour longtemps ou non,
attendez 24 heures avant de brancher l’appareil.
1) N’utiliser cet appareil que pour l’usage prévu, tel que décrit dans ce
guide d’utilisation et d’entretien.
2) C
e réfrigérateur doit être correctement installé, conformément aux
instructions d’installation avant d’être utilisé. Voir les instructions de
mise à la terre dans la section Installation.
3) C
e réfrigérateur ne doit être ni encastré, ni enclos dans un placard. Il
est uniquement conçu pour être installé tel qu’il se présente.
4) N
e jamais tirer sur le cordon d’alimentation pour débrancher le réfrigérateur. Toujours saisir fermement la fiche et la tirer tout droit hors de
la prise.
5) Réparer ou remplacer immédiatement tout cordon électrique effiloché
ou autrement endommagé. Ne pas utiliser un cordon fissuré, abrasé
ou dont la prise ou le connecteur est endommagé.
6) Si un ancien réfrigérateur n’est pas utilisé, nous recommandons d’en
retirer les portes afin de réduire le danger qu’il peut représenter pour
les enfants.
7) ATTENTION: Une fois le réfrigérateur en fonctionnement, ne pas
toucher les surfaces froides du congélateur,
particulièrement avec des mains mouillées ou
humides. La peau peut adhérer à ces surfaces
extrêmement froides.
8) Ne pas recongeler les aliments qui ont été complètement décongelés.
Le bulletin maisons et jardins du ministère de l’agriculture des ÉtatsUnis no. 69 stipule : « ..Les aliments congelés peuvent être recongelés
en toute sécurité s’ils contiennent toujours des cristaux de glace ou si
leur température est toujours inférieure à 4,5 °C (40 °F) ».
« …Les viandes hachées, la volaille et le poison présentant une odeur
ou une couleur suspecte ne doivent être ni recongelés, ni mangés.
La crème glacée dégelée doit être jetée. Tout aliment présentant une
odeur ou couleur douteuse doit être jeté cas son ingestion pourrait être
dangereuse.»
1
Français
« …La décongélation ou la recongélation, même partielle réduit la quali
é gustative des aliments, en particulier des fruits, légumes et plats préparés. La qualité gustative des viandes rouge est beaucoup moins affectée que celle de nombreux autres aliments. Utiliser les aliments recongelés
dès que possible, afin de conserver un maximum de leur qualité gustative. »
9) Ne pas utiliser d’appareils électriques ou d’objets acérés pour dégivrer le
réfrigérateur.
10) Débrancher le réfrigérateur avant de le nettoyer ou d’effectuer toute
réparation. Remarque: si, pour une raison quelconque, ce produit devait être dépanné, nous recommandons vivement de confier le travail à un technicien certifié.
11) Ne pas utiliser le réfrigérateur en présence d’émanations explosives.
VEUILLEZ CONSERVER CES
INSTRUCTIONS
DANGER
Les enfants pourraient se retrouver coincés dans votre
réfrigérateur ou congélateur usagé avant que vous ne
puissiez vous en débarrasser. Retirer les portes. Laisser les
étagères en place de manière à ce que les enfants ne
puissent pas grimper facilement à l’intérieur.
Agrafer le ticket de caisse au guide. Il devra être présenté pour
tout service après-vente sous garantie.
2
Français
Piéces et Caractéristiques
1
2
16
10
8
3
9
12
13
11
7
6
14
15
5
4
17
1. Bacs a glace
10.Etagere du congelateur
2.Etageres integrales de la porte du
congelateur.
11.Compartiment d’emmagasinage
des gallons
3.Etagere integrale du congelateur
12.Emmagasinage des cannettes
4.Pieds de mise a niveau reglables
(pas montres)
13.Etagere mi-integrale du
compartiment d’emmagasinage
5.Bac a legumes transparent
14.Etagere mi-integrale du
compartiment d’emmagasinage
des bouteilles de 2 litres
6.Couvercle transparent du bac
a legumes
7.Etageress integrales en cable
metallique reglables
8.Commande de temperature
mecanique reglable
9.Lumiere interieure automatique
3
15.Controle de l’humidite du
bac a legumes
16.Controle du courant d’air
17.Etagere d’emmagasinage de
condiment
Français
Installation du Réfrigérateur
Désemballage du Réfrigérateur
1. R
etirer l’ensemble du matériel d’emballage. Ceci comprend la base
en mousse ainsi que l’ensemble du matériel adhésif qui maintient les
accessoires du réfrigérateur à l’intérieur tout comme à l’extérieur.
2. Inspecter et enlever tout restant d’emballage, de scotch ou de
matériaux imprimés avant de brancher le réfrigérateur.
Mise á Niveau du Réfrigérateur
• L e réfrigérateur possède deux pieds de mise à niveau qui sont situés
sur les coins avant du réfrigérateur. Après avoir convenablement
installé le réfrigérateur à la place qu’il occupera, procéder à la mise
à niveau.
• Pour régler les pieds de mise à niveau, les tourner dans le sens des
aiguilles d’une montre afin de surélever le réfrigérateur et dans le
sens inverse des aiguilles d’une montre pour l’abaisser. La porte du
réfrigérateur se ferme plus facilement lorsque les pieds de mise à
niveau sont surélevés.
Circulation d’Air Adéquate
•P
our être sûr que le réfrigérateur fonctionne à son maximum
d’efficacité, l’installer dans un environnement favorable à une
bonne circulation d’air et possédant des connexions de plomberie et
d’électricité saines.
• Les indications suivantes concernent l’espace recommandé autour du
réfrigérateur:
Latéralement...................19mm (3/4")
Partie supérieure.............50mm (2")
Arrière...........................50 mm (2")
4
Français
ATTENTION: E
XIGENCES ÉLECTRIQUES – RISQUE DE
CHOC ÉLECTRIQUE
Caractéristiques Electriques
•P
our l’alimentation du réfrigérateur, veiller à utiliser une prise
de courant convenable (prise de 120 volts,15 amp) raccordée à
la terre.
• Eviter d’utiliser des adaptateurs à trois fiches ou de sectionner la
troisième fiche reliée à la terre dans le but d’utiliser un branchement
à deux fiches. Cette pratique pourrait s’avérer dangereuse dans la
mesure où le réfrigérateur n’est pas relié convenablement à la terre,
et risquerait de causer des risques d’électrocution.
ATTENTION: U
TILISATION DE RALLONGES – RISQUE DE
DANGER POTENTIEL
Utilisation de Rallonges
•É
viter d’utiliser une rallonge électrique car, dans certains cas, cela
peut entraîner des risques pour la santé. S’il est nécessaire d’utiliser
une rallonge, utiliser uniquement une rallonge possédant une fiche
male à deux broches plus terre à une extrémité et une prise femelle
de même type à l’autre extrémité. La capacité électrique de la
rallonge doit être égale ou supérieure à la capacité de l’appareil.
N’UTILISEZ PAS DE RALLONGES D’UNE LONGUEUR
SUPÉRIEURE À
12 PIEDS/3,65 MÈTRES.
Limitations relatives à l’Installation
•N
e pas installer le réfrigérateur dans un endroit qui n’est pas
convenablement isolé ou chauffé; comme par exemple un garage,
etc. Le réfrigérateur n’est pas conçu pour fonctionner à des
températures inférieures à 12°C.
• Choisir un endroit convenable et placer le réfrigérateur sur une
surface solide et plane, loin de sources de chaleur telles que: les
radiateurs, les éléments chauffants à plinthes, les cuisinières, etc.
Toute irrégularité au sol doit être corrigée à l’aide des pieds de mise
à niveau situés sur les coins avant de la partie inférieure
du réfrigérateur.
5
Français
Alignement de la porte
La Porte du Congélateur: (voir fig. # 1)
1. Retirer la vis de protection de la charnière.
2. Retirer ensuite la protection de la charnière supérieure.
3. Desserrer les vis de la charnière supérieure à l’aide
d’un tournevis cruciforme.
