Casos de RRPP - Comunicación Profesional

Comentarios

Transcripción

Casos de RRPP - Comunicación Profesional
 Introducción: Por qué el EIKON es el premio más codiciado para los profesionales de comunicación y PR Si usted es un profesional dedicado a la comunicación institucional, los asuntos públicos, la comunicación política, las relaciones públicas, la publicidad o el marketing, lo invito a analizar los 72 casos ganadores de la edición 2010 de los Premios EIKON a la excelencia en la comunicación institucional que organiza la revista IMAGEN (www.relacionespublicas.com) en esta adaptación especial para iPad. Son una muestra de lo mejor que se hizo en la Argentina y el mundo de habla hispana en campañas de estas disciplinas. Espero que le sirva para su formación, inspiración y benchmarking y, por qué no, de aliento para atreverse a competir por el premio más prestigioso del sector de la comunicación institucional en el mundo de habla hispana. El origen Antes empezar, le explico de qué se tratan los Premios EIKON a las mejores campañas de comunicación institucional y PR: esos esfuerzos de empresas y consultoras que, a diferencia de las campañas SXEOLFLWDULDV UDUD YH] VH ³YHQ´ SHUR FRQWULEX\HQ D TXH HPSUHVDV PDUFDV 21* JRELHUQRV SDUWLGRV
políticos y celebridades tengan mejor imagen, más visibilidad y mejor reputación. Algo de etimología: eikon (pronunciado correctamente Ikon) en griego significa ícono, imagen. Al reverso de la estatuilla que reciben los ganadores está la inscripción ethos, ética, porque consideramos que no debiera haber buena imagen sin ética profesional. El premio lo otorga la revista especializada en PR y comunicación desde 1998. A lo largo de estos 13 años, cientos de postulaciones evaluadas favorablemente por el jurado han sido premiadas, y esto ha contribuido a que los profesionales ganadores obtengan mejor visibilidad y respeto entre sus pares de la profesión y dentro de sus organizaciones. El premio ha contribuido también significativamente a destacar esa labor muchas veces invisible de los profesionales de las PR. El premio comenzó a galardonar en los primeros años a los profesionales en poco más de una decena de categorías o disciplinas. Las más comunes: Relaciones con los Medios, Relaciones con la Comunidad (para muchos conocida como RSE), Asuntos Públicos, Comunicaciones de Crisis, Publicidad Institucional, Comunicación Interna, Eventos y Lanzamientos, Comunicación Digital o Comunicaciones con los Inversores. Años más tarde se fueron agregando categorías, como las vinculadas a campañas políticas y comunicaciones de gobierno. En los últimos años, viendo que las empresas pequeñas y medianas tenían a veces dificultades en competir con las grandes, los EIKON sumaron un capítulo especial para Pymes: esto garantiza que las Pymes puedan competir entre sí y no con grandes grupos empresarios. En 2006 se sumaron los EIKON Jr. que, a diferencia de los EIKON tradicionales, convoca a estudiantes del último año de las carreras de Relaciones Públicas, Ciencias de la Comunicación y afines a presentar un plan de comunicación para una propuesta determinada. Así, en los últimos años los alumnos de distintas universidades han trabajado consignas tales como un programa para mejorar la imagen argentina en el exterior, un plan de comunicación para mejorar la imagen del sector agrario, cómo mejorar la imagen del profesional de comunicación en la sociedad y una campaña de comunicación para el sector minero. Y desde 2010 los EIKON, que originalmente eran un premio exclusivamente para campañas realizadas en Argentina, se ampliaron a todo el mundo de habla hispana. Esto incluye América latina, España y el mercado hispano de los Estados Unidos. Cómo ganar En http://www.relacionespublicas.com/?page=Bases&id=17, las bases explican no sólo qué abarca cada categoría, sino también cómo presentar más convenientemente el desarrollo del caso, con una enunciación del planteo o desafío, una descripción del plan y su ejecución y desarrollo y, finalmente, una enumeración de resultados y logros comprobables. Todo este trabajo debe tener una extensión máxima y puede contar con material de apoyo. Desde 2010 las presentaciones se hacen digitalmente. Si bien la digitalización SRGtDSDUHFHUSDUDDOJXQRVFLHUWDOLPLWDFLyQSDUDWUDGLFLRQDOHVSRVWXODQWHVDORV(,.21HQIRUPDWR³ItVLFR´
en la mayoría de los casos significó un enorme ahorro en el costo de las presentaciones. Cómo se desarrolla el proceso de los EIKON. Anualmente, la revista IMAGEN nombra un jurado, destacado por su prestigio profesional. Mayormente se trata de directivos de PR de empresas, consultores, publicitarios, periodistas y consultores políticos. El jurado va rotando año a año y fue creciendo de media docena a más de treinta, a medida que crecieron las postulaciones: en el primer año fueron 25. En 2010, más de 200. Los jurados se reúnen en dos oportunidades: para distribuir las postulaciones según los intereses y expertise de cada miembro de la jury. La tarea de asignación de trabajos a evaluar se realiza entre los miembros del jurado, los integrantes de la revista y el coordinador académico del premio (en estos últimos años, el Dr. Federico Rey Lennon). Los miembros del jurado deben evaluar categorías completas para que sus calificaciones guarden relación entre todos los postulantes. Durante la tarea de distribución de las diferentes categorías se verifica también que no se produzcan conflictos de interés tales como que ningún jurado evalúe ni a clientes propios ni a competidores. Los integrantes de IMAGEN no participan del jurado ni intervienen en la evaluación. La aspiración de IMAGEN es que no menos de cuatro jurados evalúen cada categoría para garantizar la mayor dispersión posible en las calificaciones (del 1 al 10). Oro, plata, azul Muchas veces surgió la pregunta: ¿pueden empresas u organizaciones vinculadas directa o indirectamente a miembros del jurado presentarse a los Eikon? La respuesta es sí: pero siempre y cuando ese miembro del jurado no juzgue esa categoría. Como las evaluaciones en el EIKON las realizan los jurados en total soledad y no grupalmente, queda garantizada la independencia del juicio. Finalmente, los jurados se vuelven a encontrar solamente para entregar sus calificaciones. Los ganadores surgen así del promedio que obtuvieron de todos los jurados: el primero obtiene una estatuilla de oro;; el segundo, de plata, y el tercero, azul. No hay desempate, por lo que puede haber excepcionalmente más de un primero, segundo o tercer puesto. Para completar el proceso las evaluaciones que entregan los jurados son certificadas ante escribano público que garantiz así la transparencia del proceso. Sin embargo, se establece un piso por debajo del cual ningún postulante puede ser premiado: el promedio general de todos los trabajos presentados. La postulación que obtenga un tercero, segundo o incluso primer puesto que no alcance, como mínimo, el promedio general, no accede al premio. De esa manera se evita que un trabajo considerado pobre no llegue a obtener un premio en una categoría que accidentalmente contó con pocas postulaciones. En el capítulo Pymes se calcula un promedio separado para ese grupo de postulantes. Los nombres de los jurados se dan a conocer públicamente desde el inicio del proceso, pero se mantiene en reserva cómo se distribuyeron las postulaciones a evaluar para garantizar la independencia del jurado y que no reciba ni pedidos ni presiones externas. Finalmente, se dan a conocer y se publican los casos ganadores, ya que los postulantes aceptan haber leído las bases, en las que se especifica que, en caso de ganar, ceden a IMAGEN los derechos para su posterior publicación digital o impresa. Los casos perdedores se mantienen en reserva. ¿Cuál es el período de validez de las presentaciones? La campaña debe haber estado activa dentro de los dos años anteriores a la fecha de cierre de inscripción. Así, para la edición 2011, por ejemplo, se pueden presentar casos de 2010 y hasta 2009. Postulaciones que no ganaron en esas ediciones pueden volver a presentarse mientras su vigencia respete ese plazo de validez. Obviamente, casos ganadores no pueden volver a presentarse, excepto que la postulación esté justificada por diferencias claras en el planteo o la ejecución de la campaña. Los tiempos El proceso de premiación es un esfuerzo que lleva buena parte del año: a inicios del año se lanza la convocatoria, hacia mediados de año, tras el cierre de inscripción, se reúne el jurado para la distribución de postulaciones, unas cinco semanas más tarde se produce la evaluación;; se dan a conocer los resultados y, generalmente en septiembre u octubre, se realiza la entrega en la célebre Noche de los EIKON. Posteriormente se publican los casos ganadores en la revista IMAGEN. El jurado de los EIKON Jr. se forma con algunos voluntarios del propio jurado al que se suman representantes académicos de distintas universidades. Durante el año el EIKON FRQWLQ~DFRQXQDYDULHGDG GH³GHVILOHV´GHORVFDVRVJDQDGRUHV
Tradicionalmente, al inicio del año la Universidad de Palermo, en Buenos Aires, alberga el mayor desfile de casos ganadores en un evento conjunto de dos jornadas. Sin embargo la Universidad Argentina de la Empresa (UADE) suele invitar cerca de mediados de año a ganadores a exponer sus casos. La estatuilla Para finalizar: un poco de historia sobre la codiciada estatuilla que adorna vitrinas en empresas, consultoras e instituciones en Argentina y toda la región: El actual rediseño es una realización en equipo de la artista plástica Nora Iniesta y el estudio de diseño Xumano. La primera versión de la estatuilla correspondía al escultor Leo Vinci. En ambos casos apuntaban a destacar lo mismo: excelencia y transparencia. Jurado EIKON 2010 Pablo Abiad -­ Llorente & Cuenca Bárbara Anderson ± CNN ± Jurado Internacional Gustavo Averbuj -­ Ketchum Arg. Francisco Javier Celedón -­ Icc Crisis ± Jurado Internacional Carlos Chávez Del Valle -­ Bagó Belén Daghero -­ Mars Cono Sur Laura Echezarreta -­ Consultora De Comunicación Martín Etchevers -­ Grupo Clarín Carlos Fara -­ Carlos Fara y Asoc. Carmen Beatriz Fernández ± Datastrategia ± Jurado Internacional Marcela Goldin -­ Goldin R&P -­ GCABA Fernando Hoffman -­ Kimberly-­Clark Ana Jacoby -­ Fund Konrad Adenauer Lucila Maldonado -­ Metrovías Carlos Mazalán -­ Mazalán Comunicaciones Pedro Naón Argerich -­ Vincit Argentina Ramón Ponce Gil -­ Grupo Telefónica Pablo Querol -­ Lan Argentina Eduardo Reina -­ Estudio De Comunicación Belén Salvador -­ Consultores Del Plata Diego Serrano -­ Diego Serrano & Asoc. Corina Tareni -­ Nueva Comunicación Diego Videla -­ Banco Galicia Alicia von der Wettern -­ Personally Jurado EIKON Junior 2010 Pedro Naón Argerich Verónica Cheja ± Urban PR Soledad Rodríguez -­ UP Pablo Querol ± Lan Argentina Elisabet Taddei -­ UP CATEGORÍAS El Premio EIKON tiene 18 categorías y diversas subcategorías. Toda organización (empresas, ONG, organismos públicos) que se presente podrá hacerlo declarando si se trata de una empresa grande, de una PyME o de una ONG. Definición de ONG: Una organización no gubernamental es una entidad de carácter privado, con fines y objetivos humanitarios y sociales definidos por sus integrantes, creada independientemente de los gobiernos locales, regionales y nacionales, así como también de organismos internacionales. Esto no incluye instituciones u organizaciones políticas, gremiales y empresarias dedicadas a la gestión de intereses sectoriales, en última instancia la coordinación académica del PREMIO se reserva el derecho de admitir o rechazar las postulaciones dentro de esta subdivisión. El coordinador académico se reserva el derecho de aceptar la postulación a la categoría PyME. En caso de desacuerdo, la presentación podrá concursar en la categoría regular. Categoría 1: campaña general de comunicación institucional Esta categoría apunta sólo a aquellas presentaciones que contemplen programas destinados a diversos públicos y con múltiples acciones que tengan una coherencia unificadora. Excepcionalmente en esta categoría los trabajos podrán alcanzar un máximo de 12 carillas. (Máximo 30.000 caracteres). Categoría 2: relaciones con la comunidad/RSE Programas de comunicación y responsabilidad social empresaria o patrocinio social dirigidos a la comunidad en la cual está inserta la organización. Categoría 3: asuntos públicos/lobbying Programas desarrollados para la comunicación con los poderes ejecutivo y legislativo con el objetivo de influir en decisiones ejecutivas y legislativas en todos los niveles de administración (nacional, provincial y municipal). Categoría 4: relaciones con la prensa Programas de comunicación directamente enfocados a los medios de comunicación y periodistas. Categoría 5: comunicación en situación de crisis Planes y acciones para enfrentar y resolver las crisis que puedan afectar a las organizaciones, públicos internos y externos. Categoría 6: comunicación de identidad corporativa Programas de identidad (en lo visual y conceptual) que identifiquen y propongan la comunicación de una organización a nivel corporativo. Categoría 7: comunicación interna Planes de comunicación indoor para el personal de la compañía o institución. El plan puede ser global o parcial (v.g. house organ, intranets, etcétera). Categoría 8: issues management Análisis y gestión preventiva de temas políticos y sociales que puedan afectar los negocios y la imagen de la empresa. Categoría 9: patrocinio o sponsoring cultural Programas institucionales de auspicio cultural, mecenazgo y filantropía. Categoría 10: comunicaciones financieras o con los inversores Puede incluir relaciones con analistas, periodistas especializados, accionistas, inversores, o acciones puntuales, como balances, annual reports, road shows, etcétera. Categoría 11: eventos Incluye la planificación, organización y difusión en los medios de eventos y otras actividades relacionadas, así como los eventos mismos en su concepción y realización en tanto se entiendan como acciones de comunicación con diversos objetivos. Categoría 12: lanzamiento de productos Incluye la planificación, organización y difusión en los medios de lanzamientos de productos y/servicios. Categoría 13: internet/social media Diseño de páginas web corporativas: concepto corporativo, servicios. Los participantes deberán presentar los objetivos y resultados de la página conforme al esquema de presentación de las categorías anteriores y la dirección de la página para que los miembros del jurado puedan visitarla. (En esta categoría podrán participar diseñadores gráficos, agencias de publicidad, empresas especializadas en desarrollos de este tipo de servicios informáticos y consultoras de RR.PP.). Categoría 14: publicidad institucional, campaña general Además de la presentación formal del trabajo, los participantes en esta categoría deberán acompañarlo con las piezas publicitarias gráficas y/o audiovisuales Subcategoría 14.1 Publicidad institucional televisiva Subcategoría 14.2 Publicidad institucional radial Subcategoría 14.3 Publicidad institucional gráfica Subcategoría 14.4 Publicidad institucional on line Categoría 15: publicaciones institucionales/multimedia Todo tipo de trabajos de gráfica, audio, video y multimedia. (v.g. libros institucionales, revistas, videos, cd-­roms, brochures, etcétera). Categoría 16: relaciones con los consumidores Referida a acciones y campañas de fidelización y satisfacción de clientes Capítulo Comunicación política: Categoría 17: comunicación política, de gobierno y campañas electorales Comprende planes y estrategias de comunicación política aplicadas a campañas electorales presidenciales, provinciales, legislativas o municipales sean éstas enfocadas al posicionamiento de un candidato o de un partido político. Podrán participar programas de relaciones con los medios, grassroots, avisos publicitarios, Internet u otros. Se incluye también campañas de comunicación de la gestión gubernamental. Subcategoría 17.1 comunicación en campañas electorales Subcategoría 17.2 comunicación de la función pública Categoría 18: marketing social Se refiere a campañas de publicidad y comunicación de gobiernos, empresas u ONG tendientes a modificar comportamientos sociales y promover el cambio de actitudes (por ejemplo: para mejorar la conducta vial, la alimentación, la no discriminación y otros). Cada categoría podrá recibir premios EIKON oro y plata y bronce, de acuerdo con su calificación. El jurado se reserva el derecho de declarar desierta alguna/s categoría/s, cuando el puntaje de los ganadores no alcanzare el promedio general o un nivel comparativo aceptable. Los miembros del jurado podrán presentar trabajos absteniéndose de calificarlos. El jurado también deberá abstenerse de calificar trabajos de organizaciones con las que estén directamente vinculados (vg.:clientes, empleadores y competencia directa). Coordinador académico: Federico Rey Lennon , Universidad Católica Argentina GANADORES CATEGORÍA GENERAL Categoría 1: Campaña General de Comunicación Institucional 1. TETRA PAK ± PERSONALLY ² ³3$548(1$9,'(f25(&,&/$'27(75$3$.´ 2. ASOCIACIÓN DE ARTISTAS PINTORES CON LA BOCA Y EL PIE ± LLORENTE & CUENCA ² ³08(675$
,17(51$&,21$/'($57((1%8(126$,5(6´ 3. GOOGLE ± MAZALÁN COMUNICACIONES ² ³321,(1'2$/868$5,2(1(/&(1752'(/$(6&(1$´ 3. LA RURAL ² ³)257$/(&,0,(172'(/$,0$*(1,167,78&,21$/'(/$585$/´ Categoría 2: Relaciones con la Comunidad 1. PHILIPS ± KETCHUM ARGENTINA ² ³(/&$0,Ï1'(/$08-(5´ 2. COCA-­COLA/WALMART/UNIDAD COM/URBAN PR ² ³237,0,60248(75$16)250$´ 3. ARCOS DORADOS ARGENTINA ² ³(03/(2&21$32<2´ Categoría 3: Asuntos Públicos y Lobbying 1. UNICEF ² ³/$35(9(1&,Ï1'(/$*5,3($(1(0%$5$=$'$635,25,'$'´ 2. CERVECERÍA Y MALTERÍA QUILMES ² ³&25325$7($))$,56)8//352-(&7´ 3. ROCHE ± LLORENTE & CUENCA ² ³&212&(53$5A ACTUAR. CONCIENTIZANDO SOBRE LOS '(5(&+26'(/263$&,(17(6&21(/&È1&(5'(0$0$´ Categoría 4: Relaciones con la Prensa 1. FUNDACIÓN TEMAIKÉN ² ³326,&,21$0,(172'(/%,23$548(´ 2. PRICEWATERHOUSECOOPERS ² ³352*5$0$(-(&87,923:&3$5$3(5,2',67$6´ 3. MOTOROLA ± COLOMBO-­PASHKUS ² ³6(*85,'$'3Ò%/,&$´ Categoría 5: Comunicación en Situación de Crisis 1. UNICEF ² ³3/$1'(&2081,&$&,Ï13$5$/$5(638(67$$/$(0(5*(1&,$(1+$,7Ë´ 2. METROVÍAS ± BURSON MARSTELLER ² ³68%7(6&5($&,Ï1'(8118(926,1',&$72´ Categoría 6: Comunicación de Identidad Corporativa 1. ARCOS DORADOS ARGENTINA/ GRUPO OXEAN ² ³&$03$f$'(&2081,&$&,Ï162%5(0,6,Ï1
9,6,Ï1</269$/25(6'(/$&203$fË$´ 2. AMIA ± BASEVICHCREA ² ³0$'5(´ Categoría 7: Comunicación Interna 1. UNILEVER ² ³(0%$/$'26´ 2. KRAFT -­ FORO 21 ² ³<29,6,7e/$3/$17$'(.5$)7)22'6(13$&+(&2´ 3. EDESUR ² ³$%5Ë/262-26´ Categoría 8: Issues Management 1. LA RURAL ² ³/$585$/7(&8,'$´ 2. BANCO GALICIA ² ³'(0$<2'(81$$5*(17,1$326,%/(´ Categoría 9: Patrocinio o Sponsoring Cultural 1. TETRA PAK ± PERSONALLY ² ³3$548(1$9,'(f25(&,&/$'27(75$3$.´ 2. BANCO CENTRAL DE LA REPÚBLICA ARGENTINA ² ³35(0,21$&,21$/'(3,1785$%$1&2&(175$/´ 3. LA RURAL ² ³,038/6$57(352*5$0$'((67Ë08/2$/$57(&217(0325È1(2´ Categoría 10: Comunicaciones Financieras o con los Inversores 1. MOLINOS RÍO DE LA PLATA ² ³81$0(025,$&21/20(-25'(02/,126´ 2. TGS ± MACRINI MENENDEZ ² ³5(3257('(6867(17$%,/,'$'<0(025,$<%$/$1&(
´ 3. TGN ± MACRINI MENENDEZ ² ³7*109 ± 0(025,$<(67$'26&217$%/(6´ Categoría 11: Eventos 1. TED X BUENOS AIRES ± MUCHNIK, ALURRALDE, JASPER & ASOCIADOS/ MS&L ² ³7(';%8(126
$,5(6´ 2. UNIVERSIDAD DE LA PUNTA ± MAZALÁN COMUNICACIONES ² ³6$1/8,6',*,7$/± UN ENCUENTRO TECNOLÓGICO DE &$5$$/$*(17(´ 3. ALDEAS INFANTILES SOS ARGENTINA ² ³3,17$1'2&2178$57,67$´ Categoría 12: Lanzamiento de Productos 1. FUNDACIÓN TEMAIKÉN ² ³/$1=$0,(172'((//8*$5'(/$6$9(6(/$9,$5,20È6*5$1'('(
/$7,12$0e5,&$´ 2. ROCHE ± LLORENTE & CUENCA ² ³EL TIEMPO CUENTA. LANZAMIENTO DE ACTEMRA EN LA $5*(17,1$´ 3. NATURA COSMÉTICOS ± MUCHNIK, ALURRALDE, JASPER Y ASOCIADOS/ MS&L ² ³/$1=$0,(172'(/
3(5)80(1$785$+8025(1%$):((.´ Categoría 13: Internet ± Social Media 1. MARS PEDIGREE ² ³$'23&,Ï13(',*5((´ 2. GAS NATURAL BAN ² ³&$03$f$('8&$7,9$'(&2081,&$&,Ï1',*,7$/(1/$65('(662&,$/(6
9,9Ë6,1021Ï;,'2´ 3. MICROSOFT ± FORO 21 ² ³'2&(17(6,1129$'25(61(7´ Categoría 14: Publicidad Institucional ± Campaña General 1. MASTERCARD ² ³%,&,&/(7$´ 2. DELOITTE ² ³&$03$f$38%/,&,7$5,$*5((1'27´ 3. PIERO ² ³3,(5263216252),&,$/'(/68(f2$5*(17,12´ Categoría 14 ± Subcategoría 3: Publicidad Institucional Gráfica 1. MOLINOS RÍO DE LA PLATA ² ³´ 2. FUNDACIÓN MUNDO SIN GUERRAS ± BASEVICHCREA ² ³/$3$=(6'(/269$/,(17(6´ Categoría 15: Publicaciones Institucionales 1. FIAT ARGENTINA ² ³+20(1$-('(),$7(1686$f26´ 2. DELOITTE ² ³-­/2635,0(526$f26'('(/2,77((1$5*(17,1$´ 3. KIMBERLY CLARK ² ³5(3257('(6867(17$%,/,'$'´ Categoría 16: Relaciones con los Consumidores 1. PANTENE ± PERSONALLY ² ³3(/23$17(1(´ 2. COCA COLA ± URBAN PR ² ³7523+<7285´ 2. PALADINI ± NUEVA COMUNICACIÓN ² ³&8$1'2126-817$026&+(´ 3. ASOCIACIÓN FABRICANTES ARTESANALES DE HELADO Y AFINES ± TRES CONSULTORES ² ³$FADHYA 9,9((/%,&(17(1$5,2´ Categoría 17 ± Subcategoría 2: Comunicación de la Función Pública 1. PARTIDO ACCIÓN MARPLATENSE ± CARLOS FARA & ASOCIADOS ± YA! PUBLICIDAD ² ³3/$1'(
COMUNICACIÓN DE LA GESTIÓN DE LA MUNICIPALIDAD DEL PARTIDO DE GENERAL PUEYRREDÓN (MAR '(/3/$7$´ 2. MINISTERIO DE TRABAJO, EMPLEO Y SEGURIDAD SOCIAL ² ³8138(17(+$&,$0È6<0(-25