4. Régler la porte ou placer une cale puis serrer les vis.
5. Replacer la protection de la charnière supérieure.
couverture de la
boîte charnière
fig. # 1
charnière du haut.
Inverser l’ouverture de la Porte
Méthode d’ouverture de la Porte sur la
gauche ou la droite:
Ce produit permet de faire passer l’ouverture de la porte de la gauche
vers la droite. Vous pouvez choisir le côté d’ouverture de la porte en
suivant la procédure d’inversion.
Désassemblage: (voir fig. # 1 et fig. # 2)
1. F ixer la porte du réfrigérateur et du congélateur à l’aide de papier
adhésif encollé des deux côtés afin de maintenir la porte en place.
2. Comme il est décrit au schéma 1, désassembler la couverture de la
boîte à charnières située sur la partie supérieure de la porte du
congélateur à l’aide d’un tournevis cruciforme. Retirer ensuite les
vis de la charnière. Retirer la charnière en la tirant à la verticale,
puis la placer dans un endroit sûr.
3. Retirer le papier adhésif de la porte du réfrigérateur,
soulever puis retirer la porte; la poser avec précaution.
4. Démantelez deux vis de la charnière centrale, soulevez et prenez vers
le bas la charnière et la garniture centrales, et maintenez-les
dans un endroit sûr. (voir fig # 2)
5. Retirez le ruban adhésif sur la porte de réfrigérateur, soulevez et
prenez vers le bas la porte de réfrigérateur,
et mettez-soigneusement la de côté.
6. Retirez les taquets de porte des portes de congélateur et de
réfrigérateur et installez-les du côté opposé de la porte.
7. Doorstopper de côté gauche de Insert (fourni en votre emballage) sur
le trou de bas de côté gauche de la porte de réfrigérateur et sur le trou
de bas de côté gauche de la porte de congélateur. Attachez avec des 6
vis fournies.
Français
trous de vis
taquet de la porte
de congélateur
fig. # 2
axe de pivotement
moyen
fixing moyen
Réinstallation: (voir fig. # 3 et # 4)
1. R
etirez le trou inférieur de la broche de point d'appui de la porte en
tournant dans le sens contraire à celui des aiguilles d'une montre.
Placez la broche dans le trou de l'autre côté et serrez.
fig. # 3
bas d'unité
abaissez l'axe de pivotement
charnière inférieure
2. D
esserrez les vis retenant le support de la charnière inférieure
et retirez la charnière.
7
ATTENTION: Deux Personnes Ont exigé.
Français
3. Retirez les deux pieds avant gauches et droits du bas.
4. Desserrez les vis tenant la charnière inférieure et retirez-les.
5. A
lignez les trous du support de la charnière inférieure sur les trous
correspondant l'autre côté. Introduisez les vis et serrez-les.
6. Installer la poignée du réfrigérateur: faire en sorte que le trou de gauche
situé sur la partie inférieure de la porte du compartiment de réfrigération
se retrouve sur l'essieu de la charnière inférieure; faire bouger la porte de
l’arrière vers l’avant de manière à ce qu'elle soit droite et alignée sur la
charnière supérieure. Installer à nouveau la charnière centrale puis tourner
l'essieu de la charnière jusqu'à ce qu'il entre complètement dans la porte; le
fixer ensuite à l'aide de vis. (see fig. 4)
NOTE: Retirez les prises du doorframe et les installez de l'autre côté.
doorstopper
(côté gauche)
axe de
pivotement moyen
trous de vis
fig. # 4
fixing moyen
7. P our installer la porte de congélateur: faites le trou de bas gauche
de la porte de congélateur tomber au-dessus de l'axe central de
charnière; soulevez la charnière supérieure, de sorte que l'axe de
charnière puisse être installé dans le trou supérieur de la partie
supérieure de la porte de congélateur; ajustez la porte pour la
rendre droite et de niveau.
8
Français
Caractéristiques du Réfrigératuer
et Utilisati
Caracteristiques
generales
Lumiere interieure de la
section refrigerante:
Commande de temperature
reglable:
Votre refrigerateur est equipe d’une
lumiere interieure automatique situee
dans le section des aliments frais pour
reperer facilement votre nourriture.
Votre refrigerateur maintient
automatiquement le niveau de temperature
programme. Le cadran de controle de
temperature comporte 7 positions , plus
une position d’arret. La position “1”
est la plus chaude et “7” la plus froide.
Quand vous tournez la position sur
“OFF” arret, le refrigerateur et le
congelateur cessent de refroidir. Au
debut, mettez le cadran sur la
position “4” , attendez 24 heures
avant de regler la temperature sur la
position desiree. Si vous desirez une
temperature froide, tournez le cadran
dans le sens des aiguilles d’une montre.
Pour une operation normale, gardez
le cadran entre “froid” et “plus froid”.
Pour votre comodite, la fabrique regle
en avance le controle de temperature
sur une condition d’operation normale
(Note: Si le refrigerateur a ete
place horizontalement ou a ete
incline,attendez 24 heures avant
de le brancher.
Le compartiment de votre congelateur
est equipe d’un controle reglable du
courant d’air. Pour votre comodite,
l’air courant est regle en avance par la
fabrique sur un arrangement normal.
Il y a aussi un choix pour ajuster les
arrangements, sur une basse congelation, ou une haute congelation. Votre
refrigerateur est equipe d’un controle
pour rehausser ou abaisser les niveaux
d’humite de votre bac a legumes. Ce
caracteristique augmentera la duree
d’emmagasinage de vos fruits et
vegetables. Simplement ajustez le
controle sur l’arrangement approprie pour
les produits que vous emmagasinez
dans le bac a legumes. L’arrangement
bas, permettra l’air humide de sortir du
bac a legumes pour l’emmagasinage
optimum des fruits et vegetables qui
ont une epluchure . Un arrangement
haut retient l’air humide dans le bac a
legumes pour un emmagasinage
optimum des vegetables frais.
Frost libèrent le Réfrigérateur-Congélateur
Ne devez jamais dégivrer votre congélateur, comme il dégivre
automatiquement n'importe quelle accumulation de glace qui
peut se produire.
Etagères Intérieures du Réfrigérateur
(Les Etagères peuvent varier par le Modèle)
9
Les étagères du réfrigérateur ont été conçues pour vous faciliter la vie.
Elles sont réglables afin de s’adapter à vos besoins Les possibilités ne sont
limitées que par le type de modèle en votre possession et l’étendue de
votre imagination.
Français
Pour retirer ou régler une étagère de‘largeur
intégrale’ coulissante: (Voir fig. # 5)
1. Incliner légèrement l’étagère vers le haut puis la faire glisser
vers l’avant jusqu’à ce que l’étagère soit complètement retirée.
2. Pour replacer l’étagère, sélectionner la position souhaitée puis la faire
glisser avec précaution jusqu’à ce qu’elle se trouve enclenchée.
fig. # 5
Bac à Légumes et Couvercle du Bac
Pour retirer et installer le bac à légumes:
(Voir fig. # 6)
1. Agripper fermement le bac puis le retirer complètement en
le faisant glisser.
2. Replacer le bac comme il convient, puis le faire glisser vers
l’arrière avec précaution.
fig. # 6
Pour retirer ou replacer le couvercle du bac:
(Voir fig. # 7)
1. Agripper le bac avec précaution et le sortir en le faisant glisser.
fig. # 7
2. A
baisser la partie avant de l’étagère jusqu’à ce que les crochets
situés à l’arrière s’enclenchent dans les encoches des supports
d’étagère en métal.
10
Français
Informations sur le Rangement des Aliments
Aliments Frais:
•S
auf avis contraire, lorsque vous stockez des aliments frais n’ayant
pas été préemballés, assurez-vous de bien emballer ou stocker ces
aliments dans des matières hermétiques et à l'épreuve de l'humidité.
Vous en préserverez ainsi la durée de conservation et empêcherez le
transfert d'odeurs et de goûts.
•E
ssuyez les contenants avant de les ranger pour éviter tout déversement inutile.
• L es oeufs devraient être rangés à la verticale dans leur carton
d’origine pour en maximiser la durée de conservation.
• L es fruits devraient être lavés et séchés, puis insérés dans des sacs de
plastique avant d’être rangés au réfrigérateur.
• L es légumes à pelure devraient être rangés dans des sacs ou des contenants de plastique.
• L es légumes-feuilles devraient être lavés et séchés, puis rangés dans
des sacs ou des contenants de plastique.
• L es aliments chauds devraient être laissés à refroidir avant d’être
stockés au réfrigérateur. Ceci évitera toute utilisation d’électricité
inutile.
• Les fruits de mer frais devraient être consommés le jour de leur achat.
• L orsque vous stockez des viandes dans la section des aliments frais,
gardez-les dans leur emballage d’origine ou réemballez-les au
besoin.
Voici quelques conseils de conservation d'aliments:
• Poulet – 1 à 2 jours
• Boeuf haché – 1 à 2 jours
• Viandes froides – 3 à 5 jours
• Steaks/rôtis – 3 à 5 jours
• Viandes fumées/salaisonnées – 7 à 10 jours
Pour un tableau de stockage détaillé visitez le site internet de la FDA:
www.cfsan.fda.gov/~dms/fttstore.html
11
Français
Aliments Surgelés
•E
ssuyez les contenants avant de les ranger pour éviter tout déversement
inutile.
• L es aliments chauds devraient être laissés à refroidir avant d’être stockés
au congélateur. Ceci évitera toute dépense superflue d’électricité.
• L orsque vous stockez des viandes, gardez-les dans leur emballage
d’origine ou réemballez-les au besoin.
• L es aliments stockés au congélateur doivent être emballés de façon
appropriée. Tous les aliments doivent être emballés de manière à
empêcher l’infiltration ou l’évacuation d’air ou d’humidité. Le stockage
inapproprié des aliments entraînera le transfert d'odeurs et de saveurs,
et fait sécher les aliments mal emballés.
•C
onformez-vous aux directives de bonne utilisation figurant sur les
emballages ou les contenants.
• Recommandations sur l’emballage :
Contenants en plastique avec couvercles hermétiques
Papier d’aluminium ultra résistant
Pellicule rétractable faite de fibre de saran
Sacs de plastique auto-scellant
• Ne pas recongeler les aliments dégelés / décongelés.
• Il est recommandé d’inscrire la date de mise au congélateur sur
l’emballage.
Voici quelques conseils de conservation d'aliments :
•
•
•
•
•
•
•
Repas congelés – 3 à 4 mois
Crevettes, langoustines, écrevisses frais –3 à 6 mois
Boeuf haché et viandes à ragoût – 3 à 4 mois
Dinde, veau ou porc haché – 3 à 4 mois
Côtelettes – 4 à 6 mois
Steaks – 6 à 12 mois
Poulet ou dinde – 6 à 8 mois
Pour consulter un tableau de conservation détaillé, visitez le site de la
FDA, à l'adresse www.cfsan.fda.gov/~dms/fttstore.html
Témoins Habituels de Bon Fonctionnement
• L es éléments de refroidissement tubulaires (serpentins refroidisseurs)
font des bruits d’ébullition, des gargouillements et provoquent
de légères vibrations.
• L a commande du thermostat émettra un déclic lorsque qu’elle s’allume
et s’éteint.
12
Français
Entretien e Nettoyage Adéquats
du Réfrigérateur Nettoyage et
Entretien
Nettoyage et Entretien
Attention: Pour éviter les risques d’électrocution; toujours débrancher
le réfrigérateur avant de le nettoyer. Le non respect de cette
mesure peut entraîner des blessures graves ou mortelles.
Précautions:
Avant d’avoir recours à des produits d’entretien, toujours
consulter et suivre les instructions du fabricant et
recommandations afin d’éviter toute blessure éventuelle et
risque de dégât de matériel.
Généralités: •Préparer une solution de nettoyage comportant 3 à 4 cuillerées
à soupe de bicarbonate de soda mélangé à de l’eau chaude.
A l’aide d’une éponge ou un tissu doux humectés de solution
de nettoyage; essuyer le réfrigérateur.
•Rincer à l’eau chaude et sécher à l’aide d’un tissu doux.
•Ne pas utiliser de détergents chimiques, abrasifs, ou contenant
de l’ammoniaque ou du chlore, ni de solvants ou de tampons à
récurer en métal. CERTAINS de ces produits chimiques peuvent
dissoudre, endommager et/ou décolorer le réfrigérateur.
Joints de porte: •Nettoyer les joints de porte tous les trois mois en suivant les
instructions générales fournies. Les joints doivent rester propres
et flexibles afin d’assurer une bonne étanchéité.
•Une fine couche de gelée de pétrole appliquée sur le côté des
joints comportant les charnières permet de préserver la
flexibilité de ces derniers et d’assurer une bonne étanchéité.
13
Français
Changement d’Ampoule
1.
2.
3.
4.
Débrancher l’alimentation du réfrigérateur.
Retirer l’étagère la plus haute.
Laisser l’ampoule refroidir avant de la retirer.
Pince l'en matière plastique couvre entre doigts et pouce et
doucement tire à gauche.
5. Retirer l’ampoule en la dévissant dans le sens inverse des
aiguilles d’une montre.
6. Toujours remplacer à l’aide d’une ampoule pour appareil
de 40 watts ou d’une puissance en watts inférieure.
7.
Attention: Ne jamais dépasser 40 watts.
8. Pour
substituer la couverture, insérez les clips arrière dedans
d'abord et poussez doucement le clip avant dedans jusqu'à ce que la
couverture se casse dans l'endroit.
Pannes d’Alimentation
•D
es pannes d’alimentation occasionnelles peuvent survenir à cause
d’une tempête ou de causes autres. Retirer le cordon d’alimentation
de la prise CA pendant toute la durée de la coupure d’alimentation.
Lorsque le courant électrique est rétabli, rebrancher le cordon dans la
prise CA. Si la coupure d’alimentation se prolonge, vérifier et jeter les
aliments avariés ou décongelés se trouvant dans le congélateur et le
réfrigérateur. Nettoyer le réfrigérateur avant de le réutiliser.
Vacances et Déménagement
• P endant les périodes de vacances ou d’absence prolongée, vider le
réfrigérateur et le congélateur, placer le CADRAN de température sur la
position ‘OFF’ (arrêt) et nettoyer le réfrigérateur ainsi que les joints de
porte en suivant les procédures du chapitre intitulé ‘Nettoyage général’.
Faire en sorte que la porte reste ouverte de manière à ce que l’air
puisse circuler à l’intérieur. Toujours déplacer le réfrigérateur en position
verticale. Ne pas déplacer l’appareil en position horizontale. Ceci
pourrait endommager le système d’étanchéité.
ATTENTION: S
I LA COUPURE DE COURANT DURE POUR UNE
PÉRIODE PROLONGÉE, INSPECTEZ ET JETEZ
LES ALIMENTS AVARIÉS OU DÉCONGELÉS QUI
SONT DANS LE CONGÉLATEUR. NETTOYEZ LE
CONGÉLATEUR AVANT DE LE RÉUTILISER.
14
Français
Dépannage
Le Réfrigérateur ne fonctionne pas:
•V
érifier que le programmateur du thermostat ne se trouve pas sur la
position ‘OFF’ (arrêt).
• Veiller à ce que le réfrigérateur soit bien branché.
• Veiller à ce que la prise de courant CA fonctionne bien en
vérifiant le disjoncteur.
La température des aliments semble être trop élevée:
• La porte est ouverte trop fréquemment.
• Patienter le temps nécessaire pour que les aliments chauds récemment
mis au frais refroidissent ou congèlent.
• Vérifier l’étanchéité des joints.