75$%$-2´ Categoría 18: Marketing Social 1. PHILIPS ± FORO 21 ² ³&8,'(026(/3/$1(7$$+255$1'2(1(5*Ë$´ 2. TETRA PAK ± FORO 21 ² ³3527(*((/0(',2$0%,(17(-8*$1'2&217(75$3$.´ 3. OXY ARGENTINA ± UNIDAD COM ² ³9$/25$518(6752/8*$5´ CATEGORÍA GENERAL -­ PYMES Categoría 1: Campaña General de Comunicación Institucional 1. MATER CELL ± MAURO & ESTOMBA ² ³(/)$/62',/(0$´ Categoría 4: Relaciones con la Prensa 1. FEDERACIÓN DE ASOCIACIONES Y CÁMARAS DE ASCENSORES DE LA REPÚBLICA ARGENTINA ± CANIZA COMUNICACIÓN ² ³3258175$163257('(9(57,&$/6(*852´ Categoría 6: Comunicación de Identidad Corporativa 1. ELECTROMAK ± MIRELA HIDALGO ² ³,'(17,'$'(/(&7520$.´ Categoría 9: Patrocinio o Sponsoring Cultural 1. VEKA LATINA ² ³&203520,629(.$0È6$+2552(1(5*e7,&2´ Categoría 14: Publicidad Institucional 1. SAMSA ² ³6,0,/,78'(6´ Categoría 16: Relación con los Consumidores 1. ARANDÚ ² ³$5$1'Ò52'$17(&$/,'$'48(9,$-$$72'2(/3$Ë6´ 2. PROKRETE ± VISIÓN EMPRESARIAL ² ³352.5(7(810$18$/3$5$(/&216758&725´ CATEGORÍA REGIONAL Categoría 1: Campaña General de Comunicación Institucional 1. YANBAL ± MORA Y ARAUJO ² ³6(1625<$1%$/'(/$08-(5´ 2. UNIVERSIDAD EARTH -­ KETCHUM ² ³($57+6,(0%5$(/)87852´ Categoría 4: Relaciones con la Prensa 1. MOTOROLA -­ COLOMBO PR ² ³&,8'$'(6',*,7$/(6´ Categoría 7: Comunicación Interna 1. TELEFÓNICA DE LATINOAMÉRICA ± LLORENTE & CUENCA ² ³&2081,&$´ Categoría 11: Eventos 1. UNIVERSIDAD EARTH ± KETCHUM ² ³($57+6,(0%5$(/)87852´ Categoría 13: Internet ± Social Media 1. UNIVERSIDAD EARTH ± KETCHUM ² ³($57+6,(0%5$(/)87852´ 2. MASTERCARD ± PERSONALLY ² ³352*5$0$&216802,17(/,*(17(´ Categoría 15: Publicaciones Institucionales 1. DIRECTV ± HT CONTENIDOS ² ³5(9,67$$&&(66',5(&79/$7,12$0e5,&$´ Categoría 16: Relaciones con los Consumidores 1. MASTERCARD ± 3(5621$//<³352*5$0$&216802,17(/,*(17(´ Categoría 18: Marketing Social 1. AGENCIA HEALTHCARE ± BARÓN BECERRA ² ³)8&.<286,'$´ 2. YANBAL ± MORA Y ARAUJO ² ³6(1625<$1%$/'(/$08-(5´ PREMIOS EIKON 2010 Categoría: Campaña General de Comunicación Institucional Caso: Parque Navideño Reciclado Tetra Pak Empresa: Tetra Pak Southern Cone Agencia de PR: PersonAllY Asesores en Comunicación Integrantes Por Tetra Pak: Esteban Casares, Director de Marketing y Estela Reale, Gerente de Comunicaciones. Por PersonAllY: Marcelo Altuna, Socio Director y Gabriela Salice;; Ejecutiva Sr. de Cuentas. Introducción a) Breve descripción de la compañía A comienzos de la década del 50, el mayor avance en las ciencias de la alimentación llegó al mundo de la mano de Tetra Pak: un innovador sistema de envasado para leche líquida -­el proceso de larga vida-­ que combinó el tratamiento térmico UAT y el envasado aséptico modificando significativamente la forma de manipular los alimentos líquidos sensibles. Desde entonces, década a década Tetra Pak se ha transformado en uno de los principales proveedores del mundo en sistemas de envasado de leche fluida, jugos y bebidas, entre otros productos en más de 165 países. En Argentina está presente desde 1979 y cuenta con oficinas centrales en Buenos Aires, una planta de producción de material de envase en La Rioja, una estación de servicio técnico en San Fernando y otra en Mendoza. Tetra Pak cree en un liderazgo industrial responsable, que permita el crecimiento de la compañía en armonía con la sustentabilidad del medio ambiente y con la buena ciudadanía corporativa. b) Envases sustentables Quienes trabajan en Tetra Pak o tienen una relación cercana con la compañía conocen el lema de su IXQGDGRU5XEHQ5DXVLQJ³ORVHQYDVHVGH7HWUD3DNGHEHQDKRUUDUPiVGHORTXHFXHVWDQ´UHILULpQGRVH
tanto el aspecto económico como social. Hoy Tetra Pak aplica este estándar al medio ambiente y trabaja entendiendo que proteger el ambiente es el camino correcto para beneficiar a la comunidad y a su propio negocio. Es así que lleva adelante políticas y acciones que aseguren que el impacto en el medioambiente y la sociedad sean tomados en cuenta en sus operaciones diarias. El enfoque holístico que Tetra Pak tiene para desarrollar responsablemente su negocio, permite que sus productos -­los envases Tetra Brik-­ sean sustentables. El camino recorrido para su fabricación -­desde la cuna hasta la tumba-­ contempla procesos que minimizan el impacto sobre el medioambiente. Por un lado, el envase tiene un origen renovable ya que el cartón utilizado para la fabricación de los envases (80% de su composición es papel) proviene de bosques certificados por FSC, es decir, de bosques gerenciados de manera responsable. Y por otro, los envases de Tetra Pak son 100% reciclables y pueden convertirse nuevamente en materia prima que se utiliza para producir una amplia gama de productos comerciales como placas tipo aglomerado con las que se pueden fabricar desde muebles hasta casas;; chapas acanaladas, tejas doble romano, y por supuesto, cartulina, papel. c) Causas de la campaña Para Tetra Pak, la sustentabilidad del envase es uno de los principales pilares comunicacionales sobre los que debe trabajar para posicionar a la marca como medioambientalmente responsable. Y es justamente el mensaje de sustentabilidad, anclado en ser un producto reciclable, el que debe llegarle al consumidor. El envase de Tetra Pak está fuertemente posicionado como un producto de gran calidad, que protege el alimento, pero no tanto como un producto ambientalmente responsable. Por eso necesita poner foco sobre este atributo, generando un valor agregado más al envase, que lo convierta en un nuevo driver para la decisión de compra. Por el tipo de producto, la marca Tetra Pak se encuentra muy emparentada con las marcas alimenticias que envasa;; lo que dificulta la disociación entre el envase y el alimento que contiene. Es por esto que Tetra Pak como marca necesita hablarle al consumidor de manera directa, sin intermediarios. A pesar de que la marca lleva adelante acciones en relación a la protección ambiental y a las características del producto, necesLWDED DXPHQWDU HO QLYHO GH DZDUHQHVV GHO DWULEXWR ³VXVWHQWDELOLGDG´
comunicándolos a través de una acción de alto impacto y recordación. d) Públicos Consumidores Clientes Gobierno Empleados e) Objetivos Generar una campaña de alto impacto y disruptiva dirigida al público target, apalancado en el mensaje de sustentabilidad de los envases de Tetra Pak y que integre componentes educativos, culturales y solidarios. Continuar posicionando a Tetra Pak como una empresa socialmente responsable y comprometida con el cuidado medioambiental. f) El mensaje clave ENVASES SUSTENTABLES: Los envases de Tetra Pak protegen el medioambiente, porque tienen un origen renovable y porque son 100% reciclables. Plan de acción: Presentamos el Primer Parque Navideño Reciclado Tetra Pak En diciembre de 2009, la Fundación Tetra Pak sorprendió a la Ciudad de Buenos Aires con la presentación del primer Parque Navideño Reciclado Tetra Pak, hecho enteramente con envases de Tetra Pak reciclados. El parque estuvo abierto durante un mes, desde el 8 de diciembre hasta el 8 de enero del 2010, en la Plaza Naciones Unidas (comúnmente conocida como la Plaza de la Flor). Elegimos la Navidad por ser un momento de celebración y distensión única para las familias, en un momento del año donde las propuestas de salidas al aire libre son mejor recepcionadas por el público general, por el clima y la previa a las vacaciones. Además, históricamente Tetra Pak realiza desde hace más de 10 años espectáculos (de otra índole) en la Plaza de la Flor, la cual apadrina desde 2001. La campaña contó con el apoyo y aval del Gobierno de la Ciudad de Buenos Aires, ya que fue declarada de Interés Público debido al espíritu de la campaña que buscaba transmitir un mensaje en pos del cuidado medioambiental a través de una acción cultural, educativa, recreativa y solidaria dirigida a toda la comunidad. a) Ejes comunicacionales Para llevar a cabo la campaña se tomaron dos ejes conceptuales fieles a la filosofía de la compañía: SUSTENTABILIDAD (concientización sobre el ciclo de vida del envase con foco en su reciclabilidad) y COMPROMISO COMUNITARIO (acción benéfica, actividad didáctica y arte & cultura). b) ¿Cómo lo hicimos? b.1) El artista Convocamos al artista plástico argentino Milo Lockett, por ser un reconocido pintor argentino, dueño de un perfil lúdico, colorido y moderno, y de perfil solidario. Él diseñó el parque e intervino los envases post-­
consumo que le dieron vida a la obra artística-­reciclada. b.2) Recolección de envases usados Un mes antes de la acción, montamos espacios de la campaña en cada una de las sucursales de Hipermercados Jumbo de Ciudad de Buenos Aires y Gran Buenos Aires como centro de recolección de envases necesarios para armar el Parque Navideño Reciclado Tetra Pak. De esta manera, a partir del 8 de noviembre, comunicamos la campaña a los consumidores en estos puntos de ventas y quienes acercaron envases de Tetra Pak post consumo a las urnas (enjuagados y aplanados), colaboraron en el armado del Parque Navideño Reciclado. Para difundir masivamente la etapa de recolección de envases, llevamos adelante una campaña de PNTs en Radio Diez, Radio Mitre, Continental, FM La 100 y Radio Uno. Además, Jumbo dio a conocer la iniciativa a sus clientes a través de un aviso en el newsletter que les envía mensualmente. *Ver Alianza con Hipermercados Jumbo b.3) Construimos el Parque Navideño Reciclado Tetra Pak Para el armado del Parque Navideño se construyeron 5 árboles de navidad de alrededor de 10 metros cada uno, enteramente decorados por envases de Tetra Pak;; una muralla construida por envases de más de 70 metros de largo y una gran pérgola decorada íntegramente con envases. Todo fue creado e intervenido por Milo Lockett para luego ser montado en el parque. Además, el artista pintó de 8 murales que fueron expuestos dentro del Parque Navideño Reciclado para que luego sean subastados a beneficio en el día de la inauguración. *Ver fotos del armado de las piezas b.4) Inauguración Realizamos un evento inaugural el día 8 de diciembre, ya que por tradición es el día del armado del árbol de Navidad. Estuvieron presentes el Sr. Hernán Lombardi, Ministro de Cultura de la Ciudad de Buenos Aires;; todas las autoridades de la compañía a nivel local;; el artista Milo Lockett;; clientes y empleados de Tetra Pak, más de 45 periodistas y Fundación P.U.P.I. A partir de las 18hs comenzaron a llegar los primeros invitados al cocktail inaugural del Parque Navideño Reciclado Tetra Pak, entre ellos más de 50 niños de la Fundación P.U.P.I. que animadamente se divirtieron pintando envases reciclados junto al artista Milo. Promediando el encuentro, iniciamos una subasta solidaria y silenciosa de las obras de Lockett cuyos fondos recaudados fueron destinados a la construcción de la Casa Garrahan del Chaco, apadrinada por el artista, que albergará a pacientes ambulatorios sin recursos económicos. Luego de los discursos de Aldo Ferrer, presidente de Tetra Pak;; del artista Milo Lockett y del Sr. Hernán Lombardi, Ministro de Cultura de la Ciudad;; llegó al Parque Navideño Reciclado Tetra Pak un invitado muy esperado por los niños para sacarse fotos y entregarles los deseos navideños: Papá Noel. b.5) Actividades Semanales Si bien el Parque Navideño Reciclado Tetra Pak estuvo abierto durante un mes, para ser visitado en todo momento, durante los dos fines de semanas previos a la Navidad, realizamos el Taller de Arte con Envases Reciclados para Chicos dictado especialmente por Milo Lockett, de manera libre y gratuita a partir de las 16hs. Deslumbrados por los árboles y figuras presentes en los más de 200 metros cuadrados del parque, las familias lo recorrieron fascinados, apreciaron la gran obra de Milo compuesta por envases reciclados, y los más chiquitos participaron del taller donde pintaron con témperas coloridas los envases de Tetra Pak usados que fueron sumándose a las pérgolas y árboles navideños del parque. Organizados en turnos de 20 minutos, ningún niño quiso perderse la actividad recreativa donde aprendieron que un envase puede convertirse en otra cosa, en este caso, en una obra de arte. Como no podía ser de otra manera, Papá Noel también estuvo presente en el Parque durante los fines de semana. La fila para sacarse fotos con él y dejar las cartitas navideñas, en un hermoso buzón pintado por Milo, estaba siempre llena de familias. ¡No faltaron los abrazos y emoción de los niños que disfrutaron de un momento único con la figura más emblemática y mágica de la Navidad! c) Herramientas de Comunicación Espacios en los hipermercados Jumbo de Ciudad de Buenos Aires y GBA para recolectar envases usados. PNTs en Radio Diez, Radio Mitre, Continental, FM La 100 y Radio Uno. Desarrollamos un microsite del Parque Navideño Reciclado Tetra Pak con el principal objetivo de educar sobre la reciclabilidad del envase de Tetra Pak. En este site se incluyeron fotos y videos de la construcción del Parque Navideño y del evento inaugural, explicación para participar en la colecta de envases y contenidos educativos sobre cómo proteger el medioambiente a través del reciclado de envases. El dominio es www.parquetetrapak.com. Creación de cuenta en Facebook del Parque Navideño Reciclado Tetra Pak. Publicidad en vía pública. Publicidad en medios gráficos: La Nación, Clarín y La Razón. Gestión de prensa en medios target: entrevistas a Milo Lockett y a voceros de Tetra Pak, y noticia en secciones de agenda y novedades. Envío de Tarjeta Navideña de Tetra Pak a clientes, empleados y periodistas, que incluyó un video de la campaña. 3. Resultados de la campaña Campaña declarada de Interés Público por el Gobierno de la Ciudad de Buenos Aires. Se obtuvieron 100 repercusiones de prensa en solo 2 semanas, y 200 repercusiones en un mes. 25 notas fueron en TV abierta y cable (Canal 13 ±en Telenoche-­, CNN, Canal 9 (noticiero y Tendencia), Canal 7, TN (Colectivo Imaginario), C5N (con más de 6 repeticiones), América 2, Canal 26 y Canal Metro. Más de 1.5 millón de pesos el valor de ahorro publicitario conseguido a través de la gestión de prensa y 200.123.000 de contactos alcanzados. Más de 2.000 visitas al microsite de la campaña en 3 días, con un promedio de 2 minutos de tiempo promedio en el site. Más de 10.000 familias visitaron el Parque Navideño Reciclado Tetra Pak y participaron de las actividades que se llevaron a cabo los fines de semana previos a la navidad junto a Milo. 17.000 envases de Tetra Pak usados fueron recolectados para el armado del parque. Cerca de 250 invitados asistieron al evento inaugural. Se recaudaron $61.000 en la subasta de las obras de Milo a beneficio de la Casa Garrahan del Chaco. Tetra Pak donó 3.000 litros de leche larga vida a comedores de la Ciudad de Buenos Aires y a los chicos de la Fundación P.U.P.I. PREMIOS EIKON 2010 Categoría: Campaña General de Comunicación Institucional Caso: Muestra Internacional de Arte en Buenos Aires Empresa: Asociación de Artistas Pintores con la Boca y el Pie Agencia de PR: Llorente & Cuenca Integrantes: Por Llorente & Cuenca Daniel Felici, Socio y Director General;;Yolanda Yebra, Directora Senior;; Gustavo Ripoll, Gerente Regional Introducción Durante medio siglo, la Asociación de Artistas Pintores con la Boca y el Pie ha apoyado con éxito rotundo a artistas de todas partes del mundo que, como consecuencia de alguna discapacidad o enfermedad, crean sus obras sin utilizar sus manos, sino sus bocas y pies. Con el transcurso de los años, una pequeña fraternidad de 18 pintores con la boca y el pie formó una Asociación que es activa en todo el mundo y, en la actualidad, se encuentra representada en 74 países del mundo con 726 artistas. Año tras año, las obras realizadas por los artistas de AMFPA (la organización internacional de AAPBP) se exhiben en galerías, museos y edificios públicos muy reconocidos en todo el mundo, con la presencia destacada de personalidades distinguidas. Durante el 2009, la Asociación decidió realizar la primera Exhibición Internacional que se llevó a cabo en América Latina y eligió a Buenos Aires como locación para el evento. Del 12 al 17 de octubre del año pasado, pintores con la boca y el pie provenientes de todas partes del mundo llegaron ma Argentina para formar parte del corazón de uno de los museos más importantes en la región: el Museo de Artes Plásticas Eduardo Sívori. Con las ganancias obtenidas de las ventas de obras de arte los miembros de AAPBP perciben un ingreso mensual de por vida, independientemente de que el aumento de la discapacidad tornara imposible para el artista seguir produciendo pinturas que la Asociación pueda comercializar. Esto permite disipar la mayor ansiedad que aqueja al artista discapacitado ± el temor a perder la capacidad de pintar como consecuencia del deterioro de la salud dado que el costo de independencia para el discapacitado es muy elevado. En particular, este es el caso de quienes pueden vivir por su cuenta sólo porque tienen personas que los asisten periódicamente. Los miembros estudiantes reciben una beca de forma tal de contribuir a mejorar su nivel de pintura al contar con fondos para materiales y clases. Esto les proporciona los medios para convertirse en Miembros Titulares o Adjuntos de la Asociación. A medida que un estudiante mejora, se incremente la beca. Una vez que el estudiante ha alcanzado un nivel que se considera equivalente al de profesionales no discapacitados, se concede la Membresía Titular o Adjunta. Considerando los últimos parámetros, decidimos resaltar los aspectos más importantes de la Asociación, evitando la condición especial de sus miembros y dejando de lado la supuesta situación de impedimento de los pintores. Nos concentramos en explicar el modelo de negocios de la AAPBP, mostrando el éxito de un sistema distributivo que se centra en el bienestar de sus miembros. En busca de este éxito decidimos comenzar a generar ruido en el país, aumentando la presencia pública de los artistas a nivel provincial y luego a nivel nacional. En segundo lugar, hemos resaltado la calidad de artistas y pintores de los miembros de la Asociación, personas que dedican sus vidas a la creación de obras de arte, para su exhibición en el mundo mediante la mejora continua de sus estándares. Finalmente, impulsamos la difusión y circulación de la Exhibición Internacional con estos conceptos, otorgando particular relevancia al carácter internacional de la Exposición de Arte y el hecho de que Buenos Aires fue escogida como anfitriona de la primera exhibición en América Latina. Para lograr estos objetivos, hemos invitado a las más distinguidas autoridades de la política y contamos con el auspicio de grandes instituciones culturales. Desde el punto de vista de los medios de comunicación, la Exhibición logró la presencia de siete canales de TV, incluidos reconocidos servicios de noticias internacionales, tales como Reuters y EFE. Asimismo, estuvieron presentes canales argentinos de aire junto con canales de cable. Sobre la base de este apoyo político e institucional, la Exhibición fue declarada de interés cultural tanto a nivel nacional como municipal, con el aval del Gobierno Nacional con el Ministerio de Cultura y el Gobierno de la Ciudad Autónoma de Buenos Aires con su Ministerio de Cultura. Como consecuencia de la implementación de esta estrategia, los artistas no sólo lograron difundir sus capacidades y talentos en el prestigioso Museo Sívori, sino que además su trabajo se mostró como arte, dejando de lado la condición de los pintores. La cobertura que hicieron los medios de la Exhibición Internacional de AAPBP registró más de 118 impactos de prensa en TV, radio, servicios de noticias, prensa, revistas y medios on line;; no sólo en Argentina sino también a nivel internacional en inglés, español, portugués, alemán, francés, coreano, japonés, indio y otros idiomas. Quien dio inicio con éxito a esta historia fue Arnulf Erich Stegmann, de Alemania. Fue él quien tuvo la idea de fundar una asociación de ese tipo y, por iniciativa propia, buscó pintores con la boca y el pie que acogieran su plan y desearan participar como miembros fundadores. (QSDODEUDVGHOSURSLRIXQGDGRU³(QHOPXQGRHQHOTXHYLYLPRVTXHVXHOHVHUWDQKRVWLOFRQODVSHUVRQDV