• Régler le programmateur de température sur froid.
La température des aliments est trop basse:
•S
i le programmateur de température est placé sur une position trop
froide, le régler sur une position plus chaude et patienter plusieurs
heures, jusqu’à ce que la température se soit ajustée.
Le réfrigérateur se met en marche trop fréquemment:
• Il peut s’agir de l’activité normale pour maintenir une
température constante lorsque la température extérieure
ou le taux d’humidité dans l’air sont élevés.
• Les portes ont été ouvertes trop fréquemment ou pendant
une période de temps prolongée.
• Vérifier l’étanchéité des joints.
• Veiller à ce que les portes soient bien fermées.
Accumulation d’humidité à l’intérieur ou à l’extérieur
du réfrigérateur:
• Ceci est normal pendant les périodes de grande chaleur humide.
• Ouvertures de la porte prolongée ou trop fréquente.
• Vérifier l’étanchéité des joints.
L’intérieur du réfrigérateur dégage une odeur:
• Nettoyer l’intérieur du réfrigérateur.
• Les aliments ne sont pas convenablement enveloppés ou les
emballages dégagent une odeur.
La lumière du réfrigérateur ne fonctionne pas:
• Vérifier l’alimentation.
• Resserrer l’ampoule dans la douille.
• Remplacer l’ampoule grillée.
La porte du réfrigérateur/congélateur ne ferme
pas correctement:
15
• Mettre le réfrigérateur à niveau.
• Réaligner la porte du réfrigérateur/congélateur.
• Vérifier qu’il n’y ait pas d’obstruction comme par exemple des
containers ou les couvercles des bacs, les étagères, paniers, etc.
Français
Garantie Limitée
Eléments sous garantie et durée
de la garantie:
Cette garantie couvre tous les défauts de
main-d’œuvre et de matériaux pour une
période de:
12 mois pour la main d’oeuvre
12 mois pour les pièces
5 ans pour le système
d’étanchéité
La garantie prend effet le jour de l’achat
de l’article. Le ticket de caisse d’origine
doit être présenté au centre de
réparation agréé pour toute réparation
sous garantie.
EXCEPTIONS: Garantie pour
usage commercial ou location.
90 jours pour la main d’œuvre
(service en atelier uniquement)
90 jours pour les pièces
Aucune autre garantie n’est
applicable
Couverture.
1. Les pièces électriques et mécaniques
servant au fonctionnement de
l’appareil, pour une période de 12
mois. Ceci comprend l’ensemble des
pièces, à l’exception de la finition et
des garnitures.
2. Les composants du système
d’étanchéité, tels que le compresseur
hermétique, le condenseur et
l’évaporateur, contre tous défauts de
fabrication, pour une période de 5
ans à compter de la date d’achat.
Tout dommage concernant ces
composants et résultant d'un abus
d’ordre mécanique, d’une
utilisation incorrecte, ou de méthodes
d’expédition inadéquates, ne sera pas
compris dans la garantie.
Réparations qui seront
effectuées:
1. Nous nous engageons à réparer
ou remplacer, à notre discrétion,
toute pièce électrique ou mécanique
s’avérant défectueuse dans des
conditions normales d’utilisation,
au cours de la période de garantie
spécifiée.
2. L’acheteur ne subira aucun frais pour
les pièces et la main-d’œuvre
couvertes par la garantie, au cours de
la première période de 12 mois.
Au-delà de cette période, seules es
pièces seront couvertes par la durée
restante de la garan tie. La
main-d’œuvre n’est pas pourvue et à
la charge du client.
3. C
ontacter le centre de réparations
agréé le plus proche. Pour obtenir
les nom et adresse du centre le plus
proche, appeler le 1-877-337-3639.
LES APPAREILS SONT COUVETRS
PAR LA GARANTIE SUR LE
TERRITOIRE CONTINENTAL DES
ETATS-UNIS, Á PUERTO RICO ET
AU CANADA:
Les dommages résultant d’une installatio
incorrecte. Les dommages survenus
pendant le transport. Les défauts ne
résultant pas de la fabrication.Les
dommages résultant d’un usage incorrect
ou abusif, d’un accident, de
modifications, d’un manque d’entretien
ou de maintenance, ou d’une tension
incorrecte. Les dommages résultant d’un
usage autre que l’usage ménager. Les
dommages résultant d’un entretien ou de
réparations par quiconque autre qu’un
distributeur ou centre de réparations
agréé. Garnitures décoratives ou
ampoules pouvant être remplacées.
Transport et Frais d’envoi. Main d’œuvre
(après la période initiale de 12 mois)
CETTE GARANTIE LIMITÉE REMPLACE
TOUTE AUTRE GARANTIE EXPRESSE
OU IMPLICITE, Y COMPRIS LES
GARANTIES DE VALEUR
MARCHANDE OU D’ADÉQUATION A
UN USAGE PRECIS
Le recours offert dans cette garantie est
exclusif et est accordé à l’exclusion de
tout autre.
La garantie ne couvrant pas les
dommages directs et indirects, les
limitations ci-dessus peuvent ne pas
s’appliquer à tous les cas. Certains
états ne permettant pas la limitation
de la durée des garanties implicites,
les limitations ci-dessus peuvent ne pas
s’appliquer à tous les cas.
Cette garantie confère à l’acheteur des
droits spécifiques et celui-ci peut
bénéficier d’autres droits qui varient
selon les états.
Haier America
New York, NY 10018
16
Español
REGLAS GENERALES DE SEGURIDAD
ADVERTENCIA: L ea todas las instrucciones antes de utilizar este
aparato. Cuando utilice este aparato, siempre
ejerza las precauciones de seguridad básicas,
incluyendo las siguientes:
NOTA: S
i el refrigerador se ha ubicado en una posición horizontal o
inclinada durante cualquier lapso de tiempo, espere 24 horas
antes de enchufar la unidad.
1) Utilice este aparato exclusivamente para su uso especificado, según
se describe en esta guía de uso y cuidados.
2) Este refrigerador debe ser adecuadamente instalado siguiendo las
instrucciones de instalación antes de utilizarse. Observe las instrucciones para conectarlo a tierra en la sección de instalación.
3) Este refrigerador no debe de ser empotrado o colocado dentro de un
gabinete de cocina. Ha sido diseñado exclusivamente para ser instalado por separado.
4) N
unca desconecte su refrigerador tirando del cordón eléctrico. Sujete
siempre la clavija firmemente y retírela del contacto evitando torcerla.
5) Repare o reemplace inmediatamente cualquier cordón eléctrico que
muestre raspaduras o daños. No utilice ningún cordón que muestre señales de abrasión o grietas en su extensión, clavija o terminal de conexión.
6) S
i su antiguo refrigerador no está siendo utilizado, recomendamos
quitarle las puertas. Ello reducirá los riesgos de accidentes infantiles.
7)
A
DVERTENCIA: Una vez que su refrigerador se encuentre
operando, no toque las superficies frías en el compartimento del
congelador, especialmente si sus manos se encuentran húmedas
o mojadas. Su piel puede adherirse a estas superficies extremadamente frías.
8) No congele alimentos que hayan sido previamente descongelados en
su totalidad. El Departamento de Agricultura de los Estados Unidos,
en su Boletín de Casa y Jardín No. 69 indica que "…Usted puede
volver a congelar, sin correr ningún riesgo, aquellos alimentos congelados que hayan sido descongelados y que aún contengan cristales
de hielo o que aún se encuentren fríos con una temperatura por debajo de los 4.5° C (40°F)".
1
"…Carnes molidas, aves, o pescados, descongelados que despidan
olor extraño o muestren decoloración no deben volver a congelarse
y no deben consumirse. El helado descongelado debe desecharse. Si
el olor o color de cierto alimento es deficiente o cuestionable, deséchelo. Tal alimento podría resultar peligroso si lo ingiriese."
Español
"…Incluso el descongelar parcialmente y volver a congelar los ali
mentos disminuye su calidad de consumo, especialmente si se trata de frutas, verduras y alimentos preparados. La calidad de consumo de las carnes rojas es menormente afectada en comparación a la de muchos otros alimentos. Utilice los alimentos que hayan vuelto a congelarse lo más pronto posible para evitar que sufran mayor dete
rioro en su calidad de consumo."
9) No emplee ningún aparato eléctrico o instrumento punzocortante para descongelar su refrigerador.
10) Desconecte su refrigerador antes de limpiarlo o antes de hacer
cualquier reparación.Note: If for any reason this product requires
service, we strongly recommend that a certify technician perform
service.
11) No opere su refrigerador en la presencia de gases explosivos.
GUARDE ESTAS
INSTRUCCIONES
PELIGRO
Existe el riesgo de que los niños puedan quedar atrapadosdentro. Antes de tirar su refrigerador o congelador, quite las
puertas. Deje los anaqueles en su lugar para que los niños
no puedan entrar fácilmente en el interior.
Agrafer le ticket de caisse au guide. Il devra être présenté pour tout
service après-vente sous garantie.
2
Español
Piezas y Características
1
2
16
10
8
3
9
12
13
11
7
6
14
15
5
4
17
1. Bandejas para cubos de hielo
10.Estante del congelador
2.Estantes de la puerta del ancho
completo del congelador
11.Compartimiento de almacenamiento
de un galón
3.Estante de la puerta del ancho
completo
12.Sistema de almacenamiento de latas
Can
4.Patas de nivelación ajustables para
la parte delantera (no se muestran)
13.Compartimiento para
almacenamiento con estante
de la mitad del ancho
5.Cajón transparente para verduras y
frutas
6.Tapa del cajón para frutas y
verduras de vidrio transparente
7.Estantes ajustables de alambre del
ancho completo de la unidad
8.Control mecánico para ajuste de
temperatura
9. Luz interior automática
3
14.Estante de la mitad del ancho,
compartimiento para almacenamiento de botellas de 2 litros
15.Control de humedad para frutas y
verduras
16.Control de flujo de aire
17.Estante para almacenamiento de
condimentos
Español
Instalación de Su Refrigerador
Desempaque del Refrigerador
1. R
etire todo el material de embalaje. Esto incluye la base de espuma
y toda la cinta adhesiva que sostiene los accesorios del refrigerador
en el interior y exterior.
2. Inspeccione y retire cualesquier restos del embalaje, la cinta
adhesiva o los materiales impresos antes de encender
el refrigerador.
Nivelación del Refrigerador
•S
u refrigerador tiene dos patas niveladoras que están ubicadas en las
esquinas frontales de su refrigerador. Después de haber colocado su
refrigerador en la posición definitiva, puede nivelar su refrigerador.
• Puede ajustar las patas niveladoras girándolas a la derecha para
elevar el refrigerador y girándolas a la izquierda para bajarlo. La
puerta del refrigerador cerrará con más facilidad cuando las patas
niveladoras son elevadas.
Circulación Apropiadado del Aire
•P
ara asegurar que su refrigerador funcione con la eficiencia máxima
para la que fue diseñado, éste debe ser instalado en un lugar donde
haya una circulación de aire adecuada, conexiones eléctricas y
de tubería.
• Estas son las distancias recomendadas que deben dejarse
alrededor del refrigerador:
Lados..........................19 mm
Parte Superior..............50 mm
Parte Posterior..............50 mm
ADVERTENCIA: R
EQUISITOS ELÉCTRICOS – RIESGO DE
DESCARGA ELÉCTRICA
Requisitos Eléctricos
•A
segúrese de que haya un tomacorriente apropiado (120 V, 15
Amp.) con una conexión a tierra apropiada para hacer funcionar
el refrigerador.
• Evite el uso de adaptadores de tres patas o el cortar la tercer pata
de conexión a tierra para poder conectar en un tomacorriente
bifásico. Esto sería una práctica muy peligrosa ya que no proveería
al refrigerador con una conexión a tierra adecuada y podría resultar
un riesgo de descarga eléctrica.
ADVERTENCIA: U
SO DE CABLES DE PROLONGACIÓN –
PELIGRO POTENCIAL
Uso de Alargues
•E
vite el uso de alargues para mayor seguridad. Si fuese necesario
utilice solamente un alargue de tres cables que posea un enchuefe
de tres patas. NO UTILICE CABLES DE PROLOGACIÓN MÁS
LARGOS DE 12 PIES.
4
Español
Limitaciones de Instalación
•N
o instale su refrigerador en ningún lugar que no tenga el
aislamiento o la calefacción apropiada, por ejemplo una cochera,
etc. Su refrigerador no fue diseñado para funcionar en temperaturas
abajo de los 12° Centígrados (55°F).
• Seleccione un lugar adecuado para el refrigerador sobre una
superficie sólida y nivelada alejado de los rayos directos del sol
o de una fuente de calor como la de los radiadores, rejillas de
calefacción, estufas, etc. Cualquier desnivelación del piso debe ser
corregido con las patas niveladoras ubicadas en las esquinas
inferiores frontales del refrigerador.
Colocación del Gozne de la Puerta en el Lado Opuesto
1. Retire la cubierta de la bisagra superior.
2. Utilizando un destornillador Phillips, afloje y retire los tornillos que mantienen la bisagra superior en su lugar.
3. Quite la bisagra superior y levante la puerta con cuidado.
4. Quite los tarugos de los tornillos del lado opuesto e insértelos en los agu
jeros para tornillos de los tornillos que acaba de sacar.
5. Quite del refrigerador los elementos que pueda haber sueltos y gírelo con cuidado apoyándolo sobre la parte trasera, quite las dos patas de nivelación
y ubíquelo en un lugar seguro.
6. Afloje los tornillos que unen el soporte de la bisagra inferior con el refriger
ador y quite los tornillos y el soporte.
5
Español
Alineación de la Puerta
Puerta del congelador: (vea fig. # 1)
1. Quite la cubierta de los tornillos.
2. Quite la cubierta de la bisagra superior.
3. Afloje los tornillos de la bisagra superior usando un
destornillador de punta de cruz.
4. Ajuste la puerta o coloque un espaciador entremedio
y luego vuelva a apretar los tornillos.
5. Vuelva a colocar la cubierta de la bisagra superior.
cubierta de
la bisagra
fig. # 1
bisagra superior
Cómo Invertir las Manijas de la Puerta
Método de apertura de la puerta izquierda/derecha:
Este producto le ofrece la opción de invertir la apertura de la puerta
izquierda/derecha. Puede seleccionar su preferencia de apertura de la
puerta siguiendo el procedimiento para hacer el cambio.
Desmantelamiento: (Vea fig. # 1 y # 2)
1. Fije las puertas del refrigerador y congelador pegando cinta
adhesiva en ambos lados para mantener las puertas en su lugar.
2. Como se muestra en la figura 1, desmantele la cubierta de la
bisagra en la parte superior de la puerta del congelador con un
destornillador de punta de cruz. Después retire los dos tornillos
de la bisagra. Saque la bisagra jalándola verticalmente
y guárdela en un lugar seguro.
3. Quite la cinta adhesiva de la puerta del congelador, levante y
quite la puerta y póngala cuidadosamente adentro.
4. Como se muestra en la figura 2, desmonte dos tornillos de la bisagra
central, levante y tome abajo la bisagra y la pista centrales,
y manténgalas un lugar seguro. (vea fig # 2)
5. Quite la cinta adhesiva en puerta del refrigerador y del congelador,
levante y tome abajo la puerta del refrigerador, y póngala
cuidadosamente a un lado.
6. Quite los doorstoppers de las puertas del refrigerador y
del congelador.