con discapacidades físicas, una asociación de estas características ofrece una gran posibilidad de superar las dificultades con mayor facilidad, ya sea en el área del arte en particular o de la vida en general. Esta WDUHDHVWDFUHDWLYLGDGDUWtVWLFDUHSUHVHQWDODOODYHDODOLEHUWDG´ Como consecuencia de este logro, se instaló en la sociedad un mensaje de esperanza que constituye un ejemplo vivo y nos incentiva a sobreponernos a nuestras dificultades tal como lo hacen los pintores. PREMIOS EIKON 2010 Categoría: Campaña General de Comunicación Institucional Caso: Poniendo al Usuario en el CentURGHOD(VFHQD´ Empresa: Google Argentina Agencia de PR: Mazalan Comunicaciones Integrantes: Por Google Alberto Arebalos -­ Director de Comunicaciones y Asuntos Públicos de Google para América Latina;; Victoria Campetella -­ Gerente de Comunicaciones y Asuntos Públicos para Argentina, Chile y Perú. Por Mazalán Comunicaciones: Carlos Mazalán -­ Presidente Mazalán Comunicaciones y Director General de la Cuenta / Francisco Petracco -­ Director de Cuenta -­ Mazalán Comunicaciones Introducción Google conecta a millones de personas alrededor del mundo con información, todos los días. Fundada hace apenas 12 años por Larry Page y Sergey Brin, en ese entonces estudiantes universitarios en Stanford (EE.UU), rápidamente se convirtió en un ícono de la era de Internet y sus productos en sinónimo de acceso, participación y colaboración. Pero su fin trasciende el negocio y es, sin lugar a dudas, ambicioso: la misión de Google es organizar la información del mundo y hacerla universalmente accesible y fácil. Y todo esto sin perder de vista el activo más importante de la compañía y en torno a lo que todos los Googlers nos inspiramos y creamos: el usuario. Porque en Search, AdWords, Maps, YouTube, Apps, Gmail, Chrome, Android, AdSense, Blogger y los miles de productos que integran nuestro portfolio, todo -­absolutamente todo-­ lo que no es mejorar la experiencia del usuario en la web es una consecuencia. Desafío Desde la llegada de su operación a la Argentina, en 2007, Google empezó a tomar control de sus comunicaciones a nivel local y en el año 2009 -­-­luego de algunos cambios en el management y la consolidación del área de PR-­-­ se enfrenta al desafío de alinear definitivamente su estrategia de comunicación alrededor de los usuarios, por tres razones principales: 1. Porque una buena experiencia en la Web para los usuarios no sólo es contar con productos excelentes e innovadores sino que también depende de una buena comunicación con ellos, consecuentemente con la filosofía de Google. 2. Porque los clientes, socios, periodistas, ONGs, etc. son -­ante todo-­ usuarios. 3. Porque es inconcebible encarar un proceso de crecimiento en una industria tan disruptiva como ésta sin el apoyo de quienes la hacen posible. Y todo esto debía lograrse con los recursos humanos y económicos disponibles que, en una compañía del tamaño de una PyME como es Google en Argentina, son acordes a la estructura de su operación. Objetivos El objetivo del área de Comunicaciones y Asuntos Públicos de Google Argentina era mejorar la percepción y valoración que el usuario tiene de la compañía y de sus principales productos. Esto, en un contexto económico y político complejo, a raíz del crecimiento exponencial del negocio y de los crecientes intereses de Google en las más diversas industrias (libros, entretenimiento, noticias, etc) tanto a nivel global como local. Así, para comienzos de 2009, Google había dejado de ser el start up cool del momento para convertirse, a los ojos de los usuarios, en el gigante de Internet -­cada vez más grande, omnipresente y todopoderoso-­. Orientar la comunicación al usuario en este contexto era crítico para mantener su confianza y credibilidad y, por consiguiente, asegurar la sustentabilidad del negocio en el marco de un plan agresivo de crecimiento. Públicos y mensajes Los públicos comprendidos en este plan pueden agruparse de la siguiente forma: · Usuarios en general: comprende a los usuarios de Internet en la Argentina, que se estima asciende a los 20 millones de personas. Si consideramos que la búsqueda de información en Internet es una de las actividades principales de los usuarios y que 9 de cada 10 personas en el país utilizan Google para estos fines, es claro que este público comprende a un vasto número de personas. · Desarrolladores: la prometedora comunidad de desarrolladores de tecnología en Argentina y de manera especial quienes desarrollan sobre plataformas de código abierto. · Emprendedores y PyMEs: tanto aquellas que ya tienen presencia online como las que están próximas a hacerlo. Abarca un amplio espectro de industrias además de los pure players (.coms) como turismo, tecnología, servicios, retail, entretenimiento, entre otras. Aquí, los interlocutores principales son los fundadores, Gerentes Generales y de Ventas, así como los responsables de Tecnología, Marketing y Publicidad. · Grandes empresas: su perfil es el de las Fortune 500 y comprende también a varias industrias, entre las que se destacan: turismo, tecnología, retail, medios & entretenimiento, finanzas, automotriz, consumo masivo y los pure players. Los interlocutores son CEOs, Groupers, Brand Managers y demás tomadores de decisión en las áreas de Marketing y Publicidad. · Agencias de publicidad: son partners y clientes y, por lo tanto, un componente esencial del negocio. Comprende desde las grandes agencias de publicidad tradicional hasta las agencias boutique digitales. Ocasionalmente, también se incluyen consultoras en comunicación institucional. · Periodistas: editores y redactores de medios de alcance nacional y regional de interés general, tecnología, negocios y verticales. · Bloggers y twitteros: líderes de opinión en temas de tecnología e Internet. · ONGs: de las ramas más diversas, principalmente aquellas radicadas en Buenos Aires y con presencia online o próximas a tenerla. · Universidades y escuelas: nacionales y regionales, principalmente de las carreras vinculadas a Marketing, Publicidad, Administración y Sistemas. · Cámaras y asociaciones profesionales: de las áreas de Marketing, Publicidad, PyMEs y Tecnología así como asociaciones profesionales paralelas como IDEA. · Otros grupos de interés: Medios y Asociaciones de Autores y detentores de derechos de propiedad intelectual. Por su parte, los mensajes desarrollados están comprendidos en 5 grandes narrativas: 1. Google contribuye al acceso igualitario a la información. El objetivo de Google es acercar a todos los usuarios alrededor del mundo la información que ellos quieren, de la más amplia variedad de fuentes, dondequiera que se encuentren. Hacer la información del mundo universalmente accesible y útil brinda a las personas mejores opciones, más libertades y mayor poder. Principales productos: Search, Translate, Geo (Earth, Sky & Maps), Mobile. 2. Google te hace la vida más fácil. Hay mil millones de personas online en el mundo: conectadas, creando, compartiendo y buscando información. Es fácil de entender por qué la Web se ha hecho tan popular: ofrece una oportunidad sin precedentes para descubrir, aprender, conectar y, sobre todo, simplificar la vida de la gente. Principales productos: Search, Apps, YouTube y Geo. 3. Google genera oportunidades económicas. Permitiendo a la gente descubrir información. Aumenta el tráfico Web, las búsquedas de clientes, los ingresos por publicidad y las ventas, tanto para dueños de contenidos y editores online, como offline. Y lo hace de la forma más accesible posible. Principales productos: AdWords, AdSense, Content (Books, News, YouTube). 4. Google estimula la innovación en la Web. La Web nació del consenso. En sus inicios, al igual que hoy, no existió una única compañía decidiendo las reglas o determinando quién puede o no acceder al creciente contenido online. Como las reglas no están concentradas en un único actor, tampoco hay grandes barreras de ingresos. Principales productos e iniciativas: Google Developer Tools, Webmaster Central, Chrome, Android. 5. Google actúa responsablemente. Desde que la era de la información se transformó en una realidad para una gran cantidad de personas en todo el mundo, las tecnologías que la sustentan se están volviendo más sofisticadas y útiles. Por otra parte, estos cambios generan cuestiones importantes acerca de la privacidad y la seguridad online. Principales productos e iniciativas: Privacidad, Child Safety, Energías Limpias, Seguridad. Canales Una de las premisas del trabajo del área de Comunicaciones de Google fue no dar por sentado ningún canal a la hora de buscar el mejor impacto de los mensajes clave en el público objetivo. Prensa, eventos propios y de terceros, open houses y speaking engagements fueron algunos de los canales elegidos, además de otras acciones de comunicación ad hoc oportunamente definidas. Sin embargo, hubo una premisa que sí se mantuvo en todo momento: entablar comunicaciones lo más directas posibles, que permitan poner cuerpo y cara a una compañía de Internet, cuyos productos y servicios son en esencia intangibles. Esto resultaba especialmente complicado por la extensión de los públicos objetivo y la masividad de la mayoría de los productos, con lo cual fue fundamental usar un modelo mixto que combine instancias de relacionamiento personal con comunicaciones masivas. Ejecución del plan y acciones Con los objetivos ya fijados, el plan tuvo como premisa mantener al usuario (léase los públicos) en el centro de la escena y que resumimos en la LGHDGH³3XWWLQJ3EDFNLQ35´ (VWRQRVRULHQWyDPDQWHQHU
siempre al público adelante y claridad en los objetivos de modificar conductas y generar conciencia en la sociedad más allá del soporte utilizado. A continuación se detallan las principales acciones que se realizaron durante el período Marzo-­Diciembre 2009, organizadas en función de los públicos target y con sus resultados más destacados. Público: Usuarios en general $FFLyQ³9HQtDVDOWDUVREUHODFLXGDG´(YHQWRSURSLR\SUHQVD Descripción: Google presentó Google Maps, con su nuevo dominio .ar, localizando la plataforma más popular de mapas en el mundo con mejoras para usuarios y negocios. En base a este anuncio se realizó una acción especial en el predio del Planetario de Buenos Aires y en el Monumento a la Bandera de Rosario durante dos fines de semana, donde se instaló una colchoneta infladle FRQHOGLEXMRGHFDGDXQRGHORVPDSDVGHODVFLXGDGHV\VHLQYLWDEDDODJHQWHD³VDOWDUVREUHVXFLXGDG´
Consecuencia de escuchar al usuario durante mucho tiempo, decidimos usar uno de los productos más HVSHUDGRV SRU HOORV \ FRQ PiV FRQH[LyQ HPRFLRQDO SDUD ³VDOLU D OD FDOOH´ \ FRPSDUWLUOR FRQ HO S~EOLFR
invitándolos además a mostrar su barrio y sus lugares preferidos. Se realizó también una conferencia de prensa con 40 periodistas de medios televisivos, radio, gráfica, y online, tanto especializados en tecnología, Internet, negocios, como así también las secciones de ciudad y sociedad. Se instalaron demo stations (computadoras con acceso a Internet) y se hicieron presentes los protagonistas de casos emblemáticos de organizaciones, emprendedores y negocios especialmente desarrollados para esta iniciativa para dar soporte a la comunicación. Mensajes principales: Google te hace la vida más fácil. Google genera oportunidades económicas. Google contribuye al acceso igualitario a la información. Google estimula la innovación en la Web. Highlight: De 7 a 10 millones de visitas de usuarios luego del lanzamiento y 5 mil personas participando en vivo y activamente en dos de las principales ciudades de la Argentina. $FFLyQ³=HLWJHLVW(OHVStULWXGHORVWLHPSRVHQ,QWHUQHW´3UHQVD Descripción: Google publicó por segundo año consecutivo el reporte de los términos más buscados a nivel global y local, poniendo al alcance de todos una de las fuentes de información más poderosas: las búsquedas en Internet. Esta acción ayuda a humanizar la compañía detrás del buscador, mostrando los intereses de las personas en determinado período, y también permite posicionar al buscador como una fuente de referencia para detectar tendencias y comportamientos en la sociedad. Mensajes principales: Google contribuye al acceso igualitario a la información. Highlight: Más de 100 artículos sobre este reporte de búsquedas incluyendo gestiones uno a uno por resultados segmentados en secciones de Cultura, Deportes, Espectáculos, Música, etc. $FFLyQ³3DUDORVKLQFKDVGH%RFDTXHORPLUDQSRU<RX7XEH´(YHQWRHQFRQMXQWR\SUHQVD Descripción: Si de acercarse al usuario se WUDWDTXpPHMRUTXHXQLUVH D³ODPLWDG PiVXQR´GLVFXVLRQHV
aparte). Por eso Boca y Google decidieron lanzar en conjunto el canal oficial del Club en YouTube, uniendo la plataforma de videos más grande al club más popular. El objetivo central para Boca con esta iniciativa era estar presente allí donde están sus hinchas y para Google, mostrar las capacidades avanzadas de YouTube para usuarios y organizaciones, como es la posibilidad de crear un canal y alrededor de éste una comunidad. Para esto se convocó a la hinchada mediante una campaña online a enviar videos con sus festejos de gol que luego se compaginaron en una pieza para uso en TV. Para el anuncio se realizó una conferencia de prensa en la cancha de Boca con periodistas de deportes, tecnología e interés general. Mensajes principales: Google te hace la vida más fácil. Highlight: Decenas de miles de visitas al canal de Boca en YouTube y cerca de 250 mil vistas de videos subidos al canal. Público: Periodistas Acción: Google Press Summit (GPS) / Evento propio y prensa Descripción: Evento anual de prensa de Google donde se suceden lanzamientos y presentaciones de personalidades destacadas de Google a nivel mundial. En 2009 se invitó a Vint Cerf, padre de Internet y Google evangelist, para hablar sobre el futuro de la red y el rol de los usuarios en ella. Mensajes principales: Todas las narrativas de Google estuvieron presente en este evento a través de distintos voceros y temas. Highlight: Más de 60 periodistas de América Latina (8 de Argentina) presenciaron el evento en Brasil y se publicaron más de 30 notas en medios tier 1 de la región. · Acción: Seminario para periodistas / Evento propio Descripción: Sabemos que el trabajo del periodista es mucho más fácil con las herramientas de Google y decidimos promover entre ellos un mejor uso de éstas de la forma más relevante: mejorando su propia experiencia. Para esto se realizó un seminario en conjunto con las organizaciones de periodistas FOPEA y TEA y se trabajó con un editor colombiano que preparó el contenido y vino especialmente para esta actividad. Luego de este seminario se sucedieron varias capacitaciones personalizadas a editores de medios importantes y también se llevó este contenido a una jornada de entrenamiento en el Congreso anual de FOPEA. Mensajes principales: Google te hace la vida más fácil. Highlight: Más de 60 periodistas entrenados en vivo en las oficinas de Google + 30 en Congreso de FOPEA y otros 20 con entrenamientos customizados en base al contenido del seminario original. Público: Grandes Empresas $FFLyQ³*RRJOH([SHULHQFH'D\V´(YHQWRVSURSLRV Descripción: La mejor manera de conocer y entender a Google es vivirlo puertas adentro. Por eso, Google invita a las principales empresa de la Argentina a empaparse de su filosofía, sus productos, su conocimiento y sobre todo, su experiencia para transformar Internet en negocios. A través de una jornada completa y con una intensa agenda, se reúnen en las oficinas locales a equipos multidisciplinarios de estas compañías de Google con voceros locales y regionales de Google que comparten conceptos teóricos y casos prácticos. Mensajes principales: Google genera oportunidades económicas. Google te hace la vida más fácil. Highlight: Más de 20 empresas de las más importantes compañías nacionales con alrededor de 200 profesionales participando. Público: PYMEs y Emprendedores ā$FFLyQ³6WRU\&KHIV´3UHQVD Descripción: se realizó una acción de prensa para transmitir al público las historias detrás del uso de los productos de Google. El hobbie del ama de casa que se transforma en un negocio en Internet o una secretaria que pierde su trabajo y logra desarrollarse con el e-­commerce son sólo algunos de los casos descubiertos. Para esto se trabajo internamente con el equipo de ventas, concientizándolos sobre la importancia de contar las historias de las personas e invitándolos ayudar al equipo de Comunicación a ³FRFLQDU´ HVDV KLVWRULDV /D FDPSDxD LQFOX\y OD FUHDFLyQ GH XQ QRPEUH XQD LGHQWLGDG \ PDWHULDO GH
soporte (stickers, cenefas, guirnaldas, individuales, etc.). Mensajes principales: Google genera oportunidades económicas. Highlight: Más de 20 historias de éxito de emprendedores mostrando cómo Internet y Google ayudan a las personas a crecer económicamente. $FFLyQ³*RRJOH6HUYH´(YHQWRVGH terceros Descripción: En el marco de un programa de voluntariado que Google realiza a nivel global, se eligió trabajar junto a Endeavor para llevar conocimiento a la comunidad de emprendedores argentinos sobre cómo potenciar el uso de Internet en sus proyectos. Mensajes principales: Google genera oportunidades económicas. Highlight: 100 emprendedores asistieron a una jornada intensiva de entrenamiento en Google. Público: Universidades y Escuelas ā$FFLyQ³*RRJOH2SHQ+RXVH´(YHQWRVSURSLRV Descripción: Google recibió a grupos de escuelas secundarias en la oficina para compartir la historia de la compañía, su misión, valores y principales productos. Para Google es central integrar a los más jóvenes en su estrategia para que los líderes del futuro comprendan la importancia del modelo disruptivo que plantea Internet. También se realizaron charlas para Universidades locales y extranjeras en esta misma línea y se visitaron universidades donde se dieron charlas introductorias al mundo de Internet Mensajes principales: Google contribuye al acceso igualitario a la información. Google actúa responsablemente. Highlight: 20 colegios secundarios con más de 600 alumnos pudieron conocer las oficinas de Google, la cultura de la empresa y sus productos pero además comprender la relevancia de Internet en términos de acceso y democratización de la información. Más de 10 charlas en universidades. ā$FFLyQ³7HFQRORJtD6t´(YHQWRFRQWHUFHURV\SUHQVD 'HVFULSFLyQ³7HFQRORJtD6tFRQHFWDWHFRQUHVSRQVDELOLGDG´HVXQDLQiciativa llevada a cabo por Chicos.Net junto con Google y con el apoyo de Save the Children, con el propósito de promover el uso responsable de la tecnología entre los jóvenes. La creciente exposición de los adolescentes a Internet, el desconocimiento generalizado que hay sobre los peligros que esto conlleva y, por sobre todo, la falta de información y fuentes confiables sobre la mejor manera de tratarlos motivó la creación de un concurso de cortos en video para que los chicos enseñen a sus pares -­-­que son su principal influencia-­-­ cómo se debe usar responsablemente la tecnología. Desde Google, el objetivo era concientizar sobre los riesgos que existen y aportar soluciones, con la idea de que el miedo no paralice y lleve a los padres a limitar o incluso prohibir el acceso a Internet a sus hijos. El concurso se lanzó en en una conferencia de prensa en las oficinas de Google en el marco de la presentación de una investigación de campo de Chicos.net con presencia de periodistas de educación, cultura, tecnología y RSE que siguieron el concurso etapa por etapa. Mensajes principales: Google actúa responsablemente. Highlight: 1200 chicos de todo el país participaron del concurso, enviando 200 videos cortos para competir. Videos ganadores en Telefé, CNN y TN. Público: ONGs ā$FFLyQ³:RUNVKRSVSDUD21*V´(YHQWRVFRQWHUFHURV Descripción: Junto con Idealistas.org, Google realizó un ciclo de talleres gratuitos a lo largo de todo el año dirigidos a ONGs con el propósito de ayudarlas a aprovechar los beneficios de Internet a la hora de administrar y difundir sus proyectos. Los contenidos estuvieron a cargo de Googlers y se basaron en la suite de herramientas gratuitas de Google Apps y en Google Grants, un programa por el cual las ONGs pueden acceder a fondos para ejecutar campañas de publicidad en el buscador. Mensajes principales: Google genera oportunidades económicas. Google te hace la vida más fácil. Highlight: 140 ONGs asistieron al ciclo de talleres. Público: Desarrolladores ā$FFLyQ³*RRJOH'HY)HVW´(YHQWo propio y prensa Descripción: Google realizó por primera vez un evento de gran escala para hablarle a la enorme comunidad de desarrolladores y programadores que hay en Argentina, con Globant como socio local. La agenda del evento fue variada y didáctica, gracias a las disertaciones de ingenieros de Google de renombre internacional que viajaron especialmente a Argentina para el evento. Además, y dadas las visitas especiales, se capitalizó la oportunidad para generar entrevistas 1:1. Mensajes principales: Google estimula la innovación en la Web. Highlight: Más de 500 desarrolladores y programadores asistieron al evento y más de 10 artículos en medios especializados sobre innovación y desarrollo. Público: Cámaras y Asociaciones Profesionales · Acción: Speaking Engagements Descripción: Google trabajó junto a Cámaras y Asociaciones en distintos ámbitos (Marketing, Publicidad y Negocios) para llevar mensajes clave a sus miembros en forma presencial y directa. Esto se realizó a través de presentaciones y charlas, además de la presencia de Google en eventos destacados de estas asociaciones (Ej. CACE, IAB, AMDIA, AAM, CAME, entre otras) Mensajes principales: Google genera oportunidades económicas. Highlight: Se trabajó con 7 asociaciones a través de las cuales se llegó con presentaciones a más de 3 mil contactos. Público: Agencias de Publicidad · Acción: Eventos propios Descripción: Las agencias de publicidad son un actor clave en el ecosistema de negocios de Google. Uno de los principales desafíos es llegar a sus profesionales con conocimiento de valor para ellos, capacitándolos y generando una mayor conciencia respecto del potencial de la publicidad online para el negocio de las agencias y sus clientes. Mensajes principales: Google genera oportunidades económicas. Highlight: Más de 10 encuentros con agencias brindando entrenamiento a más de 100 profesionales de la publicidad. Público: Bloggeros y Twitteros · Acción: Encuentros 1:1s Descripción: En esta primera etapa de acercamiento se optó por reunirlos uno a uno para entender mejor sus necesidades y crear canales directos de comunicación que sean adecuados para su dinámica de trabajo. Mensajes principales: Todas las narrativas. Highlight: Alrededor de 10 encuentros 1:1. Público: Otros Grupos de Interés · Acción: Google Book Search / Eventos propios y prensa Descripción: En línea con el objetivo de organizar la información del mundo y hacerla universalmente accesible y útil, Google Book Search es la herramienta de Google que permite encontrar libros, editoriales y autores y representa la incursión de Google en una de las industrias más tradicionales, como lo es la editorial. Por este motivo fue necesario trabajar fuertemente en la educación de los actores ya instalados en el mercado y contener las posibles críticas, en su gran mayoría producto de un desconocimiento real de lo que representa para sus intereses. Con este objetivo se realizaron reuniones de prensa con periodistas especializados y encuentros directos con miembros de la industria (editoriales y referentes), en su mayoría alrededor de la Feria del Libro. De este modo se dio difusión al programa y se pudo contener además la circulación de suposiciones e información errónea. Mensajes principales: Google contribuye al acceso igualitario a la información. Highlight: 50 editoriales convocadas en una charla directa con representantes de Google Book Search. 