7. Inserte el doorstopper del lado izquierdo (proporcionado en su
embalaje) en el agujero del fondo del lado izquierdo de la puerta
del refrigerador y en el agujero del fondo del lado izquierdo de la
puerta del congelador. Sujete con los tornillos
6
Español
agujeros del tornillo
tapón para la puerta del congelador
pasador- pivote en el
centro
fijación en el centro
Reinstallation: (see fig. # 3 and fig. # 4)
1. Remueva el inferior para el pasador- pivote del soporte del gozne
inferior, girándolo en la dirección opuesta a las manecillas del reloj.
Coloque luego el perno en el agujero opuesto y apriételo.
fig. # 3
fondo de la
unidad
baje el pasador- pivote
bisagra inferior
2. Remueva los tornillos que sostienen el soporte del
gozne inferior y quite el soporte.
7
PRECAUCION: Dos Personas Requirieron.
Español
3. R
emueva los tornillos que sostienen el soporte del
gozne inferior y quite el soporte.
4. Afloje los tornillos que sostienen la bisagra inferior y quítelos.
5. A
linee los agujeros del soporte del gozne inferior con los
agujeros correspondientes en el costado opuesto del gabinete,
para luego insertar y apretar sus tornillos.
6. Instale la puerta del refrigerador: haga que el orificio izquierdo de
la puerta del compartimento del refrigerador caiga sobre el eje de la
bisagra inferior, mueva la puerta hacia atrás y hacia adelante para
enderezarla y alinearla con la bisagra central. Instale la bisagra
central de nuevo, gire el eje de la bisagra hasta que entre
completamente al cuerpo de la puerta, luego fije con los tornillos.
(see fig. 4)
NOTA: Quite los enchufes de doorframe e instálelos en la otra cara.
doorstopper
(lado izquierdo)
agujeros del tornillo
fig. # 4
pasador- pivote
en el centro
fijación en el centro
7. P ara instalar la puerta del congelador: haga que el agujero del fondo
izquierdo de puerta del congelador cae sobre el árbol central de la
bisagra; levante la bisagra superior, para poder instalar el árbol de
la bisagra en el agujero superior de la parte superior de la puerta del
congelador; ajuste la puerta para hacerla recta y llana.
8
Español
Uso y Funciones Refrigerador
Características
generales
Luz interior de la sección del
refrigerador
Dial para el ajuste de la
temperatura:
Su refrigerador está equipado con una
luz interior automática en la sección de
alimentos frescos para que ubique los
alimentos con facilidad.
El refrigerador mantendrá automáticamente
el nivel de temperatura que seleccione.
El dial de control de temperatura tiene 7
configuraciones además del apagado.
1 es la más cálida. 7 es la más fría.
Si se gira el dial a la posición OFF
(APAGADO), se detiene el enfriamiento
tanto en la sección de refrigerador
como de congelador. En un primer
momento, configure el dial en 4 y deje
pasar 24 horas antes de ajustar la
temperatura como lo desee.
Para ajustar el rango de temperatura en
la configuración fría, gire el dial de la
temperatura hacia la derecha. En
condiciones de funcionamiento
normales, mantenga el dial en el medio
entre la configuración fría y la más fría.
Para su comodidad, en fábrica se
pre-configura el control según las
condiciones funcionamiento normales.
(Nota: Si el refrigerador se
ha ubicado en una posición
horizontal o inclinada durante
cualquier lapso de tiempo,
espere 24 horas antes de
enchufar la unidad).
El compartimiento del congelador está
equipado con un control ajustable del
flujo de aire. Para su comodidad, el
flujo de aire se pre-configura de fábrica
en la configuración normal. También
está la opción de regular las
configuraciones, ya sea congelamiento
bajo o congelamiento alto.
Su refrigerador puede estar equipado
con un control deslizable para subir o
bajar los niveles de humedad de sus
cajones para frutas y verduras. Esta función
aumenta la vida de almacenamiento
de frutas y vegetales. Simplemente
ajuste los controles en la configuración
adecuada para los elementos que está
almacenando en los cajones para frutas
y verduras. Las configuraciones bajas
permiten que el aire húmedo salga
del cajón, son óptimas para el almacenamiento de frutas o vegetales que
tienen cáscara. Las configuraciones altas
retienen el aire húmedo en el cajón,
son óptimas para el almacenamiento de
vegetales frescos.
Frost libera el Refrigerador-Congelador
Nunca necesite descongelar su congelador, como descongela
automáticamente cualquier aumento de hielo pueda ocurrir.
Entrepaños Interiores del Refrigerador
(Los estantes pueden variar por el Modelo)
9
Los entrepaños del refrigerador fueron diseñados pensando en usted. Su
variada ajustabilidad le permite satisfacer sus necesidades personales de
almacenaje. Su modelo puede incluir entrepaños de alambre, vidrio o
vidrio antiderrames. Su modelo puede incluir entrepaños de ancho
completo o ancho medio. Solo el tipo de modelo y su imaginación
limitan las posibilidades.
Español
Para sacar o ajustar un entrepaño deslizable no
voladizo de ancho completo: (vea la figura # 5)
1. Levante ligeramente el entrepaño y deslícelo hacia el frente hasta
sacarlo completamente.
2. Para volver a colocar el entrepaño, seleccione la ubicación deseada y
deslice cuidadosamente el entrepaño hasta que quede enganchado.
fig. # 5
Cajón para Frutas y Verduras y Cubierta
Para sacar e instalar el cajón para frutas y verduras:
(vea fig. # 6)
1. Sujete firmemente el cajón y deslícelo hacia afuera completamente.
2. V
uelva a meter el cajón colocándolo correctamente dentro de las guías
y deslizándolo cuidadosamente a su lugar.
fig. # 6
Para sacar e volver el cajón para frutas y verduras:
(vea fig. # 7)
1. Sujete cuidadosamente la cubierta del cajón y deslícela
hacia afuera para sacarla.
fig. # 7
2. Vuelva
a colocar los cajones para frutas y verduras
como se indica anteriormente.
10
Español
Información Sobre el Almacenamiento de Alimentos
Alimentos Frescos:
•C
uando almacene alimentos frescos que no vengan empacados,
asegúrese de envolverlos o almacenarlos con material a prueba de
humedad o hermético, a menos que se indique otra cosa. De esta
forma no caducarán antes de lo previsto y evitará que se contaminen
con olores y sabores.
• L impie los recipientes antes de guardarlos para evitar derrames
innecesarios.
• L os huevos deben almacenarse en posición vertical, en su caja de
cartón original para maximizar su caducidad.
• L a fruta debe lavarse y secarse, y después almacenarse en bolsas de
plástico selladas antes de guardarse en el refrigerador.
• L as verduras con cáscara deben almacenarse en bolsas o recipientes
de plástico.
• L os vegetales con hojas deberán lavarse y escurrirse, y después
almacenarse en bolsas o recipientes de plástico.
• L os alimentos calientes deben dejarse enfriar antes de meterlos al
refrigerador. Esto evitará el uso innecesario de energía.
• L os mariscos frescos deberán utilizarse el mismo día en que se compren.
•C
uando almacene carnes en la sección de alimentos frescos, manténgalas en el empaque original o vuelva a envolverlas si es necesario.
Estas son algunas sugerencias para un almacenamiento seguro:
• Pollo, de 1 a 2 días.
• Carne de res molida, de 1 a 2 días.
• Carnes frías, de 3 a 5 días.
• Bisteces/cortes para asar, de 3 a 5 días.
• Carnes ahumadas/curadas, de 7 a 10 días.
Consulte la tabla detallada de almacenamiento en el sitio web de la FDA
www.cfsan.fda.gov/~dms/fttstore.html
11
Español
Alimentos Congelados
• L impie los recipientes antes de guardarlos para evitar derrames innecesarios.
• L os alimentos calientes deben dejarse enfriar antes de meterlos al congelador. Esto evitará el uso innecesario de energía.
•C
uando almacene carnes, manténgalas en el empaque original o vuelva
a envolverlas si es necesario.
• P ara almacenar alimentos en el congelador es necesario empacarlos
correctamente. Todos los alimentos deben estar en empaques que impidan el flujo de aire o humedad hacia adentro o hacia afuera. Un almacenamiento inadecuado provocará que se transmitan olores y sabores,
los alimentos mal empacados se resecarán.
•S
iga las indicaciones de almacenamiento adecuado del empaque o del
recipiente.
• Recomendaciones de empacado:
Recipientes de plástico con tapas herméticas.
Papel aluminio de alta resistencia.
Película transparente para envolver alimentos.
Bolsas de plástico de autosellado.
• No vuelva a congelar los alimentos descongelados.
• Se recomienda que marque la fecha de congelamiento en el empaque.
Estas son algunas sugerencias para un almacenamiento seguro:
• Comidas preparadas, de 3 a 4 meses.
• Camarones, vieiras, langostinos frescos, de 3 a 6 meses.
• Hamburguesas y carne guisada, de 3 a 4 meses.
• Carne molida de pavo, ternera y cerdo, de 3 a 4 meses.
• Chuletas, de 4 a 6 meses.
• Bisteces, de 6 a 12 meses.
• Pollo o pavo, de 6 a 8 meses.
Consulte la tabla detallada de almacenamiento en el sitio web de la FDA
www.cfsan.fda.gov/~dms/fttstore.html
Ruidos de Operación Normales
•R
uido como de agua hirviendo, sonidos como de gárgaras o
pequeñas vibraciones se producen cuando el refrigerante
circula por los serpentines de enfriamiento
•E
l termostato de control produce un “Click” cuando se cierra o se
abre.
12
Español
Cuidados y Limpieza
Asecuada
Limpieza y Mantenimiento
Advertencia: Para evitar una descarga eléctrica siempre
desenchufe su refrigerador antes de limpiarlo.
El ignorar esta advertencia puede causar
esiones o la muerte.
Antes de usar productos de limpieza, siempre lea y
Precaución: siga las instrucciones y advertencias del fabricante
para evitar lesiones personales o daños al producto.
En general: • P repare una solución de limpieza de 3-4
cucharadas de bicarbonato de sodio mezclado
con agua tibia. Use una esponja o un trapo
suave, humedecidos con la solución de limpieza,
para limpiar su refrigerador.
• Enjuague con agua limpia tibia y seque con un
trapo suave.
• No use químicos fuertes, abrasivos, amoniaco,
cloro, detergentes concentrados, disolventes o
estropajos metálicos. ALGUNOS de estos
químicos pueden disolver, dañar y/o
decolorar su refrigerador.
Empaques de la puerta: • L impie los empaques de la puerta cada tres meses
de acuerdo a las instrucciones generales. Los
empaques deben mantenerse limpios y flexibles
para asegurar un sellado apropiado.
• El aplicar un poco de vaselina en el lado
articulado de los empaques mantendrá el
empaque flexible y asegurará un
sellado apropiado.
13
Español
Reemplazo del Foco
1.
2.
3.
4.
Apague el interruptor del refrigerador.
Saque el entrepaño más alto.
Permita que el foco se enfríe antes de quitarlo.
Pellizque la cubierta plástica entre dedos y pulgar y estire suavemente
a la izquierda.
5. Quite el foco destornillándolo hacia la izquierda.
6. Siempre reemplácelo con el tipo de foco incluido con la unidad,
que tenga una capacidad de 40 watts o de menor potencia.
7.
Nunca exceda los 40 watts de potencia.
8. Para reemplazar la cubierta, la adición clipes traseros en primero y
suavemente clip de frente de empujón en hasta los cierres de la
cubierta en el lugar.
Interrupciones de Energía
• P ueden ocurrir ocasionalmente interrupciones de energía debido a
tormentas eléctricas u otras causas. Desenchufe el cable eléctrico del
tomacorriente de corriente alterna cuando ocurra una interrupción en
el sistema eléctrico. Cuando la electricidad haya regresado, vuelva a
conectar el cable eléctrico a un tomacorriente de corriente alterna. Si
ocurre una interrupción en el sistema eléctrico durante un periodo
prolongado, inspeccione y deseche los alimentos descongelados o
echados a perder en el refrigerador o congelador. Limpie el
refrigerador antes de volver a usarlo.
Vacaciones y Mudanza
•D
urante ausencias largas o vacaciones, vacíe la comida del
refrigerador y congelador, coloque el DIAL de temperatura a la posición
de "OFF" (apagado) y limpie el refrigerador y los empaques de la
puerta de acuerdo a la sección de "Limpieza general". Mantenga
las puertas abiertas para que el aire pueda circular en el interior. Al
mudarse, siempre traslade el refrigerador verticalmente. No lo traslade
con la unidad colocada horizontalmente. Pudiera ocurrir un posible
daño el sistema sellado.
ATTENTION: S
I EL CORTE SE PRODUCE DURANTE UN PERÍODO
PROLONGADO, INSPECCIONE Y DESCARTE LOS
ALIMENTOS QUE SE ECHARON A PERDER O SE
DESCONGELARON EN EL CONGELADOR. LIMPIE EL
CONGELADOR ANTES DE USARLO NUEVAMENTE.
14
Español
Verificación de Problemas
El Refrigerador no Funciona:
•R
evise que el control del termostato no esté en la posición de "OFF"
(apagado).
• Revise que el refrigerador esté conectado.
• Revise que haya corriente eléctrica en el tomacorriente de
corriente alterna, revisando el interruptor de circuito.
La temperatura de los alimentos parece estar
demasiado tibia:
• Apertura constante de la puerta.
• Dele tiempo a los alimentos tibios para que puedan alcanzar una
temperatura fresca o de congelación.
• Revise que los empaques estén bien sellados.
• Ajuste el control de temperatura al ajuste más frío.
La temperatura de los alimentos es demasiado fría:
•S
i el ajuste del control de temperatura es muy frío, ajústelo a una
temperatura más cálida y permita que pasen varias horas hasta
que la temperatura se ajuste.
El refrigerador se enciende frecuentemente:
•E
sto puede ser normal para mantener una temperatura constante durante
temperaturas altas y días húmedos.
• Las puertas pudieron haberse abierto frecuentemente o durante un
largo periodo de tiempo.
• Revise que el empaque esté bien sellado.
• Revise que las puertas estén completamente cerradas.
Acumulación de humedad en el interior o exterior
del refrigerador:
• Esto es normal durante periodos de alta humedad.
• Apertura constante o prolongada de la puerta.
• Revise que los empaques de la puerta estén bien sellados.
El refrigerador despide un olor:
• Necesita limpiar el interior.
• Los alimentos envueltos o sellados inadecuadamente están
despidiendo los olores.
La luz del refrigerador no funciona:
• Revise el suministro eléctrico.
• Apriete el foco en el zócalo.
• Reemplace el foco fundido.
La puerta del refrigerador/congelador no
cierra correctamente:
15
• Nivele el refrigerador.
• Vuelva a alinear la puerta del refrigerador/congelador.
• Revise que no haya obstrucciones como contenedores de alimentos, la
cubierta del cajón para frutas y verduras, entrepaños, recipientes, etc.
Español
Garantía Limitado
¿Qué está cubierto y por
cuánto tiempo?
Esta garantía cubre cualquier defecto en
la manufactura o empleo de materiales
por un plazo de:
12 meses de mano de obra
12 meses en componentes
5 años en el sistema sellado
La garantía comienza en la fecha de
compra del artículo, y la factura original
de compra debe presentarse al centro
de servicio autorizado para poder
efectuar cualquier reparación que esté
bajo garantía.
EXCEPCIONES: Garantía por Uso
Comercial o Bajo Arrendamiento
90 meses en mano de obra
(únicamente en taller)
90 días en componentes
Ninguna otra garantía es válida
¿Qué está cubierto?
1. Los componentes mecánicos y
eléctricos que cumplen con alguna
función de este aparato durante un
plazo de 12 meses. Esto incluye
cualquier componente con excepción
acabados y molduras.