20 periodistas participaron de reuniones, encuentros y entrevistas sobre esta temática. Más de 10 publicaciones sobre el tema. Tituló Clarín Sociedad: Más de 20 editores argentinos cerraron el acuerdo propuesto por el gigante de Internet y hoy ofrecen de este modo 8.000 títulos por la Web. Tituló &ODULQFRP³*RRJOHQRHVODFRPSHWHQFLD´ Evaluación y Pruebas En esta sección se encuentran algunos resultados generales y datos adicionales a lo reflejado en los highlights de cada una de las acciones descriptas anteriormente. · Al asumir el desafío de llevar adelante una gestión de PR capaz de modificar percepciones y actitudes reales por parte de los usuarios también asumimos la necesidad de considerar mediciones externas sobre la percepción y valoración de la marca. Uno de los principales indicadores que consideramos para poder evaluar el impacto en el usuario de forma directa fue la encuesta realizada con la metodología Trackingmerco, a partir de 1.400 encuestas a la población en general y publicadas en Mayo de 2010 por Clarín iEco, la cual señala a Google como al marca más valorada por los argentinos y revela la percepción de gran parte de la sociedad sobre el trabajo realizado durante 2009. Complementariamente, dentro del mismo ranking realizado por MERCO pero esta vez bajo el escrutinio de la opinión pública calificada (altos directivos), Google alcanzó la posición número 12, siendo una de las revelaciones del estudio. Por otra parte el Ranking Prestigio y Empresas del Centro de Estudios de Opinión Pública (CEOP) publicado en El Cronista en junio de 2010, colocó a Google en la posición número 15 en reconocimiento, escalando 6 posiciones respecto al año anterior. · Un análisis más abarcativo de la gestión de prensa realizada a lo largo del año y en línea con la necesidad de dotar de escalabilidad a todos los esfuerzos de comunicación arroja estas métricas: -­ 50 Minutos de aire en TV prime time con un público estimado de alcance de 50 millones de contactos. -­ Más de 4000 artículos en medios gráficos nacionales con más de 30 llamadas en tapa o notas de tapa. Cobertura en secciones y medios no espontáneamente asociadas con Google como Revista Cosmopolitan, Nubilis, Oh la la, Rolling Stone, Olé, Suplemento Sí!, etc. -­ La segmentación de artículos de acuerdo a las narrativas fue: Igualdad de Acceso (37%), Google actúa responsablemente (6%), Innovación (22%), Google hace la vida más fácil (22%), Google genera oportunidades económicas (13%). Esta distribución fue coherente con la distribución de las acciones para cada una de las narrativas y a los resultados esperados por la gestión de comunicación. · El alcance y la eficiencia de los resultados fueron medidos teniendo bajo consideración que Google no realizó para su campaña de comunicación ninguna inversión en publicidad (ni online ni offline). Los únicos proyectos con inversiones puntuales fueron el lanzamiento de Google Maps Argentina y TecnologiaSi, con un presupuesto mínimo destinado a cubrir algunos costos operativos y no para difusión. Conclusiones 1. El plan de comunicación se planteó por primera vez en alineación total y con un compromiso absoluto con la filosofía base de la compañía: centrarse en el usuario. 2. El plan definido para llevar esto adelante implicó trabajar sobre diversas acciones que contemplen a una amplia variedad de públicos pero siempre apalancadas en las personas -­-­como protagonistas o como voceros-­-­ y sus historias, haciendo al usuario parte de la comunicación y yendo más allá de la tecnología. 3. Como resultado, la gente eligió a Google como la marca más valorada entre todas las marcas de acuerdo al ranking de Clarín. 4. Crecer y seguir siendo queridos. La estrategia de PR finalmente logró posicionarnos más cerca del usuario y lograr su confianza, admiración y respeto. Esto sin lugar a dudas nos ayudará a atravesar en mejores condiciones el proceso de crecimiento de la compañía en Argentina. PREMIOS EIKON 2010 Categoría: Campaña General de Comunicación Institucional Caso: Fortalecimiento de la imagen institucional de La Rural Empresa: La Rural Predio Ferial de Buenos Aires. Integrantes: Por La Rural: Juan Pablo Maglier, Director de Relaciones Institucionales;; Leticia Guolo, Jefa de Relaciones Institucionales;; Jorgelina Guandalini, Jefa de Prensa Introducción 1. Historia y naturaleza de la compañía Creada en 1866, la Sociedad Rural Argentina (SRA) es una organización que agrupa a productores agropecuarios de la Argentina y que tiene por objetivo fundacional fomentar el desarrollo del país y promover el mejoramiento de la vida rural en todos sus aspectos, así como el de sus industrias complementarias y derivadas, asumiendo la más eficaz defensa de los intereses agropecuarios. En 1878 la SRA comienza a celebrar la Exposición Nacional de Ganadería en su predio de Palermo, inaugurando allí el recinto ferial La Rural. Hacia fines del siglo XXI, se remodelan las oficinas y pabellones de La Rural y se convierte en un complejo con una infraestructura de tecnología e inmobiliaria de última generación. Más tarde, en el año 2002, el Grupo de Narváez asume el gerenciamiento del predio, genera un replanteo de negocio y un reposicionamiento de La Rural como compañía, con un modelo de gestión dinámico y diversificado. Desde ese entonces, La Rural S.A. divide su paquete accionario en partes iguales entre la Sociedad Rural Argentina y el Grupo de Narváez. Así es como hoy La Rural, Predio Ferial de Buenos Aires es el recinto ferial más importante del país y de Latinoamérica. En 2009, albergó 40 ferias y exposiciones, 57 congresos y convenciones, más de 60 eventos empresariales y cerca de 30 eventos sociales, que recibieron a casi 4 millones de visitantes. Y se calcula que sólo en ese año, gracias a su actividad, La Rural generó directa e indirectamente más de 50.000 oportunidades de empleo. Entre las ferias y eventos más destacados, en 2009 La Rural fue escenario de arteBA, Feria del Libro, Feria Puro Diseño, el Congreso Forestal Mundial y el 24º Congreso Mundial del Gas. Además, La Rural participó en la organización del espacio Village Dakar del Rally Dakar Argentina-­Chile, BAFWEEK, ExpoNieve, Vinos y Bodegas, Nuestros Caballos y la tradicional Exposición Rural, entre otras exposiciones. A su vez, por primera vez La Rural se ubicó primera en el ranking anual de complejos del país que albergaron la mayor cantidad de congresos durante el último año que revela anualmente el medio especializado del sector. En los últimos años, La Rural fue evolucionando paulatinamente de su carácter de espacio físico al de compañía integral con misión, visión y valores, y perfil institucional, afianzada en sus productos y servicios. Por esta razón y como ícono de la Ciudad de Buenos Aires, centro receptor de múltiples eventos y negocios y punto de encuentro de millones de visitantes, La Rural tiene, siente y cree en el compromiso de contribuir con la sustentabilidad medioambiental y el desarrollo humano de su entorno. De este modo, La Rural cuenta con un plan de Responsabilidad Social Empresaria que incorpora permanentemente nuevas iniciativas y proyectos. 2. Causas por las que se generó el plan: Durante muchas décadas, La Rural fue percibida únicamente como un espacio, una sede para la realización de eventos. A su vez, su percepción estaba fuertemente vinculada al campo, a los temas agropecuarios y a la tradicional Exposición Rural. En cambio, La Rural es una compañía integral que cuenta con diversos productos y servicios, una organización con misión, visión y valores. Su misión es ser la ventana al mundo del mercado local, un ³PHHWLQJ SRLQW´ SDUD OD SURPRFLyQ GH RSRUWXQLGDGHV GH QHJRFLRV PRYLOL]DGRU GHO GHVDUUROOR SURGXFWLYR
local y nacional hacia el mundo. Estas características que hacen de La Rural una compañía, sumado al fuerte compromiso social evidenciado a través de sus programas de Responsabilidad Social Empresaria, no eran percibidas cabalmente como un atributo de la organización. La Rural contaba con gran cantidad de menciones en los medios de comunicación, pero de forma casi exclusiva como predio, sede de distintas ferias y eventos. Específicamente en el año 2008, según lo auditado por Management Press, se registraron 1.977 apariciones de La Rural en medios. Tan solo 7 corresponden a temáticas puramente de posicionamiento institucional, y 14 hacen mención a responsabilidad social empresaria pero se refieren únicamente a La Rural como sede de eventos solidarios (Festival Canta Conmigo de Caritas, cena solidaria de COAS, entre otros). 3. Plan de Respuesta: Posicionamiento de La Rural Para el año 2009, la Dirección de Relaciones Institucionales definió como objetivo general de su labor diario fortalecer la imagen institucional de La Rural, sin dejar de dar soporte en la comunicación de las ferias y exposiciones propias de la compañía. A tal fin, desarrolló un plan anual para posicionar a La Rural, Predio Ferial de Buenos Aires como compañía líder en la industria de eventos y actor de relevancia dentro de la industria del marketing en general. El plan se canalizó a través de distintas campañas de relaciones públicas, Responsabilidad Social Empresaria y prensa institucional, y continúa desarrollándose en el 2010. 4. Objetivos impuestos para el programa El objetivo general del plan se concentró en posicionar a La Rural, Predio Ferial de Buenos Aires como compañía integral, con acciones institucionales sólidas y consolidadas, marca paraguas para diversos productos y servicios, tales como la Exposición Rural, Vinos y Bodegas, Exponieve, Nuestros Caballos, entre otros, resaltando sus atributos de: empresa socialmente responsable líder en la industria de eventos;; fuerte actor el mercado de promociones y la industria del marketing Públicos a los que apunta el plan Público en general Instituciones, fundaciones y compañías clave para la organización Clientes y organizadores de ferias, congresos y eventos Prensa y líderes de opinión Público interno Ejecución 5. Descripción de los pasos y procesos La campaña de posicionamiento y visibilidad institucional se valió de una diversidad de productos y canales con el fin de fortalecer la imagen corporativa de la organización. Para ello, se trabajó de manera transversal con todos los eventos y productos que tuvieron lugar en La Rural. Las acciones emprendidas fueron: 5.a) Ajustes y mayor profundización del plan de Responsabilidad Social Se incorporaron nuevos programas al plan general de la compañía: * Impulsarte, programa de impulso al arte contemporáneo. Consiste en la selección obras de artistas contemporáneos exhibidos en arteBA para conformar una la colección artística propia de la compañía. La colección de obras Impulsarte es compartida con la comunidad a través de su exhibición en diferentes muestras y exposiciones que tienen lugar en el predio a lo largo del año. El programa se creó con los objetivos de: estimular el arte contemporáneo;; -­ promover a la feria arteBA como vidriera de excelencia para la expresión artística y vincular a La Rural con marcas prestigiosas como ser arteBA y otras grandes compañías que participan con programas de adquisición en la muestra, como Mercedes Benz, Petrobras, Zurich y Citi * Corazones Solidarios, ganas de ayudar. Se trata de una iniciativa conjunta de Responsabilidad Social de La Rural, América TV, Radio La Red y El Cronista, empresas pertenecientes al mismo grupo empresario. Nació en el 2009 con el objetivo de dar respuesta rápida y efectiva a situaciones de emergencia, crisis o contingencias sociales, climáticas y de cualquier otra índole, derivada de una sinergia grupal que se basa en el aporte individual que cada una de las compañías puede dar por su la naturaleza de su negocio. Desde su comienzo organizó funciones de Ópera Pampa a beneficio de Tartagal en febrero de 2009, Haití en febrero de 2010 y con motivo del Bicentenario a beneficio de Cáritas Buenos Aires y Fundación Tzedaka en junio de 2010. * Palermo Lee. Con el apoyo de Fundación El Libro consiste en facilitar a niños de nivel inicial y primario de escuelas públicas, comedores y fundaciones de Palermo la visita a la Feria del Libro, al brindarles el transporte e ingreso sin cargo, incluyendo un recorrido guiado y la participación en actividades educativas dentro de la feria. Su objetivo es contribuir a mejorar la imagen institucional en el entorno. Además, se profundizó la difusión de la comunicación de las acciones de RSE que la compañía ya tenía en marcha, sumadas a las que habían nacido en el 2009. El desafío incluía la detección de espacios en donde la empresa pudiera encontrar un canal de comunicación para informar estas acciones. * Ciclo de encuentros empresarios de UNIRSE La Rural fue auspiciante del Ciclo de Encuentros Empresarios de UNIRSE, newsletter especializado en Responsabilidad Social, que se realizó mensualmente en Terraza del Central, el restaurante del recinto. Esta alianza permitió compartir con otras compañías y fundaciones los avances del plan de RSE de la compañía. Entre otras empresas, se encontraron presentes Banco Santander, Edesur, IBM, Kimberly Clark, Natura, Nobleza Piccardo, Telecom, Telefé y Toyota. Además, también asistieron prestigiosas organizaciones como Amcham Argentina y Fundación Forge. * Asistencia a seminarios y conferencias sobre Responsabilidad Social Empresaria La Rural asistió a diversos seminarios y conferencias en materia de RSE con el fin de mantenerse actualizado en las nuevas tendencias en ese campo y de compartir los avances de su plan. Entre otros FXUVRV \ VHPLQDULRV /D 5XUDO HVWXYR SUHVHQWH HQ HO ³,, 6HPLQDULR GH 56( \ 'HVDUUROOR 6XVWHQWDEOH
Generando Valor a la empresa \DODVRFLHGDG_(VWUDWHJLDVGHFRQVROLGDFLyQGHXQDJHVWLyQUHVSRQVDEOH´D
cargo de Fundación Compromiso;; en el "Taller de Indicadores y Reportes de Sustentabilidad" organizado por Fundación Compromiso junto al Global Report Initiative (GRI);; en el 2do Seminario de Medio Ambiente y el 3er Foro de RSE organizados por El Cronista Comercial;; en las reuniones del Comité de RSE de AMCHAM Argentina y otras presentaciones de la misma organización sobre diversas temáticas en ese campo;; en el Taller de Indicadores de RSE organizado por IARSE. A su vez, presentó el Programa de Reutilización de Recursos en el Seminario de Responsabilidad Social Comunicativa organizado por Veali Group en el que se exhibieron los casos ganadores de las Distinciones RSC 2009. * La Rural redefinió su política de Cesión de Espacios, que establece la donación del alquiler de sus salones a fundaciones y ONG para acciones de recaudación de fondos. Durante 2009, la compañía dejó de concebir a esta política como un beneficio para ciertas instituciones en sus eventos de fundraising, y en cambio desarrolló alianzas con cada una de ellas de manera de incrementar su visibilidad. La Rural entonces fue sponsor de cada uno de los eventos, participando con una mesa para relacionamiento con periodistas e invitados especiales, incluyendo su logotipo en todos los soportes visuales del evento, así como con su spot institucional o avisos en los catálogos y brochures informativos de las instituciones. * Presentación del Programa de Reutilización de Recursos en Distinciones de RSC La Rural presentó su Programa de Reutilización de Recursos, que integra el plan de RSE de la compañía, en las Distinciones de Responsabilidad Social Comunicativa 2009, evento organizado por VEALI Group para premiar las actuaciones destacadas en temas relativos a la solidaridad y el bien público. La premiación se realiza desde el 2004, a partir de la iniciativa de Guillermo Petruccelli y el padrinazgo de Juan Carr. En el 2009, La Rural se presentó por primera vez para competir a la par de empresas de probada UHSXWDFLyQHQUHVSRQVDELOLGDGVRFLDO\IXHJDODUGRQDGDHQODFDWHJRUtD³(PSUHVDV´ * Mayor presencia internacional de La Rural Como parte de su compromiso con la industria de congresos y convenciones y con el objeto de consolidar la estrategia de inserción internacional de la compañía, La Rural presentó su Programa de Reutilización de Recursos en el marco de la Asamblea Anual de AFIDA la Asociación Internacional de Ferias de América en El Salvador. AFIDA es la mayor asociación continental de compañías que operan establecimientos equivalentes y es una excelente vidriera para el benchmarking y difusión de las políticas de Responsabilidad Social. El programa fue reconocido en su carácter de mejores prácticas de la industria en ese campo. 5HODQ]DPLHQWRGHOSURJUDPDDFOLHQWHV\SURYHHGRUHVHQ³3RGHPRV0iV´ La Rural dedicó el segundo bloque de Podemos Más, su programa de mejora contínua de la actividad ferial y congresística, a la Responsabilidad Social Empresaria. Presentó los avances alcanzados con el Programa de Reutilización de Recursos. Los directivos de las empresas organizadoras presentes manifestaron su interés en participar activamente para maximizar los alcances de esta iniciativa. 5.b). Apoyo publicitario Instrumentación de una pauta publicitaria dando continuidad y reforzando, según los casos, la presencia institucional en: * los principales medios especializados (Revista Ferias y Congresos, Anuario Perspectiva, Revista La Industria Ferial en Latinoamérica, Revista Eventos) * medios de información general y economía (Revista Bank, Revista Noticias, Revista Placet, Revista Apertura, Revista Secretarias y Negocios, El Cronista, América TV) * medios de responsabilidad social (Newsletter UNIRSE) * en catálogos de ferias y eventos (COAS, Cimientos, CUBA, Banco de Alimentos, Ronald Mc Donald, entre otros). 5.c) Plan de Relaciones Públicas Se desarrolló un plan de relaciones institucionales específico por medio del cual se identificaron y se establecieron actores clave (trendsetters, referentes, celebrities y endosers), creíbles e independientes que sirvan como aliados en la consolidación de la imagen y las actividades de la compañía. Se impulsó la construcción de una red de contactos a nivel público y privado con el fin de lograr una comunicación fluida entre voceros de la empresa, líderes de opinión y público objetivo. Para ello se extremaron los esfuerzos para tener una mayor presencia institucional dentro de ferias propias y externas a través de las siguientes acciones: * Cocktail para invitados especiales y periodistas en el VIP de BAFWEEK Primavera/Verano en agosto de 2009. * Charla de introducción a la cata de vinos con degustación para periodistas e invitados especiales en Vinos y Bodegas Wine Nights (edición 2009). * Almuerzos con invitados especiales y periodistas en el marco de Nuestros Caballos y la Exposición Rural, en Terraza del Central, el restaurante * Visitas guiadas y cocktails para invitados especiales y periodistas en el stand de Impulsarte, Programa de Estímulo al Arte Contemporáneo de La Rural en arteBA. * Envío de invitaciones a todos los eventos que se realizan en el recinto a ejecutivos de empresas y actores clave * Auspicio de distintos eventos propiciados desde el seno del Gobierno de la Ciudad de Buenos Aires, como SRU HMHPSOR HQ ³9LYt 3DOHUPR´ HO IHVWHMR GHO 'tD GH 3DOHUPR RUJDQL]DGR SRU OD -HIDWXUD GH *DELQHWH GH
Ministros y el Centro de Gestión y Participación Comunal Nº14, con el auspicio de una muestra fotográfica de imágenes históricas del barrio. A su vez, se buscó mejorar la comunicación con los clientes organizadores de ferias y eventos que eligen anualmente a La Rural como sede y fortalecer entre ellos la imagen de La Rural como compañía líder de la industria: * Lanzamiento de Podemos Más, Programa de Mejora Contínua de la Actividad Ferial y Congresística ³3RGHPRV PiV´ IXH FRQFHELGR HQ HO SRU OD 'LUHFFLyQ GH 5HODFLRQHV ,QVWLWXFLRQDOHV &RQWHPSOD OD