2. Los componentes del sistema sellado,
como por ejemplo: compresor
hermético, condensador, y
evaporador, por defectos de
manufactura durante un plazo de 5
años a partir de la fecha de compra.
Cualesquier daños a tales
componentes causados por abuso
mecánico o manejo o transportación
inadecuada no serán cubiertos.
¿Qué se hará?
1. Repararemos o reemplazaremos, a
discreción nuestra, cualquier
componente mecánico o eléctrico que
se muestre defectuoso por uso normal
durante el plazo así especificado.
2. No habrá cargos para el comprador
por las partes y la mano de obra
en cualesquier artículos cubiertos
durante el periodo inicial de 12
meses. Al término de este periodo
solo las partes son cubiertas en la
garantía restante. La mano de obra
no está provista y debe ser cubierta
por el cliente.
3. L ocalice su centro de servicio
autorizado más cercano. Para
conocer el nombre del centro de
servicio más próximo a su domicilio,
por favor llame al 1-877-337-3639
(Válido solo en E.U.A).
ESTA GARANTIA CUBRE
APARATOS DENTRO DEL
TERRITORIO CONTINENTAL DE
LOS ESTADOS UNIDOS, PUERTO
RICO Y CANADÁ.
Daños por instalación inadecuada.
Daños por transportación.
Defectos que no sean por manufactura.
Daños por negligencia, abuso,
accidente, alteraci-ón, falta de cuidado
adecuado y de mantenimiento, o
conexión a tensión eléctrica incorrecta.
Daños que no sean por uso doméstico.
Daños por servicio que no sea
proporcionado a través de un
distribuidor o centro de servicio
autorizado. Molduras decorativas o
focos reemplazables.
Envío y transportación.
Mano de obra (después de los primeros
12 meses).
ESTA GARANTIA LIMITADA ES
PROVISTA EN SUSTITUCION A
CUALQUIER OTRA GARANTIA
EXPRESADA O QUE IMPLIQUE LAS
GARANTIAS MERCANTILES SUJETAS A
CIERTO PROPOSITO.
El amparo provisto por esta garantía es
de uso exclusivo y se otorga en
sustitución a cualquier otro amparo.
Esta garantía no cubre daños
incidentales o sus derivados, por lo que
las anteriores restricciones pueden serle
ajenas. En ciertos estados no se
permiten restricciones en lo que se
refiere a la duración implícita de una
garantía, por lo que las anteriores
restricciones pueden serle ajenas.
Esta garantía le otorga ciertos derechos
legales y es posible que usted goce de
otros derechos, los cuales varían de
estado a estado.
Haier America
New York, NY 10018
16
IMPORTANT
Do Not Return This Product To The Store
If you have a problem with this product, please contact the
“Haier Customer Satisfaction Center” at 1-877-337-3639.
DATED PROOF OF PURCHASE, MODEL # AND SERIAL # REQUIRED FOR
WARRANTY SERVICE
IMPORTANT
Ne pas renvoyer cet appareil au magasin.
Si vous avez un problème avec cet appareil, veuillez contacter
le service à la clientèle de Haier au 1-877-337-3639.
IL EST OBLIGATOIRE DE FOURNIR UNE PREUVE D’ACHAT DATÉE, LE NUMÉRO DU MODÈLE
ET SON NUMÉRO DE SÉRIE AFIN DE BÉNÉFICIER DE LA COUVERTURE DE LA GARANTIE.
IMPORTANTE
No Devuelva Este Producto al Establecimiento Compra.
Si tiene problemas con este producto, por favor póngase en contacto con el
“Centro Haier de Atención al Cliente” en el 1-877-337-3639.
PARA EL SERVICIO DE GARANTÍA SE REQUIERE PRUEBA DE COMPRA, FECHADA,
No. DE MODELO Y No. DE SERIE
115 V, 60 Hz
Made in China
Fabriqué en Chine
Hecho en China
Haier America
New York, NY 10018
Printed in China
HA10TG20S
Issued June 2012
© 2012 Haier America Trading, LLC.
12/1/13
Shop Haier 10.3-cu ft Top-Freezer Refrigerator (Stainless Steel) at Lowes.com
Your Store:
Iwilei - Honolulu, HI
Your Store: Honolulu, HI
FREE
Store Pickup
Your order can be available for pickup
in Low e's Of Iw ilei - Honolulu, HI
today.
Haier 10.3-cu ft T op-Freezer
Refrigerator (Stainless Steel)
Item #: 150646 | Model #: HA10TG20SS
FREE
Lowe's Truck Delivery
Your order w ill be ready for delivery to
you from your selected store.
$479.00
Parcel Shipping
Get 5%* Off Every Day or Special Financing**
Minimum Purchase Required
Tw eet
0
Unavailable for This Order
Sent by carriers like UPS,
FedEx, USPS, etc.
Haier 10.3-cu ft TopFreezer Refrigerator
(Stainless Steel)
0
Description
10.3-cu ft Top-Freezer Refrigerator (Stainless Steel)
3 full-width adjustable spill proof glass shelves
1 full-width door shelf
1 half-width gallon door shelf
2 half-width door shelf
6 Dispense a Can storage systems
Reversible door
Interior light
Full-width humidity controlled crisper
1 additional full-width glass freezer shelf
$479.00
3-Year Major
Appliance
Extended
Protection Plan
($200-$499.99)
$59.97
5-Year Major
Appliance
Extended
Protection Plan
($200-$499.99)
$99.97
Specifications
Appliance Color/Finish
Stainless
steel
Freezer Baskets
0
Overall Capacity (Cu. Feet)
10.3
Freezer Shelves
1
Refrigerator Capacity (Cu. Feet)
7.77
Freezer Door Style
Sideswing
Freezer Capacity (Cu. Feet)
Door Texture
2.51
Frost-Free
Yes
Smooth
ENERGY STAR Qualified
No
Door Style
Flat
CEE Tier Qualified
N/A
Hidden Hinge
No
Height to Top of Case (Inches)
59.21
Handle Type
Integrated
Height to Top of Door Hinge (Inches)
59.61
Water Filtration
No
Width (Inches)
23.625
Dispenser Options
N/A
Depth (Including Handles) (Inches)
26.61
Child Safety Locks
No
Depth (Excluding Handles) (Inches)
26.61
Water Filter Indicator
No
Depth (Less Door) (Inches)
23.42
Door Alarm
No
Depth with Door Open (Inches)
48.21
Dispenser Light
No
Manufacturer Color/Finish
Ice Maker
None
Stainless
steel
Air Filtration
No
Cabinet Color
Black
Dual Evaporator Cooling System
No
Door Handle(s) Color
Stainless
steel
Refrigerator Interior Lighting
Incandescent
Toe Grille Color
Black
Electronic Temperature Control
No
Reversible Door
Yes
Custom Door Kit Compatible
No
Shelf Options
Adjustable
spillproof
glass
shelves
Manufacturer's Warranty (Labor)
1-year
www.lowes.com/pd_150646-33112-HA10TG20SS_0__?productId=4764496
1/2
12/1/13
Shop Haier 10.3-cu ft Top-Freezer Refrigerator (Stainless Steel) at Lowes.com
shelves
Manufacturer's Warranty (Parts)
1-year
Lowe's Exclusive
Yes
Color/Finish Family
SteelStainless
3.0
CSA Safety Listing
No
Yes
ETL Safety Listing
No
Humidity-Controlled Crispers
1
UL Safety Listing
Yes
Freezer Door Bins
0
ADA Compliant
No
Freezer Door Shelves
2
Series
N/A
Snack/Deli Drawer
No
Temperature Controlled Drawer
No
Pantry Drawer
No
Door Shelves
Gallon Door Storage
© 2013 Lowe's. All rights reserved. Lowe's and the gable design are registered trademarks of LF, LLC
www.lowes.com/pd_150646-33112-HA10TG20SS_0__?productId=4764496
2/2

Documentos relacionados