realización de encuentros periódicos e interactivos entre las empresas líderes organizadoras de ferias, exposiciones, congresos y convenciones, en donde los participantes comparten experiencias para reforzar las fortalezas de los procesos y la modalidad de trabajo vigentes e identificar aquellas áreas a mejorar, necesidades e intereses. El primer encuentro tuvo lugar el 1 de octubre en la Sala Nogal de La Rural, en donde se dieron cita 30 directivos que compartieron casos prácticos de ferias exitosas que se realizaron este año en un marco de crisis, abordaron contenidos de responsabilidad social empresaria y debatieron propuestas de mejoras ante problemáticas actuales que afectan al sector. * Lanzamiento del Club La Rural-­Consejo Profesional de Relaciones Públicas. La Dirección de Relaciones Institucionales de La Rural generó una alianza por la cual a través de una tarjeta de membresía personalizada al Club La Rural, se le brinda una serie de beneficios especiales a los más de 400 profesionales de comunicación que son socios del Consejo Profesional de Relaciones Públicas de la Argentina. El objetivo es fidelizar y propiciar una relación fluida y recíproca con este público que es afín a la compañía. 5.d) Campaña de Prensa Se generó un plan de relacionamiento con periodistas de medios gráficos, audiovisuales y digitales y una intensa campaña de prensa institucional para otorgar presencia y visibilidad a la organización, sus acciones institucionales y de responsabilidad social. * Convocatoria de periodistas a almuerzos y desayunos junto al equipo de RRII de La Rural con el objetivo de conocerse personalmente y trasmitir los mensajes institucionales * Se comenzó a generar un vínculo con periodistas de secciones de vidriera de los medios, y periodistas de marketing, comunicaciones y RSE, segmentos con los cuales anteriormente la compañía no tenía relacionamiento * Activa difusión de gacetillas de prensa e informaciones institucionales de forma permanente a lo largo del año, entre ellas las acciones del Plan de Responsabilidad Social Empresaria. Se gestionó la participación de la compañía en notas generales sobre Responsabilidad Social Empresaria, nombramientos de directivos, acuerdos institucionales. * Desayuno de presentación de balance anual de Responsabilidad Social. En noviembre de 2009, La Rural invitó a periodistas especializados en RSE a un desayuno de presentación de su balance anual y sus objetivos hacia 2010. Luego, se los invitó a presenciar un operativo del Programa de Reutilización de Recursos en el desarme de la Feria Internacional de Turismo (FIT). Además se los invitó a lo largo del año a presenciar distintas actividades de RSE realizadas por la compañía, como ser funciones especiales de Opera Pampa Educativo, stand Impulsarte en arteBA, funciones de Corazones Solidarios, entre otras. * Invitaciones a eventos de relacionamiento. La Rural invitó a periodistas especializados según la temática y líderes de opinión a los eventos de relaciones institucionales mencionados en el punto 5.c. * Se diseñó una planificación anual para el envío de salutaciones institucionales en los aniversarios de los medios, cumpleaños de periodistas clave y fechas especiales. También como acción de relacionamiento se les envío entradas a diversas exposiciones, acompañadas siempre de una carta institucional. * Día del periodista. A diferencia de 2008, año en el que se envió a los periodistas regalos sin vinculación directa con la marca, en 2009 se obsequió una tarjeta de invitación gratuita para el dinner-­show Tango Palace, espectáculo de producción integral de La Rural, junto a un elemento didáctico para aprender a bailar el tango. De este modo, se buscó vincular el obsequio con un producto propio de la compañía, invitando al periodista a que visite La Rural. * Aumento de la participación de directivos La Rural en notas generales y de interés como profesionales de la organización. * Convocatoria de celebrities y líderes de opinión a ferias y eventos y a acciones puntuales organizadas por la Dirección de Relaciones Institucionales con la consiguiente repercusión mediática, con el objetivo de fortaOHFHUODSHUFHSFLyQGH/D5XUDOFRPR³OXJDUDVSLUDFLRQDO´YLVLWDGRSRUSHUVRQDOLGDGHVS~EOLFDVGHDOWR
perfil. 5.e) Inclusión de noticias institucionales en las herramientas de comunicación de la compañía Se priorizó la inclusión de novedades institucionales en las herramientas de comunicación con las que contaba La Rural y que anteriormente sólo transmitían noticias vinculadas a ferias y exposiciones que tenían lugar en el predio. La comunicación de novedades institucionales al público interno se materializó a través del boletín interno ³/D5XUDO1HZV´FRPXQLFDGRVLQVWLWXFLRQDOHV\FDUWHOHUDV En tanto a nivel externo se difundieron contenidos institucionales en el website de La Rural, el newsletter externo de la compañía, comunicados institucionales puntuales enviados por correo electrónico y flyers informativos. 5.f) Gestión de la identidad institucional en la web 2.0. Se crearon cuentas institucionales de la marca en Facebook, Twitter, You Tube y Flickr y se realizaron acciones en sintonía con la comunicación que realizada a través de los medios tradicionales. La posibilidad que brinda Internet de fragmentar los públicos de manera específica permite el envío de PHQVDMHV VHJPHQWDGRV TXH DFUHFLHQWHQ HO VHQWLGR GH ³SHUWHQHQFLD´ SDUD HO FOLHQWH LQWHUno) y de identificación (para el cliente externo) con la organización. Resultados Las acciones encaradas y el desarrollo de alianzas contribuyeron a potenciar la valorización de los eventos que se realizan en La Rural y colaboraron en el fortalecimiento de la imagen de la marca ante la opinión pública. El resultado más visible se evidencia en el récord de publicaciones, alcanzándose en el 2009 un total de 108 repercusiones puramente institucionales en medios gráficos auditados por Management Press. Representa un incremento del 500% con respecto a la cantidad de menciones alcanzadas en el 2008 y un crecimiento del 4,8% en la participación institucional sobre el total de publicaciones de la compañía (que pasó del 1% en el 2008 al 5,8% en el 2009). Cabe destacar que del total de las 108 publicaciones, 75 (el 69%) tratan sobre acciones de Responsabilidad Social (RSE) y que si además se contabilizan notas registradas en agencias de noticias, medios digitales y audiovisuales no auditados por Management Press, las publicaciones institucionales logradas en el 2009 ascienden a un total de 210 y las referentes a RSE a 140. PREMIOS EIKON 2010 Categoría: Campaña General de Comunicación Institucional (PYME) Caso: MaterCell Empresa: MaterCell Agencia de PR: Mauro & Estomba Integrantes Por MaterCell: Dr. Claudio Chillik (Asesor Científico) y Oscar López Serrot (Gte. General) Por Mauro & Estomba: Lucio Mauro y Paola Estomba Introducción Acerca de MaterCell Fundado en 2003, MaterCell es el primer banco de células madre de cordón para uso propio de la Argentina. Se encuentra dedicado exclusivamente a la recolección, procesamiento y criopreservación de las células madre del cordón umbilical. MaterCell cuenta con la certificación ISO 9001: 2000 otorgado por el BVQI (Bureau Veritas Quality International) y posee oficinas en Pilar, Córdoba, Rosario, Mendoza y delegaciones en las principales ciudades del país. Además cuenta con el respaldo y asesoramiento de Matercell Biotech Suiza. Actualmente, más de 15 mil familias guardaron las células madre en Matercell. Escenario La medicina regenerativa, área de trabajo de MaterCell, es novedosa no sólo en la Argentina sino también en el mundo. Por eso MaterCell ha venido desarrollado una estrategia de comunicación permanente en el tiempo, la que se ha ido complejizando y adecuando a los escenarios políticos-­sociales, al devenir de la técnica y al crecimiento de la propia compañía. Respecto del futuro de la medicina regenerativa hay debate y polémica en torno a su aplicabilidad concreta, a qué enfermedades curará y a la cantidad de personas que podrán beneficiarse de ella. Hay incluso quienes están convencidos de que la medicina regenerativa será la nueva medicina en tanto revolucionará diagnósticos, tratamientos y cura de afecciones, incluso algunas hoy incurables. En este marco, MaterCell está llamada a jugar un papel activo porque se generaron voces desde el gobierno y desde algunos representantes de la ciencia y la medicina contrarias a la preservación de células madre para uso propio. En este sentido es importante destacar que MaterCell se enfoca exclusivamente en la guarda de células madre para uso propio y no tiene ningún vínculo con tratamientos o investigaciones clínicas. En efecto, el jueves 23 de abril de 2009 el tíWXOR FHQWUDO GH OD WDSD GH &ODUtQ IXH ³(O FRUGyQ XPELOLFDO
FRQJHODGR VHUi SDUD XVR S~EOLFR´ KDFLHQGR UHIHUHQFLD D OD 5HVROXFLyQ GHO ,1&8&$, TXH YHQtD D
cambiar radicalmente el negocio de los bancos de preservación de células para uso propio ya que a partir de la misma el Estado podría apropiarse de las muestras privadas para el uso de cualquier persona que la necesitara. Frente a este escenario complejo se redefinieron objetivos de comunicación y se trazó un plan de comunicación integral que atendía tanto a las necesidades vinculadas al posicionamiento de marca y la continuidad comercial como a una acción orientada al poder político y a la comunidad médico-­científica. En paralelo se trazó además una acción judicial para contrarrestar la resolución 069/09 del INCUCAI. Objetivo Mensajes Vinculados Informar y concientizar a la población sobre la El 99% del los cordones de los cerca de 700.000 partos importancia de la preservación de las células que se dan cada año en el país se desechan. Hay que madre de cordón umbilical en general ya sea cambiar esa realidad. para uso propio o para donación. Lo público convive con lo privado porque su concepción, sus fines y sus posibilidades son diferentes. Las células madre de cordón sirven para uso propio. Establecer y reforzar vínculos con líderes de Los bancos para uso propio están a favor de la regulación opinión y periodistas especializados. Establecer vínculos con el poder político (legisladores, poder ejecutivo, funcionarios de Salud, Ministerio de Ciencia y Tecnología) para para poder operar en un marco de certezas y pautas claras. Se trata de un servicio lícito y su potencialidad a futuro no es razón para invalidarlo. Experiencia mundial. Se desperdicia el 99% de los cordones por falta de concientización, interés, información, logística de recolección e infraestructura de conservación. ¿Por qué no trabajar en todo ese universo? Necesidad de encontrar una legislación que encuadre la actividad considerando tanto lo público como lo privado. Relevamiento de experiencia mundiales Informar sobre aspectos científicos de la técnica para generar percepción positiva sobre el mismo. Mejorar la imagen de su servicio entre la Inversión, investigación y desarrollo. opinión pública. Testimoniales y celebrities apalancando seriedad de la compañía 2-­ Plan de acción A partir del escenario y de los objetivos anteriores se sumaron nuevas herramientas de comunicación para potenciar a las anteriores. En lo concreto en el período 2009/2010: Diseño e implementación de una estrategia de Asuntos Públicos liderada por una consultora especializada en total interacción con la agencia de comunicaciones. El trabajo está orientado tanto a la búsqueda de una solución de corto plazo (modificación de la reso. 069/09 que permita la operación comercial y la habilitación de los bancos) y de largo plazo con la promulgación de una Ley Nacional. Internet 2.0: se estableció un acuerdo con el portal Materna.com y se desarrolló una página en facebook para potenciar la presencia de la marca en Internet y para especialmente estar en contacto directo con las usuarias y potenciales usuarias del servicio por medio de comunicaciones directas, encuestas on-­line, concursos, trivias. Esta serie de acciones permitió monitorear de manera permanente la acción de prensa y los efectos que el aspecto judicial y regulatorio tenía sobre la opinión pública. Celebrities: Se sistematizó el plan de relacionamiento con personalidades embarazadas para ofrecerle el servicio con el objetivo doble de lograr difusión mediática y la recomendación boca a boca entre su círculo de allegados. Capacitación: se puso en marcha un ciclo de charlas a cargo de médicos obstetras en la sede la empresa sobre temas de interés para la mujer embarazada. A estas acciones se sumaron las que ya venía haciendo la compañía y cuya continuidad se priorizó pese al vacío legal y la incertidumbre sobre el futuro comercial por entender que no se podía perder el espacio ganado y que la comunicación externa era funcional y necesaria para la acción de Asuntos Públicos. Éstas son: RR.PP. Se estableció una agenda de encuentros del vocero con periodistas y líderes de opinión. Prensa: Se continuó con la divulgación de materiales vinculados al área de Salud, a novedades empresarias y a testimoniales. Eventos: Presencia en eventos orientados a la Mujer y a la comunidad médica como el 28º Congreso de Ginecología Y Obstetricia de Buenos Aires (SOGIBA) Publicidad: Plan en medios especializados tanto de gráfica como en Internet Internet: resideño de Página web con nuevas funcionalidades para médicos y usuarias 3-­ Resultados Se reforzó el posicionamiento de MaterCell como referente del sector en los medios de comunicación, hecho comprobado por la cita de su marca y la convocatoria a su vocero a participar en las notas sobre la cuestión regulatoria y sectorial. Se logró un mantenimiento del ritmo de crecimiento en el número de contrataciones del servicio de criopreservación de células aún en medio del conflicto regulatorio y de la campaña de comunicación proactiva del gobierno para atacar la actividad. De las 12.000 muestras preservadas a fin de 2009 se pasó a 15.000 al cierre del presente trabajo. Se conformó y motorizó ABC Cordón, cámara empresaria que agrupa a los 8 bancos para uso propio, por iniciativa de MaterCell para liderar y concentrar la acción sectorial de Asuntos Públicos. Personalidades destacadas como Mariana Fabbiani, Nancy Duplá, Geraldine Neuman y Soledad Pastorutti contrataron el servicio y accedieron a contar públicamente el tema. Facebook: en los primeros meses de estar on line la página en facebook alcanzó cerca de 900 fans. Se logró la publicación de 184 notas de prensa en el período mayo 2009 a junio 2010, algunas particularmente importantes para la lucha judicial/regulatoria tanto por la difusión de fallos contrarios al INCUCAI como por notas positivas sobre la actividad como la de La Nación de enero de 2010, que incluso fue tapa. PREMIOS EIKON 2010 Categoría: Campaña General de Comunicación Institucional (Regional) Caso: Sensor Yanbal de la Mujer Empresa: Yanbal Agencia de PR: Mora y Araujo grupo de comunicación Integrantes Por Mora y Araujo grupo de comunicación Daniel Valli Introducción El reto de Yanbal Yanbal International es una corporación presente en 8 países dedicada a la producción y comercialización de cosméticos, perfumes y joyas a través de un sistema de venta directa por catálogo. El programa de comunicación que se presenta en este documento fue diseñado para la unidad de negocios de Yanbal en Bolivia y debido a su éxito está siendo replicado por la misma compañía en 4 países de Sudamérica. Fundada en 1967, Yanbal trabaja en la investigación y desarrollo de productos para la mujer, los jóvenes y la familia, incluyendo productos de tratamiento de rostro, cuidado personal, maquillaje, fragancias y bijouterie de calidad mundial, que se comercializan de forma exclusiva mediante la venta a través de ³&RQVXOWRUDV GH %HOOH]D´ (V XQD GH ODV PDUFDV OtGHUHV HQ %ROLYLD \ FRPSLWH FRQ RWUDV HPSUHVDV FRPR
$YRQ/¶(EHO\1DWXUDHQWUHRWUDV La naturaleza de la compañía presenta un doble desafío de comunicación en forma permanente. Por un lado, al basarse en un sistema multinivel de venta por catálogo, es necesario demostrar la oportunidad que representa formar parte de la fuerza de ventas. Es decir, el principal producto de la empresa no es tangible: es la oportunidad de formar una microempresa y crecer. El segundo desafío constante es vincular sólidamente la marca Yanbal con la mujer. Tanto la oportunidad de negocios que ofrece la empresa como la gran mayoría de sus productos, están dirigidos a un target femenino. De hecho, solo mujeres integran su fuerza de ventas que, en Bolivia, supera las 30.000 personas facturando activamente. La venta directa es un motor de empleo y la mujer es la principal protagonista en este sector de la economía. Yanbal impulsa lo que denomina la Oportunidad para la mujer, un proyecto que le permita crecer económicamente y que es clave en el proceso de posicionamiento público. En 2007 y según nuestro diagnóstico, en Bolivia podía notarse un vacío en la opinión pública respecto a la realidad y las aspiraciones de la mujer. Yanbal se relaciona diariamente con la mujer y sabe de la necesidad de valorar su rol en la familia y en el entorno social y su potencial como emprendedora para generar ingresos y lograr una vida mejor. Por lo tanto, el desafío de fondo era contribuir a instalar en los medios y en la agenda pública la problemática de la mujer y generar un ambiente favorable para mejorar su desarrollo personal y profesional. En este contexto era necesario producir contenidos relevantes y ±sobre todo± consolidar la relación de la mujer con Yanbal. Estos contenidos debían ser relevantes desde el punto de vista periodístico que fomentaran cambios de actitud como una contribución concreta para debatir estos temas. 2. La propuesta de Mora y Araujo Grupo de Comunicación Luego de elaborar un diagnóstico situacional para esta compañía, mora y araujo grupo de comunicación presentó una Estrategia de Posicionamiento Público. Desde luego, la Estrategia abarcó varios ámbitos vitales para el posicionamiento, incluyendo comunicación interna y externa, marketing, brand PR, auspicios y relaciones públicas;; con ejes transversales de comunicación y acciones específicas en cada uno de estos ámbitos. Entre los desafíos abordados en la Estrategia, estuvo el problema específico mencionado anteriormente. Luego de la investigación y el análisis, mora y araujo grupo de comunicación propuso enfrentar este reto creando el Sensor Yanbal de la Mujer Boliviana (en adelante, el Sensor Yanbal). 3. Objetivos En lugar de definir objetivos en términos meramente comerciales, el programa fue concebido como una acción de amplio alcance social. El impacto sobre el posicionamiento de la marca debía ser una consecuencia natural, pero planificada, que genere el programa. Por este motivo, los objetivos del Sensor Yanbal fueron planteados en los siguientes términos: a. Generar información periódica y relevante para los medios de comunicación en relación a la temática de género. b. Revelar el rol actual de la mujer boliviana como actor social y económico. c. Profundizar el conocimiento de la sociedad respecto a las preocupaciones, necesidades, pensamientos y sentimientos de la mujer sobre su realidad. d. Aportar información para el desarrollo de iniciativas públicas y privadas enfocadas en la mujer. e. Generar un ambiente propicio para el desarrollo empresarial de la mujer. 4. Áreas de Acción Para perseguir estos objetivos, el programa se diseñó en base a dos dimensiones básicas. La primera dimensión -­y la más importante-­ fue la realización y difusión de investigaciones regulares sobre la realidad de la mujer en el país. Este es el núcleo central de la iniciativa y provee el insumo necesario para relacionarse con los medios de comunicación. En la segunda dimensión del programa se contemplaron una serie de espacios y acciones de relacionamiento e intercambio, tales como foros y cursos, que tomaran la información del Sensor Yanbal como fuente de información, vinculando más y mejor a la empresa con públicos estratégicos, con miras a fortalecer la reputación corporativa. 5. Lapsos de tiempo previstos En cuanto a la disposición de las acciones en el tiempo, se planteó una primera etapa de 12 meses, durante la cual se debían realizar y publicar tres investigaciones, además de llevar a cabo actividades de encuentro y relacionamiento vinculadas a la misma temática. Tras una evaluación de los resultados al final del primer año, se decidió incorporar el Sensor como una línea de acción permanente en la estrategia de la compañía. 6. Públicos En lo que respecta a los públicos del programa, se definió como audiencia primaria a los periodistas y medios de comunicación bolivianos, y a través de ellos, a la opinión pública en general. Además, se contempló la necesidad de llegar a líderes de opinión, autoridades y especialistas en la temática de género. B. Ejecución del plan 1. Alianza con medios estratégicos Se decidió seleccionar a los tres principales diarios del país, ubicados en cada una de las ciudades más importantes: La Razón (La Paz), El Deber (Santa Cruz) y Los Tiempos (Cochabamba). Tras una serie de gestiones personales con los Jefes de Redacción se convirtió a estos medios en aliados del Sensor. Bajo un compromiso de exclusividad, Yanbal ofreció los resultados de cada investigación a estos medios en forma anterior al resto de la prensa boliviana. 2. Estudios de investigación Durante el periodo 2008/2009, se llevaron a cabo 5 trabajos de investigación. La mayoría de ellos tuvieron como núcleo la metodología cuantitativa (encuestas a 1.050 casos aleatorios en 4 ciudades del país). Además, se realizó una investigación de tipo cualitativo con 12 grupos focales en 3 ciudades, con mujeres de diversos estratos socioeconómicos. Todos los estudios fueron diseñados por mora y araujo grupo de comunicación y el trabajo de campo estuvo a cargo de una firma especializada en investigación (Captura Consulting SRL). Los temas de las investigaciones fueron los siguientes (comenzando por la más reciente): Los cambios de la mujer boliviana (Octubre 2009) Estudio Cualitativo (Grupos focales sobre tres temas -­ Marzo 2009): La relación entre el hogar y el ámbito laboral Principios y valores Igualdad de derechos y oportunidades La percepción de los hombres sobre la mujer (Encuesta a hombres -­ Octubre 2008) La educación de los hijos (Abril 2008) Valores y principios de la mujer (Febrero 2008) Oportunidades de la mujer boliviana (Octubre 2007) 3. Análisis y difusión de las investigaciones Los resultados se presentaron a los medios aliados en reuniones especialmente organizadas para este fin en cada una de las ciudades seleccionadas. Más que reuniones de presentación, fueron encuentros de intercambio que derivaron en publicaciones amplias y analíticas por parte de los medios. En estas reuniones participaron: Gerentes de Yanbal Periodista a cargo de la cobertura Analista externa invitada por Yanbal para aportar en la interpretación de los resultados Investigadores a cargo del estudio La difusión de los resultados se realizó en fechas de importancia clave: Día Internacional de la Mujer Día de la Mujer Boliviana Día de la Madre Una vez realizadas estas reuniones, se llevaron a cabo acciones de difusión en otros medios: Tours de medios en radio y televisión Gestiones individuales con revistas y semanarios seleccionados 4. Los Foros del Sensor Yanbal A medida que se acumularon datos revelados por el Sensor Yanbal de la Mujer Boliviana, se organizaron eventos de reflexión e intercambio con líderes de primera línea a nivel nacional, aprovechando como principal insumo la información generada por este proyecto. A su vez, estos foros fueron instancias de sumo valor para el relacionamiento con los medios. Las periodistas que publicaron los resultados del Sensor participaron activamente en las mesas redondas y, por otro lado, diversos medios de comunicación cubrieron los eventos generando repercusiones positivas para la compañía. Se organizaron dos foros, uno en La Paz y otro en Santa Cruz, con la participación de las siguientes panelistas: Foro en La Paz: Magdalena Cajias (Ministra de Educación) Ana Maria Romero de Campero (Ex Defensora del Pueblo) Cecilia Levy (Reconocida educadora y escritora) Claudia Benavente (Doctora en Ciencias Sociales y Periodista) Justa Canaviri (Conductora de Televisión) Carolina Virreira (Comunicadora Social y Escritora) Margaret Hurtado (Psicóloga) Foro en Santa Cruz Paula Peña (Historiadora) Ruth Lozada (Ex Presidenta del Comité Cívico Femenino) Manigeh Roosta (Socióloga y Doctora en Educación) Isabella Prado (Psicóloga Social e Investigadora) Paola Senseve (Escritora) Inés Panoso (Representante de la Casa de la Mujer) &LFORGH7DOOHUHV³&XDQGR\RFDPELRHOPXQGRFDPELD´ En las investigaciones del Sensor Yanbal se reveló que una preocupación crítica en las mujeres bolivianas es la temática de los valores. Por este motivo, se organizaron talleres en el marco del proyecto con una especialista en la temática. Los talleres estuvieron dirigidos a mujeres líderes del ámbito público, privado y de la sociedad civil. Cecilia Levy, la capacitadora de los cursos, es autora de un libro sobre educación en valores y conferencista de reputación internacional. Al igual que los foros, estos cursos se organizaron tanto en La Paz como en Santa Cruz. Diversos medios de comunicación cubrieron estos eventos. C. Evaluación 1. 48 apariciones en medios impresos, en su mayoría ±más del 80%-­ de páginas completas en los principales diarios del país. 2. 33 apariciones en televisión, incluyendo los canales más importantes del país, con un total de 137 minutos cubiertos. 3. En un sondeo de percepciones realizado a 48 periodistas y autoridades a principios de 2010, el 43% calificó el Sensor como uQD ³H[FHOHQWH LQLFLDWLYD´ HO FRPR ³PX\ EXHQD´ \ HO FRPR
³EXHQD´ $GHPiV OD LQPHQVD PD\RUtD GH ORV HQWUHYLVWDGRV LGHQWLILFy HO YDORU GH HVWH SUR\HFWR
como una iniciativa de Responsabilidad Social Empresarial. 4. Se logró implementar todos los pasos previstos originalmente: 6 investigaciones, 12 encuentros de presentación con medios y analistas, 2 foros con autoridades y líderes y 2 cursos de capacitación. 5. Los encuentros regulares con la prensa para compartir información relevante crearon un nuevo SDWUyQHQODVUHODFLRQHV³UHIUHVFDQGR´ODLPDJHQGHODFRPSDxtDIUHQWHDSHULRGLVWDVGHLPSRUWDQFLDFODYH
otorgando estatura al tipo de noticias generadas por la empresa y creando nuevas oportunidades en otras áreas de trabajo. 6. Seleccionado por la Corporación Yanbal International como una práctica exitosa, el proyecto está siendo replicado por la compañía en 4 países de la región. 7. Luego de realizarse un diagnóstico a profundidad de los resultados obtenidos, la empresa decidió incorporar el Sensor Yanbal como una línea de acción permanente en su estrategia de negocios y ampliar el alcance del proyecto. Para ello, se encargó a mora y araujo grupo de comunicación, la elaboración de un plan a largo plazo, que incluya acciones de responsabilidad social y alianzas con instituciones civiles que operan en la temática de género. 8. En un ranking independiente de reputación corporativa publicado en el diario El Deber (Abril 2010) Yanbal ocupa el primer lugar en su rubro (677 puntos) y está entre las 15 empresas de mejor reputación en el país. Los resultados del Sensor Yanbal de la Mujer permiten inferir la incidencia de este proyecto sobre los índices de reputación alcanzados. D. Anexo 1. Cobertura de prensa del Sensor Yanbal 2. Ranking de reputación corporativa de empresas boliviana a abril de 2010. PREMIOS EIKON 2010 Categoría: Relaciones con la Comunidad Caso: El Camión de la Mujer Empresa: Philips Argentina Agencia de PR: Ketchum Argentina Integrantes: Por Philips: María Alejandra Grignani, Corporate Communications Philips;; Sabrina Guidi, Corporate Communications & Social Sustainability, Philips Por Ketchum Argentina: Gustavo Averbuj CEO, Ketchum;; Valeria Bazzi, Managing Director, Ketchum;; Luciana Moraña, Ejecutiva de cuentas, Ketchum Introducción Royal Philips Electronics de los Países Bajos (NYSE: PHG, AEX: PHI) es una compañía cuyas actividades cubren todos los aspectos del cuidado de la salud y del bienestar, enfocada en mejorar la vida de las personas a través de innovaciones necesarias en el momento oportuno. Como líder mundial en cuidado de la salud, estilo de vida e iluminación, Philips integra tecnologías y diseño en soluciones centradas en las personas, basadas en el profundo conocimiento del cliente y en la promesa de maUFD ³6HQVH DQG
6LPSOLFLW\´ Con sede en los Países Bajos, Philips cuenta aproximadamente con 116.000 empleados en más de 60 países en todo el mundo. Con una facturación de 23.000 millones de euros en 2009, la empresa es líder de mercado en cuidados cardíacos, cuidados intensivos y cuidado de la salud en el hogar, soluciones de iluminación con uso eficiente de energía, como así también productos de estilo de vida para el bienestar personal y el placer con fuertes posiciones de liderazgo en TV plana, afeitadoras y cuidado personal masculino, entretenimiento portátil y cuidado de la salud bucal. A través de su unidad de negocios de equipos de monitoreo de pacientes y en el mercado de medicina de diagnósticos de alta resolución, contribuye a detectar y diagnosticar enfermedades en su fase inicial. La tecnología para el Cuidado de la Salud es desarrollada para la comodidad física y emocional del paciente, creando una experiencia personalizada como también un ambiente de trabajo más agradable, mejorando así el contacto entre el paciente y el equipo médico. Philips Argentina fue fundada en 1935 como una fábrica de lámparas y desde entonces ha sido líder en el desarrollo de la industria local, creando y ofreciendo productos de avanzada tecnología, fáciles de experimentar y con sentido para la vida de las personas. Al igual que en el resto del mundo, Philips Argentina busca innovación constante para sus clientes y consumidores, creando un ambiente que ayude a los empleados a alcanzar todo su potencial y desempeñando un rol activo en la comunidad donde vive y trabaja. En este sentido la empresa es reconocida en el país por su fuerte política del cuidado del Medio Ambiente y de Responsabilidad Social. Philips pone a las personas en el centro de todo lo que hace. Apoya a las comunidades y trabaja con programas continuados de inversión social en el ámbito de la salud, educación y medio ambiente, y a través del acercamiento de alta tecnología a la vida de las personas. Desde hace más de 12 años, Philips Argentina lleva adelante un proyecto de responsabilidad social orientado al cuidado de la salud que tiene como objetivo acercar sus recursos tecnológicos en forma totalmente gratuita a pacientes de bajos recursos, su Camión de Diagnóstico por Imágenes. La Argentina es un país de 3,8 millones de kilómetros cuadrados, con 40 millones de habitantes y un gran déficit en materia de salud que se agrava por su extensa geografía. Se calcula que en nuestro país se diagnostican 4000 casos de cáncer uterino por año, de los cuales el 50% son casos mortales. Entre 5 y 6 mujeres mueren por día en nuestro país a causa de esta enfermedad cuya causa principal es la infección por HPV. Asimismo, una de cada 8 mujeres tendrá cáncer de mama a lo largo de su vida. Anualmente se registran en nuestro país entre 15.000 y 20.000 nuevos casos de cáncer de mama. La mitad de las pacientes logran curarse y las probabilidades de sobrevivir aumentan considerablemente si el cáncer se detecta tempranamente. Se ha comprobado que las mamografías son una herramienta precisa y eficaz para obtener este tipo de diagnósticos. -­'HO³&DPLyQWRPyJUDIR´DO³&DPLyQGHOD0XMHU´ Considerando la relevancia de estos datos en relación a la salud de la mujer, Philips Argentina desarrolló en 1998 una Unidad Móvil de DiDJQyVWLFR SRU ,PiJHQHV FRQRFLGD FRPR HO ³&DPLyQ 7RPyJUDIR´ 6X
objetivo era recorrer el país brindando el servicio de tomografías computadas en forma gratuita a las comunidades más necesitadas. Ese proyecto creció a lo largo de los años y en 2003 la compañía se contactó con la LALCEC (Liga Argentina de Lucha Contra el Cáncer), una entidad de bien público sin fines de lucro orientada a la prevención y al diagnóstico de enfermedades neoplásicas. Desde su implementación hasta fines del año 2005, realizó más de 14.000 tomografías. (QHOSUR\HFWRWRPDXQQXHYRJLUR\DQRHQHOGLDJQyVWLFRVLQRHQOD3UHYHQFLyQ\QDFHHO³&DPLyQ
GH OD 0XMHU´ FRQ HO REMHWLYR GH DFHUFDU UHFXUVRV WHFQROyJLFRV SDUD OD SUHYHQFLyQ GH HQIHUPHGDGHV
oncológicas a mujeres de bajos recursos que no pueden acceder a este tipo de tecnología y a adecuados servicios de salud. De esta forma, el Camión de la Mujer comienza a realizar los estudios médicos para la prevención del cáncer de mama y cuello de útero en forma totalmente gratuita a pacientes de bajos recursos así como a trabajar en el diagnóstico y seguimiento de pacientes oncológicos. Desde el primer momento Philips y LALCEC supieron que no era tarea fácil hacer estos estudios en mujeres de bajos recursos, ya que en muchos casos se podían sentir temerosas y hasta intimidadas. Para ello, además de la contención de los médicos, se iluminó el Camión con tecnología de LED (Light Emitting Diode o Diodos Emisores de Luz) por dentro con colores pastel, que pudieran dar la sensación de un espacio acogedor y así proponer una experiencia lo más confortable posible. La unidad móvil está equipada con tecnología de última generación: Mamógrafo digital Philips, Ecógrafo 4D Philips, Workstation de imágenes para el procesamiento, la transmisión y archivo de las mismas;; Impresora láser y Colposcopio, además de un Grupo electrógeno propio. Este equipamiento permite unir el diagnóstico a la prevención y se lograr un tratamiento global del tema. Ejecución del Plan /D WDUHD GHO ³&DPLyQ GH OD 0XMHU´ HV compleja pero está muy bien organizada. LALCEC tiene 150 representaciones distribuidas en todo el país, desde Jujuy hasta Ushuaia, desde Mendoza hasta la Costa Atlántica. Cuando el Camión llega a una de esas ciudades, los voluntarios de la ONG ya realizaron la comunicación a la comunidad y la correspondiente convocatoria. El mecanismo funciona inmediatamente cada vez que el Camión llega a un destino de su recorrido. El paciente llega con un turno previamente otorgado por la representación de LALCEC y se le realizan los estudios necesarios que demuestran si padece alguna enfermedad. En cada jornada hay una médica ginecóloga, una técnica radióloga y el chofer. Los resultados son evaluados en LALCEC y los médicos responsables especializados realizan un informe médico detallado que se entrega al hospital de la zona. Cuando el personal médico de la unidad móvil recibe los resultados de las imágenes digitales y de los análisis de los pacientes, dependiendo del cuadro clínico analizado, cita nuevamente al paciente para que se realice una serie de estudios específicos utilizando el resto de los equipos que se encuentran en la unidad móvil. A través del LALCEC y del hospital de la zona se realiza un seguimiento de cada paciente y en paralelo se recopila la información brindada por los estudios realizados a fin de poder generar datos estadísticos locales de la presencia del cáncer de mama y de cuello de útero en las distintas zonas de nuestro país . -­Las Madrinas En el 2006, se buscó integrar al proyecto la figura de mujeres reconocidas que respaldaran la iniciativa. $VtVHFRQYRFyDODSHULRGLVWD0yQLFD&DKHQG¶$QYHUV\ODGLVHxDGRUDGHPRGDV3DXOD&DKHQG¶$QYHUVSDUD
ser las madrinas del proyecto, ya que ambas vencieron el cáncer de mama y se comprometieron juntas con esta causa ayudando a difundir la importancia de la prevención. De esta forma se logró un mayor acercamiento con la gente, transmitirles mayor seguridad y un respaldo que facilita la credibilidad de las mujeres que sienten miedo a someterse a estos estudios. La participación GH SHUVRQDOLGDGHV S~EOLFDV FRPR 0yQLFD &DKHQ G¶$QYHUV \ 3DXOD &DKHQ G¶$QYHUV FRPR PDGULQDV GHO
proyecto, le da credibilidad y difusión al proyecto. -­Aliados Uno de los desafíos de la práctica ha sido convocar el apoyo de grandes empresas para lograr la autosustentabilidad del proyecto. De esta forma, desde 2006 hasta 2009, la iniciativa contó con la contribución de Medicus, empresa líder de medicina prepaga de capitales nacionales creada y dirigida por médicos. Con una trayectoria superior de más de 35 años en el país, Medicus aportó al proyecto el personal médico que realiza los exámenes médicos y de laboratorio. A partir del 2010, con más de 35 años ofreciendo un servicio de salud que privilegia las necesidades de sus socios y les permite elegir libremente la mejor atención médica, el Grupo OSDE renueva su compromiso de participación activa en la comunidad y se suma al proyecto en calidad de sponsor. Con presencia nacional de más de 400 Centros de Atención Personalizada, OSDE es un aliado en cada localidad visitada por el Camión. -­Alcance Los esfuerzos de comunicación y difusión son vitales para el éxito de los programas de prevención y promoción de la salud. Por ello, la campaña del Camión de la Mujer se complementó en 2009 y 2010 con una campaña de relaciones con los medios, que tuvo como objetivo lograr una amplia difusión de las actividades con foco en la prevención y la salud de la mujer desarrolladas por Philips. Como parte de estos esfuerzos, se organizaron media trips a diferentes localidades visitadas por la unidad móvil a fin de que la prensa pudiese experimentar de cerca la actividad. Además, se realizó un envío periódico de informaciones de prensa sobre el recorrido del Camión de la Mujer a revistas y suplementos femeninos y secciones de RSE de medios on y off-­line. En el marco del Día Internacional de la Mujer, se brindaron charlas informativas sobre salud femenina y la importancia de la prevención en el tratamiento de enfermedades oncológicas. Estas tuvieron lugar en el Unicenter Shopping, y este año la acción se replicó también en otro centro comercial del Grupo Cencosud, Las Palmas del Pilar . Las conferencias estuvieron a cargo del Dr. Antonio Lorusso, Director Médico de LALCEC y especialista en prevención de cáncer de mama y ginecológico y contaron con el testimonio de Mónica Cahen d´Anvers, periodista y madrina del Camión de la Mujer. -­Responsabilidad social en los productos Continuando con su compromiso con el cuidado de la salud, Philips Argentina incorporó al packaging de su línea de depiladoras de fabricación nacional (HP 6609, 6400 y 6401) un folleto informativo que desarrolló junto con LALCEC (Liga Argentina de Lucha Contra el Cáncer) sobre recomendaciones para el cuidado de las mamas y la detección oportuna de enfermedades mamarias. IDENTIFICACIÓN, ANÁLISIS Y CUANTIFICACIÓN DE LOS RESULTADOS Año 2007: -­Recorrido: El Camión visitó las provincias de Buenos Aires, Santa Fe, Salta y Jujuy en Argentina Comenzó su recorrido en Buenos Aires, en el Instituto de Oncología Ángel H. Roffo de la Capital Federal. Durante los meses de mayo, junio, julio y agosto visitó Rosario, Jujuy y la provincia de Salta respectivamente. En Rosario, visitó el predio municipal CEMAR. En Jujuy el Hospital General San Martín de Jujuy. En Salta, visitó las localidades de Embarcación, Tartagal, Orán y Ciudad de Salta. A finales de 2007 el Camión de la Mujer cruzó la frontera y visitó las ciudades de Santiago, Rancagua, Santa Cruz y Linares en Chile. -­Estudios realizados: 3.296 en Argentina y 1.501 en Chile. Año 2008: -­Recorrido: La Unidad Móvil visitó la región noroeste de la Argentina, recorriendo las provincias de Entre Ríos, Corrientes, Chaco, Misiones, Formosa y Santa Fe. -­Estudios realizados: 3.261. Año 2009: -­Recorrido: Fueron visitadas 22 localidades de la provincia de Buenos Aires, entre ellas Laprida, 9 de Julio, Lincoln, Salto, Pergamino, Madariaga y Mar del Plata;; y 2 de Santa Fe, Rosario y Villa Constitución. -­ Estudios realizados: 6.729. Año 2010: -­Recorrido: el camión comenzó su recorrido en el mes de abril visitando las localidades bonaerenses de Campana, Zárate y Lima. Además, tiene previsto visitar, en los próximos meses, las provincias de Entre Ríos, Chaco y Formosa. -­Estudios realizados: dato no disponible a la fecha de presentación de este caso. PREMIOS EIKON 2010 Categoría: Relaciones con la Comunidad Caso: Optimismo que transforma Empresa: Coca-­Cola de Argentina y Walmart Argentina Agencia de PR: Urban PR Integrantes: Por Coca-­Cola: Silvina Bianco Por Urban PR: Verónica Cheja Introducción Coca-­Cola de Argentina y Walmart Argentina, con el apoyo de la Fundación AVINA, buscan dejar una KXHOOD SRVLWLYD HQ VX UHODFLyQ FRQ OD FRPXQLGDG D SDUWLU GH OD LQLFLDWLYD ³2SWLPLVPR TXH WUDQVIRUPD´ XQ
programa integral de recuperación de envases para su reciclado que invita a los consumidores a convertirse en agentes de cambio. Coca-­Cola de Argentina, empresa líder en la producción y comercialización de bebidas sin alcohol establecida en el país en 1942, comercializa y distribuye las marcas de bebidas más reconocidas del mundo. Su compromiso con la comunidad y el desarrollo sustentable se enmarca en la plataforma FRUSRUDWLYD ³9LYLHQGR 3RVLWLYDPHQWH´ TXH HQJORED DFFLRQHV HQ ORV VLJXLHQWHV SLODUHV HVWUDWpJLFRV
Bienestar, Comunidad, Ambiente y Entorno Laboral. Walmart Argentina, empresa que trabaja desde 1995 a través de sus 23 Supercenters y 7 Changomas, con un fuerte compromiso para ofrecer día a día un surtido diferencial sobre la base de más de 75.000 productos, HQHOPDUFRGHXQDSROtWLFDFRQVWDQWHGH³3UHFLRVEDMRVWRGRVORVGtDV£6LHPSUH´TXHSHUPLWD
TXH OD JHQWH ³DKRUUH GLQHUR \ YLYD PHMRU´ 5HVSHWR SRU HO LQGLYLGXR H[FHGHU ODV H[SHFWDWLYDV GH ORV
clientes y búsqueda de la excelencia, constituyen las bases sobre las cuales sustenta las relaciones con sus públicos de interés. Al igual que Coca-­Coca, su cultura corporativa se centra en un fuerte compromiso con la comunidad, constituyéndose en un miembro activo de la misma a través de diversos programas nacionales y acciones ORFDOHV 3DUD :DOPDUW OD5HVSRQVDELOLGDG 6RFLDO HVXQ ³FRQWUDWR´ TXH VH HMHUFH D WUDYpV GHOD ILJXUD GHO
Voluntariado Corporativo. En esa misma línea, la preocupación por la preservación del medioambiente y el desarrollo sustentable se ha convertido en un eje de su estrategia. B. Ejecución del Plan AIDIS Argentina (Asociación de Ingeniería Sanitaria y Ciencias del Ambiente) destaca que el problema de la gestión de los residuos sólidos se complejiza en las sociedades a medida que las ³SREODFLRQHVFUHFHQHQ
tamaño y cambian sus hábitos de consumo, produciéndose una variación de los parámetros de cantidad y FDOLGDG´ GH ORV UHVLGXRV (Q HVWH VHQWLGR ³H[LVWH XQ FRQVHQVR PXQGLDO UHVSHFWR D TXH OD JHVWLyQ GH
residuos sólidos debe ser efectuada contemplando tres condiciones básicas e imprescindibles: la VXVWHQWDELOLGDG DPELHQWDO OD DFFHVLELOLGDG HFRQyPLFD \ OD DFHSWDELOLGDG VRFLDO´ (Q HO FDPSR GH ODV
políticas públicas, se reconoce que es preciso trabajar en la concientización, como herramienta clave para llevar adelante programas exitosos en el plano ambiental. &RQ HVD SHUVSHFWLYD ³2SWLPLVPR TXH 7UDQVIRUPD´ EXVFD KDFHU XQ DSRUWH D OD JHVWLyQ UHVSRQVDEOH GH
residuos sólidos, estableciendo actividades en el marco de objetivos específicos: Los objetivos principales son: ‡2EMHWLYRDPELHQWDO -­Aumentar el recupero de envases a través de campañas que generen conciencia en la población sobre la importancia del reciclado y reutilización de los envases. -­Alentar a los consumidores a convertirse en agentes de cambio. -­Promover el uso de material reciclado para la elaboración de nuevos productos. ‡2EMHWLYR VRFLDO JHQHUDU XQ PRGHOR GH SURJUDPD TXH D WUDYpV GHO UHFLFODGR EULQGH EHQHILFLRV D OD
comunidad local a partir de la donación de productos elaborados con materiales reciclados. Además, el programa pretende generar un sistema de recolección sustentable, replicable y perdurable en el tiempo. ‡2EMHWLYRVGHDILDQ]DPLHQWRGHODVUHODFLRQHVHQODFDGHQDGHYDORUDILDQ]DUODVUHODFLRQHVHn la cadena de valor entre las dos compañías, con acciones que trascienden lo comercial y evidencian la coincidencia en su compromiso con la sustentabilidad. De esta manera, el objetivo es fortalecer la relación cliente-­
proveedor en función de un proyecto de trabajo conjunto. En función a estos objetivos, el plan de acción conllevó diferentes actividades para difundir el programa en WLHQGDV \ HVWDEOHFLPLHQWRV GH ³HVWDFLRQHV GH UHFLFODMH´ SDUD OD UHFXSHUDFLyQ GH ORV PDWHULDOHV QR VyOR
entre consumidores de Walmart, sino también en el público en general. La campaña de comunicación se amplió con la concientización en escuelas sobre los beneficios de disponer de productos realizados con materiales reciclados a través de las donaciones. Y se establecieron alianzas con cooperativas de recicladores urbanos que destinan el material recuperado al reciclado. En total, el programa agrupa a ocho cooperativas de recicladores urbanos que operan en las distintas áreas activadas, bajo la siguiente mecánica: 1.Se propone a los clientes de Walmart y vecinos de sus tiendas, separar los envases en sus hogares, acondicionarlos y depositarlos en estaciones de reciclado dispuestas en los Supercenters participantes de la acción. 2. Se reciben los materiales en las 14 tiendas de Walmart localizadas en la Ciudad de Buenos Aires, Gran Buenos Aires, Córdoba, Santa Fe, Paraná y Mendoza. 3. Se pesan los materiales y se trasladan con fletes a las sedes de las cooperativas, donde sus miembros los acondicionan y venden para su reciclado. 4. Coca-­Cola y Walmart donan juegos realizados con PET reciclado (un subibaja, una hamaca, un tobogán y un banco) a escuelas cercanas a cada tienda y seleccionadas por los Comités de Ayuda a la Comunidad de las tiendas de Walmart y por los socios embotelladores de Coca-­Cola en cuyos territorios existen tiendas Walmart activadas (Coca-­Cola Femsa de Buenos Aires, EDASA y Reginald Lee). La campaña de donación se realiza bajo condiciones que pueden verse en www.optimismoquetransforma.com y en función de la cantidad de material recolectado por cada tienda. En relación al afianzamiento de la cadena de valor, las campañas de difusión del programa a nivel interno incluyeron la participación de varias áreas de las Compañías, los embotelladores de Coca-­Cola y las tiendas Walmart. C. Evaluación/comprobación La multiplicidad de públicos de interés que trabajan en pos del mismo objetivo fomenta la integralidad de un programa que contribuye a la concientización de todos los públicos en relación a la importancia del reciclado. Campaña de concientización ‡3DUD HO ODQ]DPLHQWR GHO SURJUDPD VH GHVDUUROOy XQD FDPSDxD GH FRPXQLFDFLyQ TXH EXVFy JHQHUDU
concientización en la opinión pública en diferentes puntos del país. Así, entre el mes de diciembre de 2008 y enero de 2009 se desarrollaron 14 piezas de comunicación para el público en general, que explicitaron gráficamente cómo un envase vacío podía ser valorizado y reutilizado. El programa se difundió en radio y prensa gráfica. En el mes de abril-­mayo de 2010 se reforzó la campaña de concientización con nueva presencia en vía pública: un total de 345 carteles en Gran Buenos Aires y Capital Federal llevaron el mensaje de ³2SWLPLVPRTXHWUDQVIRUPD´DXQHVWLPDGRGHFRQWDFWRV$GHPiVHQODVWLHQGDV:DOPDUt se incluyeron mensajes en el reverso de los tickets de venta, separadores de compra de las líneas de caja y señalética (floorgraphics en la entrada al espacio de venta, banners de pie al lado de las puertas automáticas de la entrada, lonas perimetrales en estacionamientos, cubrealarmas en la línea de cajas y banners colgantes en el pasillo de ingreso al espacio de venta). Los mensajes en el reverso de los tickets de venta tienen un impacto especialmente significativo. Pues en cada una de las 14 tiendas de Walmart incluidas en el programa se realizan en promedio 125.000 transacciones mensuales, por lo cual cerca de 1.764.000 personas recibieron cada mes el mensaje de ³2SWLPLVPRTXHWUDQVIRUPD´ Como parte de la campaña comunicacional, el 2 de mayo fue publicado un aviso en la revista VIVA de Clarín para comunicar los resultados. En las estaciones de reciclado se publicó el listado de las escuelas que recibieron juegos, generando transparencia. A su vez, se comunicó la cantidad de material recolectado y destinado al reciclado. ‡$O ILQDOL]DU OD GLIXVLyQ HQ YtD S~EOLFD GXUDQWH OD FDPSDxD GH ODQ]DPLHQWR HO DXPHQWR GHO UHFXSHUR GH
material fue del 200% entre diciembre de 2008 y febrero de 2009, con respecto a lo recolectado previamente. ‡(QMXQLRGHOD agencia Craverolanis recibió una distinción por el diseño de esta campaña, otorgado por la Cámara Argentina de Anunciantes en el marco de los premios CAMPRO. ‡3RU~OWLPR³2SWLPLVPRTXHWUDQVIRUPD´VHGLRDFRQRFHUHQGRVHGLFLRQHVGHODUHYLVWD:DOPDUW durante su lanzamiento. Además, de abril a junio de 2009, en las tiendas activadas, se difundió un programa a través de mensajes en los tickets de venta, separadores de compra de las líneas de caja y señalética en las tiendas participantes. Resultados del programa ‡'HVGH HO LQLFLR GHO SURJUDPD KDVWD HO PHV GH PD\R GH VH UHFXSHUDURQ PiV GH WRQHODGDV GH
materiales para reciclar. ‡+DVWDHOPHVGHDEULOGHVHUHFXSHUDURQPiVGHHQYDVHVGH3(7NJ ‡+DVWDHOPRPHQWR\DVHdonaron juegos didácticos para 100 escuelas. 50 se donaron en julio de 2009, y 50 en abril de 2010, destinados a más de 25.000 alumnos ‡3RU OD LPSOHPHQWDFLyQ GH HVWH SURJUDPD &RFD-­Cola de Argentina fue reconocida por Walmart ³6XVWDLQDELOLW\ $ZDUG´ TXH Gistingue iniciativas empresarias relacionadas con la preservación del ambiente. ‡³2SWLPLVPRTXHWUDQVIRUPD´WDPELpQIXHUHFRQRFLGDSRU$P&KDPFRQHO&LWL]HQVKLS$ZDUGHQ Contribución al desempeño de la empresa ‡³2SWLPLVPR TXH WUDQVIRUPD´ FRQWULEXye al desempeño de Coca-­Cola de Argentina y Walmart en tanto materializa sus objetivos ambientales, relacionados con el fortalecimiento de su alianza, el involucramiento del público interno en acciones de responsabilidad social y el compromiso hacia la comunidad. ‡'HHVWDPDQHUD&RFD-­Cola trabaja en el recupero de envases (como lo viene haciendo desde el 2004 con HOSURJUDPD6DQ,VLGUR5HFLFODHQHOPDUFRGHODSODWDIRUPDGHVXVWHQWDELOLGDG³9LYLHQGR3RVLWLYDPHQWH´ ‡$VLPLVPR OD SUHRFXSDFLyQ SRU OD SUeservación del ambiente es uno de los pilares de la cultura corporativa de ambas compañías a nivel local e internacional, llevando adelante acciones para brindar soluciones concretas a la problemática, convirtiendo a los miembros de la comunidad en agentes de cambio. ‡³2SWLPLVPRTXHWUDQVIRUPD´VHHQPDUFDHQHVDILORVRItD\FRQWULEX\HDPDWHULDOL]DUHOFRPSURPLVRFRQ
el desarrollo sustentable. ‡(QUHODFLyQDORVS~EOLFRVLQWHUQRVGH&RFD-­Cola, participan de las donaciones los tres embotelladores del sistema con tiendas activadas en su territorio (Edasa, FEMSA y Reginald Lee). También se involucraron en el programa cinco áreas de la Compañía, para las cuales el programa contribuye a sus objetivos estratégicos: Cuentas Claves, Asuntos Públicos y Comunicaciones, Marketing, Legales y Comunicación Interna. ‡$GHPiV D WUDYpV GH ³2SWLPLVPR TXH WUDQVIRUPD´ HO GH ODV WLHQGDV GH :DOPDUW HQ HO SDtV
participan de una iniciativa de cuidado ambiental. Próximos pasos Se seguirá trabajando en la optimización de los procesos con el objeto de hacer escalable y cada vez más sustentable el programa. Replicabilidad La difusión y las estrategias de concientización contribuyen a la replicabilidad del programa, en tanto dejan instalado entre los vecinos y la comunidad la posibilidad del reciclado, incentivando a la separación de los residuos en origen y destacando los beneficios ambientales y sociales que esto conlleva. Por otro lado, se desarrolla un esquema de trabajo con pautas, responsabilidades y objetivos concretos que se documenta en todas sus etapas y que permite que el programa sea replicado en otros contextos y por otros actores del sector público, privado y organizaciones de la sociedad civil. PREMIOS EIKON 2010 Categoría: Relaciones con la Comunidad Caso: Empleo con Apoyo Empresa: Arcos Dorados Agencia de PR: Green Communications Integrantes: Por Arcos Dorados: Andrea Repetto -­Jefe de Recursos Humanos;; Gabriela Lacovinno -­ Consultora de Recursos Humanos;; Diego Benenzon-­ Director de Recursos Humanos Cono Sur Introducción Hace algunos años se pensaba que las personas con discapacidad sólo podían realizar actividades en talleres manuales. Actualmente se comienzan a considerar diferentes oportunidades de empleo en el mercado de trabajo abierto. En Arcos Dorados hemos sido pioneros en la materia, ya que desde hace 17 años tenemos como objetivo que los jóvenes con discapacidad puedan ejercer su derecho a trabajar. La realidad Argentina: El Censo Nacional del año 2001 ha arrojado como resultado que en la República Argentina existen 36 millones de habitantes. Se estima que el 7% de la población posee alguna discapacidad. Otro dato relevante es que el índice de desocupación de esta población estaría en el orden del 90%. Fuente: ENDI -­Encuesta Nacional Complementaria de Personas con Discapacidad, Indec. Nuestro Compromiso: 7HQHPRV OD REOLJDFLyQ GH GHYROYHU DOJR D OD FRPXQLGDG TXH WDQWR QRV GD´ 5D\ .URF IXQGDGRU GH
McDonald's). Es por esto que Arcos Dorados S.A. realiza distintos aportes a la Comunidad: a) Programas de integración de personas con discapacidad. b) Apoyo a la Fundación Ronald McDonald (Casas Ronald McDonald, Unidad Pediátrica Móvil). c) Programas especiales para preservar el medio ambiente. A. Ejecución del Plan: Programa Empleo con Apoyo El Programa Empleo con Apoyo le brinda a los jóvenes con discapacidad la posibilidad de incluirse en el mundo laboral, fortaleciendo el desarrollo de sus capacidades. Mejora la empleabilidad de las personas que lo integran como así también resuelve en gran parte su posibilidad de incorporarse al mercado laboral. En Arcos Dorados encuentran no sólo un empleo, sino un lugar en donde capacitarse y entrenarse en diferentes áreas para ayudar a su evolución. De esta manera, la familia se siente no sólo contenida, sino que su familiar participa, genera ingresos, y encuentra un lugar donde realizarse y establecer vínculos. El Programa de Empleo con Apoyo se encuentra directamente relacionado con la Misión, la Visión y los Valores de Arcos Dorados. La Visión Duplicar el valor de la compañía ampliando el liderazgo en cada uno de los mercados. La Misión Servir comida de calidad proporcionando siempre una experiencia extraordinaria. Los Valores Brindamos Calidad, Servicio y Limpieza a nuestros Clientes. Promovemos el Espíritu Emprendedor. Tenemos un fuerte compromiso hacia nuestra gente. Maximizamos la rentabilidad de nuestras operaciones. Operamos el negocio en un marco Ético y Responsable. Contribuimos con el desarrollo de las Comunidades en las que operamos. Objetivos del Programa Empleo con Apoyo: Facilitar al joven con discapacidad su inclusión en el mundo laboral. Favorecer el desarrollo de sus capacidades. Fomentar y estimular en el mercado laboral la creación de programas de inclusión: Hoy participan del Club 40 empresas. Concientizarnos y concientizar que la persona con discapacidad puede insertarse en el mundo laboral en aquellas tareas que está en condiciones de desarrollar, con eficacia y buen rendimiento. Insertar jóvenes con discapacidad en locales McDonald's. Desarrollo del Programa El Programa Empleo con Apoyo trabaja en conjunto con la Fundación Discar que es una institución que coordina el programa. Desde 1993 coordina la integración de personas con discapacidad en Arcos Dorados. En la actualidad, 112 jóvenes con discapacidad trabajan en los locales McDonald's de todo el país y participan de este programa jóvenes con discapacidad mental / retraso mental. La edad promedio de estos jóvenes es de 30 años. La Fundación Discar se encarga de: Realizar seguimiento a los jóvenes. Brindar en conjunto con Arcos Dorados orientación a la familia y a la empresa. Asesorar al equipo de Gerentes. Mantener una comunicación fluida con los locales intercalando mensualmente llamadas telefónicas y visitas. Dar apoyo como especialistas para la solución de posibles inconvenientes. Informar periódicamente al Departamento de Recursos Humanos sobre el desarrollo del Programa (planilla de evaluación). El Departamento de Recursos Humanos de Arcos Dorados determina las vacantes disponibles y la Institución Coordinadora realiza entrevistas con postulantes y sus familias, en las que se profundiza sobre experiencia laboral, intereses, preferencias, disponibilidad, aptitudes, habilidades, nivel de sociabilización. Luego el Departamento de Recursos Humanos conjuntamente con la Institución Coordinadora realizan la inducción e incorporación de los nuevos integrantes. Los profesores de la Fundación capacitan a los futuros entrenadores (empleados de McDonald's). Los jóvenes son entrenados en diferentes áreas del local por personal de la Compañía. Todos los empleados que participan del Programa Empleo con Apoyo gozan de los mismos beneficios, mismo salario y tienen las mismas obligaciones que los empleados de Arcos Dorados. Los Beneficios del Programa: El Programa Empleo con Apoyo cuenta con innumerables beneficios entre los que se destacan los siguientes: Beneficio Individual: ayuda a los empleados a sentirse realizados y a comprometerse con una ocupación útil, ayudando también a su sociabilización al permitirles insertarse dentro de un grupo de trabajo. ³0F'RQDOG
V HV PL VHJXQGD FDVD PH VLHQWR PX\ ELHQ PH KDQ UHFLELGR PX\ ELHQ HVWR\ PX\ DOHJUH (V
como una casa más grande, con muchRV DPLJRV $Fi FUHFt \ DFi TXLHUR FUHFHU´ (VWHEDQ 0ROLQD
empleado de Arcos Dorados Argentina desde 1993). Beneficio Familiar: Que el joven trabaje impacta positivamente en la familia. Pasa a sentirse útil, tiene sus tiempos y responsabilidades. Buenos trabajadores: Nuestra experiencia indica que responden muy bien a tareas que requieren de concentración y meticulosidad. Son cumplidores y sus reportes de inasistencia son menores a los del estándar de los empleados. Compañeros de trabajo: los hace sentirse importantes al ser asignados como entrenadores de un compañero que necesita de su apoyo. Compañeros de trabajo: los hace sentirse importantes al ser asignados como entrenadores de un compañero que necesita de su apoyo. Entrenamiento hombro a hombro. Valoración de la empresa que le da la posibilidad de ayudar y compartir el trabajo con discapacidad. Los jóvenes con discapacidad que trabajan en los locales McDonald's gozan de los mismos derechos y tienen las mismasobligaciones que la legislación laboral prevé para el resto de los trabajadores. ‡&RQWUDWDFLyQHIHFWLYDSRUWLHPSRLQGHWHUPLQDGR ‡0LVPDUHPXQHUDFLyQ ‡0LVPDREUDVRFLDO ‡0LVPRSDJRGHDSRUWHV\FRQWULEXFLRQHV La antigüedad promedio del Programa Empleo con Apoyo en McDonald's es de 10 años. B. Evaluación de Resultados de las Acciones El Programa Empleo con Apoyo genera en los compañeros de trabajo un sentimiento de solidaridad, colaboración y crecimiento al relacionarse con los jóvenes del Programa. El Programa se inició en el año 1993 cuando 9 jóvenes se integran a Arcos Dorados por iniciativa del CEO, Woods Staton. (QODDFWXDOLGDGMyYHQHVFRQGLVFDSDFLGDGWUDEDMDQHQORVORFDOHV0F'RQDOG¶VGHWRGRHOSDtV El empleado más antiguo de este Programa lleva 17 años en la empresa. No sólo se benefician los jóvenes integrantes de este programa, sino que la familia se ve claramente beneficiada por los motivos expuestos anteriormente. Adicionalmente, las Fundaciones con las que se lleva adelante el programa tienen la oportunidad de seguir creciendo, al tener a Arcos Dorados como aliado estratégico a la hora de empleabilizar a los jóvenes. D. Empresas comprometidas de Argentina: McDonald's forma parte del Club de empresas comprometidas con la empleabilidad de las personas con discapacidad. Objetivo del Club: Promover la inserción laboral de los trabajadores con discapacidad en el sector privado. Arcos Dorados es miembro fundadora de este Club y promueve la inclusión y participación de otras empresas en este Programa. Desde marzo 2004 se realizan encuentros para intercambios de experiencias entre empresas que ya han contratado personas con discapacidad, otras que tienen intenciones de hacerlo y otras que buscan asesoramiento. Hoy participan 40 empresas activamente. El Club de Empresas Comprometidas cuenta con la participación de la Oficina de Empleo de la Unidad para Personas con Discapacidad del MTSS. Para quienes integramos McDonald's el trabajo es un canal de realización y el vínculo de unión entre un individuo y su comunidad. Es responsabilidad de todos lograr una sociedad que no discrimine ni margine, brindando a todos los individuos igualdad de oportunidades para su desarrollo y estimulando permanentemente su inclusión dentro del mercado de trabajo. PREMIOS EIKON 2010 Categoría: Asuntos Públicos / Lobbying Caso: La Prevención de la Gripe A en Embarazadas: Prioridad 1 Empresa: UNICEF Integrantes: Por UNICEF: María José Ravalli, Responsable de Comunicación, UNICEF Argentina. Zulma Ortiz, Responsable de Salud, UNICEF Argentina. Introducción 1. Información Institucional El Fondo de las Naciones Unidas para la Infancia (UNICEF) es un organismo miembro de las Naciones Unidas cuyo mandato es ayudar a los países a cumplir con sus compromisos adquiridos en materia de derechos humanos. Desde 1983, trabaja en Argentina para garantizar la supervivencia, la protección y el desarrollo de todos los niños, niñas y adolescentes. Para llevar adelante sus objetivos, UNICEF trabaja con diversas estrategias, entre ellas, brinda asistencia técnica, genera investigaciones y estudios, incide sobre temas clave, aboga por quienes no son escuchados, provee asistencia financiera y promueve espacios de diálogo. UNICEF siempre se ha dedicado a prestar ayuda en las situaciones de emergencia, tanto las naturales como las de origen humano. La organización, que inicialmente se llamó Fondo Internacional de Emergencia de las Naciones Unidas para la Infancia, se creó con el propósito de brindar ayuda humanitaria a la niñez de un mundo fracturado por la Segunda Guerra Mundial. 2. Problemática Durante 2009, Argentina se vio seriamente afectada por la pandemia de Gripe A (H1N1). Las mujeres embarazadas y los niños menores de 5 años fueron las poblaciones más afectadas, entre los casos graves. A partir del 17 de mayo de 2009 se notificó la circulación autóctona del virus, alcanzando el pico máximo de transmisión entre el 20 de junio y el 3 de julio, fecha en la cual existió una transmisión generalizada en todo el país. Al 31 de octubre, se notificaron 1.241.612 casos de Enfermedad Tipo Influenza en todo el territorio nacional, de los cuales 12.471 requirieron hospitalización. Al 11 de noviembre, el Ministerio de Salud de la Nación reportó la internación de 316 embarazadas con sospecha de influenza H1N1. De estos casos, se descartó la enfermedad en 22% (70) y se confirmó en 54% (170). En correspondencia al comportamiento de la pandemia en el resto de la población, el inicio de los síntomas en la población de embarazadas se observó en la última semana de junio y primera de julio del 2009. Durante los primeros meses de la pandemia existía gran incertidumbre en la población respecto de las medidas adecuadas para prevenir la enfermedad, esta situación se acentuaba en las mujeres embarazadas, quienes inicialmente no accedían a información específica y posteriormente recibían información confusa. Los profesionales de la salud carecían de información específica respecto del tratamiento más apropiado en mujeres embarazadas, en especial, para los casos serios. Específicamente, fallaba el acceso y la distribución apropiada de información actualizada y confiable acerca de qué tipo de drogas usar para tratar a las mujeres embarazadas, los riesgos para ellas y sus fetos, así como su efectividad. Por otro lado también fallaba el acceso a información respecto de cómo estas drogas, en caso de ser consumidas, afectaban a los bebes durante el proceso de lactancia. Los hospitales y centros de salud, especialmente guardias y terapias intensivas, estaban desbordados por la demanda y contaban con escaso tiempo para investigar y seleccionar evidencia científica relevante para el tratamiento de las mujeres embarazadas. Esta situación también estuvo acompañada por una crisis política que culminó con la renuncia de la Ministra de Salud de la Nación, Lic. Graciela Ocaña y sus equipos, y la asunción del actual Ministro de Salud, Dr. Juan Manzur. Durante los primeros meses de la pandemia se observó que desde las instituciones rectoras de la Salud, a nivel nacional y provincial, existía escasa difusión de información respecto de las recomendaciones necesarias para la prevención de la Gripe A (H1N1) en mujeres embarazadas y para su tratamiento. 3. Objetivos UNICEF implementó un proceso de lobby para influir en la estrategia de prevención de la Gripe A (H1N1) del Ministerio de Salud de la Nación y del Ministerio de Salud de la Provincia de Buenos Aires. El objetivo principal fue: -­Influir para incluir y priorizar a la mujer embarazada en las acciones de prevención de Gripe A (H1N1) impulsadas por el Ministerio de Salud de la Nación y el Ministerio de Salud de la Provincia de Buenos Aires. El periodo planificado para alcanzar este objetivo fue de 2 semanas, a partir de que asumiera el nuevo Ministro. Los objetivos secundarios fueron: -­ Incidir y apoyar la generación de recursos comunicacionales dirigidos a las mujeres embarazadas con recomendaciones especificas para la prevención de la enfermedad. El periodo planificado para alcanzar este objetivo fue de 3 meses. -­ Incidir y apoyar la generación de recursos informativos y capacitación de los equipos de salud respecto de las recomendaciones para el diagnostico, tratamiento y atención de las mujeres embarazadas afectadas por la Gripe A (H1N1). El periodo planificado para alcanzar este objetivo fue de 2 meses, a partir del pico máximo iniciado el 20 de junio. -­ Incidir para que los medios de comunicación realicen coberturas que contribuyan a mejorar el conocimiento por parte de la población afectada por una epidemia. El periodo planificado para alcanzar este objetivo es de 5 años, ya que está enmarcado en el programa quinquenal de comunicación de UNICEF Argentina. Ejecución 4. Públicos, Canales de comunicación, Acciones y Mensajes Entre los públicos destinatarios de este plan, se encontraban los representantes de Ministerio de Salud de la Nación y de la Provincia de Buenos Aires. Inicialmente los canales de comunicación fueron informales, a través de los cuales, se indagó acerca de la situación de las mujeres embarazadas en el país. Para llegar a los tomadores de decisión se realizaron reuniones bilaterales entre los referentes de ambos Ministerios y UNICEF. En estas reuniones se presentó la evidencia científica internacional y se planteó la importancia de que la autoridad nacional emitiera recomendaciones dirigidas especialmente a las mujeres embarazadas para de esta manera evitar mensajes contradictorios que se emitían desde diferentes instituciones. Estos mensajes contribuirían a generar confianza y seguridad en la población y en los equipos de salud. El mensaje central fue, las mujeres embarazadas son las más afectadas por la pandemia y deben ser priorizadas. Otra de las audiencias destinatarias de este plan fueron las propias mujeres embarazadas. Las acciones y canales de comunicación diseñados para llegar a ellas fueron: -­ El desarrollo de spots para la televisión y piezas para medios gráficos con recomendaciones específicas realizados por el Ministerio de Salud. -­ La producción de un spot para la televisión con la participación de Gastón Pauls junto a Agustina Cherry. Esta pieza de comunicación buscó clarificar la situación de las mujeres afectadas por el virus y su vínculo con la lactancia. Por primera vez juntos en una producción televisiva, Pauls y Cherry, incentivaron a las mujeres para continuar con la lactancia materna aún durante la enfermedad. Esta pieza fue desarrollada por UNICEF. (anexo 1) Los spots se transmitieron a través de los principales canales de televisión nacionales y provinciales. La pieza gráfica se publicó en los periódicos argentinos de mayor circulación. Los spots también se difundieron en internet y distribuyeron a través de distintos portales dedicados a brindar información a la mujer embarazada. -­ Se desarrollaron folletos y posters entre el Ministerio de Salud de la Nación y UNICEF. (anexo 2 y 3) -­ Se elaboraron materiales informativos entre el Ministerio de Salud de la Provincia de Buenos Aires y UNICEF. (anexo 4) Para vehiculizar estas informaciones a las mujeres embarazadas, se utilizaron los canales existentes previos a la pandemia y de reconocida efectividad. Los materiales gráficos desarrollados junto al Ministerio de Salud, se distribuyeron a los hospitales y centros de salud, a través del programa Remediar de probada eficacia. Los materiales informativos para mujeres embarazadas desarrollados junto al Ministerio de Salud de la Provincia de Buenos Aires, se distribuyeron a través de una reunión presencial de capacitación para los referentes de cada una de las subregiones de la provincia. -­Se elaboraron boletines informativos periódicos con información sobre la Pandemia y recomendaciones. (O PHQVDMH SDUD ODV PXMHUHV HPEDUD]DV IXH ³VL HVWiV HPEDUD]DGD QR GHMHV GH KDFHUWH ORV FRQWUROHV´
³$QWH HO PHQRU VtQWRPD GH JULSH DQGi DO KRVSLWDO R D OD PDWHUQLGDG´ \ ³$PDPDQWDU VDOYD YLGDV
VLHPSUH´ Los equipos de salud y las autoridades de los centros de salud/hospitales constituyeron también una audiencia prioritaria de este plan. Este grupo es al mismo tiempo el principal referente a la hora de informar a las mujeres embarazadas. Si ellos no cuentan con información apropiada, es muy complejo poder prevenir y morigerar una pandemia. Entre las acciones desarrolladas se cuentan: -­ UNICEF realizó una revisión exhaustiva de la información disponible sobre el tratamiento de la mujer embarazada. -­ UNICEF elaboró una guía y recomendaciones para el tratamiento de la mujer embarazada, su atención ambulatoria, su internación y la organización del hospital.(anexo 5) Esta información fue circulada por mail a través de la red con la que cuenta el Ministerio de Salud de la Provincia de Buenos Aires. También se realizó una capacitación presencial con todos los responsables de los servicios de salud de las subregiones. Estas personas son las encargadas de difundir a nivel de su subregion la información. Se realizó una encuesta en la capacitación que dio cuenta de la importancia de contar con este material. (OPHQVDMHFODYHSDUDORVVHUYLFLRVGHVDOXGIXH³/DVPXMHUHVHPEDUD]DGDs son las más afectadas por la SDQGHPLD \ GHEHQ VHU SULRUL]DGDV´ \ ³'XUDQWH XQD SDQGHPLD HV QHFHVDULR PDQWHQHUVH LQIRUPDGR FRQ
HYLGHQFLDYiOLGD\FRQILDEOHGHIXHQWHVRILFLDOHV´ Finalmente los medios de comunicación constituyeron otra de las audiencias prioritarias. Durante una pandemia, los medios de comunicación tienen la posibilidad de visibilizar temas en la opinión pública, facilitar el acceso a información confiable y reducir los temores exagerados. Durante la pandemia, UNICEF implementó acciones que tradicionalmente realiza en este tipo de situaciones, entre ellas: proveer información confiable;; generar un diálogo directo con los líderes de opinión y constituirse como vocero en temas de su incumbencia, entre otras. Asimismo UNICEF decidió monitorear la cobertura periodística que realizaron los medios sobre la Gripe A. Específicamente se realizó un análisis cuantitativo de las noticias sobre Gripe A y Embarazo (fuentes, género, tapa, origen, etc) y un análisis cualitativo de las noticias que hacían referencia a la muerte de mujeres embarazadas como consecuencia de la pandemia. Se analizaron los medios: Clarín, La Nación, Crónica, Crítica, Página 12, La Voz del Interior y La Capital de Rosario, desde el 1 de mayo al 15 de agosto. Esta investigación constituye una herramienta para incidir sobre los medios de comunicación basado en evidencia. Los resultados arrojados se presentaron en una reunión dirigida a especialistas en salud, autoridades nacionales y medios de comunicación, junto al Dr. Nelson Castro. (anexo 6) (OPHQVDMHFODYHSDUDORVPHGLRVGHFRPXQLFDFLyQHV³XQDSDQGHPLDHVXQDRSRUWXQLGDGSDUDPHMRUDUOD
GHPDQGDGHVHUYLFLRV\FRQLHQWL]DUDODSREODFLyQPiVYXOQHUDEOH´ Evaluación 5. Resultados Podemos afirmar que la labor de lobby con las autoridades fue efectiva, ya que el Ministerio de Salud de la Nación lanzó una campaña específica dirigida a las mujeres embarazadas. Posteriormente a la fecha en la cual se sostuvieron reuniones con los tomadores de decisión, observamos que se incluyeron recomendaciones para mujeres embarazadas en las conferencias de prensa diarias y en los comunicados de prensa oficiales (anexo 7). Asimismo la Presidenta de la Nación, en el marco de las visitas semanales a hospitales por la gripe H1N1, eligió visitar una maternidad y habló sobre el tema Durante la Campaña de Prevención para la Gripe A 2010, las mujeres embarazadas fueron priorizadas en las piezas de comunicación. Se realizaron recomendaciones y materiales específicos dirigidos a ellas (anexo 8). En relación a las mujeres embarazadas, se distribuyeron 1.200.000 ejemplares aproximadamente por cada una de piezas de comunicación, en centros de salud, hospitales y salitas. Los spots desarrollados fueron transmitidos por la televisión abierta y por cable durante dos semanas. Las piezas gráficas aparecieron en los medios de mayor tirada. Según información provista por el Ministerio de Salud de la Provincia de Buenos Aires, podemos observar que disminuyó la tasa de consulta de las mujeres embarazadas en consultorios y hospitales públicos de la provincia de Buenos Aires. En relación a los medios de comunicación, a partir del estudio realizado pudimos observar que del total de notas publicadas sobre Gripe A, solo un 25% estuvo vinculado con el embarazo, aún cuando este grupo era de los más afectados. El tema de la Gripe A ocupó el 50% de las tapas, de ese 50% tapas solo un 34% se refirió a la situación de la embarazada. De las notas dedicadas a las mujeres embarazadas y la enfermedad solo un 14% hizo referencia a las medidas preventivas. La cobertura se concentró exclusivamente en las licencias laborales, pero perdió una oportunidad para transmitir información acerca de los cuidados esenciales que requieren las mujeres en esta condición. Solo para mencionar un ejemplo, se hubiera esperado que se incluyan recomendaciones sobre la vacunación y la importancia de consultar al médico frente a determinados síntomas. Las noticias con referencia a las muertes maternas por la enfermedad se limitan exclusivamente a la narrativa del caso y no se hizo referencia a los determinantes por los cuales una mujer embarazada puede morir. Estos resultados fueron presentados a periodistas especializados en género y salud. También forman parte de los contenidos curriculares del seminario para periodistas sobre mortalidad materna a realizarse en octubre de 2010. Conclusión La muerte de una mujer embarazada es una tragedia, una muestra cabal de la desigualdad y una violación a los derechos humanos. Pero aún en una situación de pandemia, la muerte materna es prevenible. Para poder prevenir todas y cada una de las muertes maternas es necesario primero visibilizarlas, para ello el rol de estado, de los profesionales de la salud, de los medios de comunicación y de la sociedad es clave. Cuando existen dificultades o limitaciones que no permiten que estos roles sean cumplidos y los niño/as, adolescentes y mujeres se ven afectados o en situación de riesgo;; por mandato institucional UNICEF debe incidir en todos los planos y niveles necesarios para garantizar que se cumplan los derechos de esta población. La acción de lobby o incidencia en esta experiencia se dio sobre todo a nivel gubernamental y medios de comunicación con resultados directos y visibles en la producción de contenidos, e indirectos y estimados en el control de la pandemia. PREMIOS EIKON 2010 Categoría: Asuntos Públicos / Lobbying Caso: Corporate Affairs Full Project Empresa: Cervecería y Maltería Quilmes Integrantes: Por Cervecería y Maltería Quilmes: Mariano Botas, vicepresidente de Asuntos Corporativos;; Agustina Ochoa, gerente de Asuntos Regulatorios;; Gregorio Lascano, gerente de Relaciones con los Medios Introducción Naturaleza de la Compañía Cervecería y Maltería Quilmes nació el 31 de octubre de 1890, día en que se tiró el primer chopp de cerveza Quilmes. Hoy, 120 años después, es líder de la industria de bebidas en la Argentina. Produce, elabora, distribuye y comercializa cervezas, gaseosas, aguas minerales, jugos e isotónicos, en alianza con empresas internacionales líderes como PepsiCo y Nestlé. Cervecería y Maltería Quilmes tiene una dotación de 4.700 empleados entre su estructura central, sus 10 plantas y sus 8 centros de distribución. Además, cuenta con una red de 200 distribuidores independientes y atiende a más de 200.000 puntos de venta en todo el país. A través de sus marcas, es uno de los mayores anunciantes del país, no sólo en medios masivos sino también en los propios puntos de venta. Inversiones en tecnología de producción superiores a los 420 millones de dólares en el período 2006/2008, exportaciones a 20 países y un Programa de Jóvenes Profesionales al cual se han presentado 105.000 postulantes desde 1991, son ejemplos a través de los cuales Cervecería y Maltería Quilmes sigue demostrando su liderazgo hoy como siempre. Desde su creación, Cervecería y Maltería Quilmes ha construido una trayectoria de compromiso responsable con el desarrollo social y económico de la Argentina. Cervecería y Maltería Quilmes forma parte del grupo Anheuser-­Busch InBev, la compañía cervecera internacional líder y una de las cinco empresas de consumo masivo más grandes del mundo, con sede en Leuven, Bélgica. Anheuser-­Busch InBev cuenta con un portfolio de más de 300 marcas y con operaciones en más de 30 países. Situación por la cual se implementó el plan El Corporate Affairs Full Project (CA Full Project) nace como la respuesta de Cervecería y Maltería Quilmes a la necesidad de involucrar en la agenda de Asuntos Públicos a ejecutivos clave de la compañía alineándolos con los objetivos de la empresa y del negocio. Debido a la complejidad y la envergadura del negocio de Cervecería y Maltería Quilmes se optó por desarrollar un abordaje focalizado en sectores específicos, que diera una respuesta local y rápida en cada zona de interés, en lugar de uno basado en la población general. Para esto fue necesario incluir a los ejecutivos de alto rango de la Compañía en los temas regulatorios, las agendas de los distintos stakeholders y familiarizarlos con las herramientas de la reputación corporativa. (O&$)XOO3URMHFWVHFRQFLELyFRPRXQDPHWRGRORJtD³SUR-­EXVLQHVV´DWUDYpVGHODTXHVHEXVFDSURWHJHU
el negocio y detectar y aprovechar oportunidades. No, como una iniciativa de reacción frente a las distintas amenazas que pudieran surgir. Para embarcarse en este proyecto, Cervecería y Maltería Quilmes aprovechó su trayectoria y experiencia en la práctica de Asuntos Públicos. Incluso distintos ejecutivos ya se habían capacitado sobre los distintos aspectos de esta práctica en workshops, jornadas internas de Relaciones Institucionales y entrenamientos de comunicación en situación de crisis. Hace décadas que la Compañía ocupa un lugar entre las empresas líderes del país y reconoce el valor del área de Asuntos Corporativos en el negocio. El CA Full Project sólo puede ser implementado en compañías donde los ejecutivos entienden que sus responsabilidades no se limitan a vender, producir o crear valor sino a hacer sustentables las ventas, los productos o el valor que generan en el tiempo entendiendo y advirtiendo sobre la evolución del contexto de negocio. Los miembros del CA Full Project deben comprender el negocio en su conjunto y estar habituados a compartir prácticas y trabajar en equipo. Objetivos Objetivo principal Generar una red de agentes de cambio en todo el país comprometida con una metodología de trabajo que colabore a mantener un entorno de negocios positivo para Cervecería y Maltería Quilmes. Objetivos secundarios -­ Imbuir a más de 30 ejecutivos clave de la Compañía en la práctica de los Asuntos Corporativos. -­ Desarrollar líderes locales que puedan interactuar con distintas autoridades y organizaciones en sus áreas de influencia y resolver tempranamente situaciones que puedan afectar el negocio de la Compañía -­ Amplificar el alcance y mejorar el seguimiento de las iniciativas de acciones comunitarias y responsabilidad social de la Compañía -­ Mejorar el sistema de alerta temprana sobre las novedades en los distintos ejes de trabajo que afectan a la Compañía y alimentar el flujo de información con el que cuenta el área de Asuntos Corporativos Estrategia El éxito de los proyectos que involucran profesionales de distintos perfiles y áreas, como en CA Full Project, se sustenta en la construcción de una metodología de trabajo simple y clara que permita comprender los ejes de trabajo y sus beneficios para la gestión diaria del negocio. Audiencias Público objetivo: 32 ejecutivos clave de la Compañía. -­ El presidente y sus reportes directos -­ Los gerentes de planta -­ Los gerentes de Venta y Trademarketing -­ Otros referentes de áreas industriales -­ Otros referentes del área RR.HH. -­ Otros referentes del área de Finanzas -­ Otros referentes del área Logística Público secundario: Grupos de interés ‡ Gobierno ‡ Asociaciones civiles, educativas y organizaciones del tercer sector ‡ Medios de comunicación ‡ Socios de negocio (distribuidores, operadores logísticos y proveedores de insumos primarios, por ejemplo) Canales de comunicación (internos y/o externos) utilizados: -­ Evento de lanzamiento (septiembre 2009) -­ Sistema de reporte trimestral a través de reuniones y conferencias telefónicas -­ CA Full Day: día en que todos los miembros del CA Full Project se reúnen para actualizarse, debatir sobre la situación de cada uno de los ejes y compartir casos -­ Documentos de actualización: entregables preparados por el área de Asuntos Corporativos sobre distintos temas de interés para el grupo A. Ejecución de Plan Descripción de los pasos y procesos Desarrollo previo del CA Full Project: 1) Definición de ejes de trabajo En esta etapa participaron el presidente y la alta dirección, bajo la coordinación el área de Asuntos Corporativos. Se definieron cuáles serían los ejes sobre los que trabajarían los futuros integrantes del CA Full Project. 2) Definición de una metodología de trabajo Para definir la metodología de trabajo sobre la que trabajaría el CA Full Project se tomó como modelo el esquema PDCA (Plan (D), Do (D), Check (C), Act (A), según sus siglas en inglés). El PDCA es un proceso de mejora continua en el que se establecen pasos claros, enfocados hacia la acción y el aprendizaje sobre los resultados. 3) Definición de públicos y sus agendas Una vez definidos los ejes y la metodología del proyecto se analizaron los públicos y stakeholders con los que interactúa la compañía diariamente. Se definió que los miembros del CA Full Project actuarían con gobiernos, asociaciones civiles, medios de comunicación y socios de negocio. Dentro de cada grupo, se seleccionaron los actores más importantes y se definieron planes de acción para generar una relación con cada uno de ellos. 4) Selección de herramientas Para facilitar las tareas de los miembros del CA Full Project se los capacitó sobre distintas técnicas y herramientas de análisis y seguimiento comunes para el área de Asuntos Corporativos. Por ejemplo, matrices de riesgos, cuadros de contacto y mapas de actores, además de sistemas de monitoreo y material de lectura complementario. Los integrantes del CA Full Project recibieron también la autonomía necesaria para implementar los siguientes programas de responsabilidad social e iniciativas comunitarias que financia la Compañía, siempre con la coordinación y los lineamientos definidos por el área de Asuntos Corporativos: Vivamos Responsablemente abarca diversas iniciativas sociales orientadas a promover el consumo y la venta responsables de alcohol a mayores de edad, contribuir a la toma de conciencia sobre la incompatibilidad de combinar las acciones de beber y conducir, y la promoción de valores saludables. El programa está basado en los pilares de Educación y Consumo Responsable que se implementan a través de: ‡ Ciclo de charlas para adolescentes ‡ Ciclo de charlas para padres de hijos adolescentes ‡ &DPSDxD³ 9HQWD5HVSRQVDEOH´ ‡ Programa Conductor Responsable ‡ Distribución gratuita de diversas publicaciones sobre la cuestión adolescente ‡ Donación de alcoholímetros a gobiernos y autoridades de tránsito y seguridad vial Futuro Posible tiene como objetivo apoyar proyectos en las áreas de influencia de nuestras cervecerías. Agrupa actividades comprometidas con proyectos de salud y educación destinadas a niños y jóvenes, y se articula con organizaciones sociales, públicas y privadas de la salud y la educación orientadas a la niñez, desde la concepción hasta la juventud. ‡ Programa de Huertas Escolares ‡ Programa de Becas Escolares ‡ Programa de reciclado de envases de PET Lanzamiento y ejecución del CA Full Project Una vez lanzado el CA Full Project se especificaron las tareas y los flujos de ejecución: 1) Tareas de los integrantes del CA Full Project: -­ Monitoreos sistemáticos en su área de competencia -­ Actualización de las matrices de riesgo y mapas de actores -­ Ejecución del plan de contactos con los actores relevados para cada caso -­ Gestionar el flujo de información con el equipo de Asuntos Corporativos 2) Flujo de ejecución del CA Full Project En situación normal: -­ Reunión o conferencia telefónica trimestral de avance con el área de Asuntos Corporativos para analizar el plan de contactos, las novedades y relevar las prioridades de cada área georgráfica. -­ CA Full Week es una semana en el año que el integrante del proyecto dedica a relacionarse con su plan de contactos. Cada uno la determina según su agenda y la disponibilidad de quienes integran su plan de contactos. En caso de surgir una novedad relevante: En caso de detectar alguna novedad con impacto potencial en los ejes definidos en la metodología, los integrantes de CA Full Project deben aplicar el siguiente modelo de gestión: INPUTS OUTPUTS Ajustes que se introdujeron durante su implementación: Un punto importante para la implementación del CA Full Project fue definir que la participación del proyecto estaba definida por el cargo y la función de cada ejecutivo, no por sus capacidades de LQWHUUHODFLyQ SHUVRQDO R VX ³DJHQGD GH FRQWDFWRV´ SUHYLD *UDFLDV D HVWD GHILQLFLyQ ORV FDPELRV HQ OD
organización no han repercutido en el espíritu del CA Full Project. Por el contrario, en muchos casos resultó una motivación para el que tomó una posición nueva comprender que su nuevo rol estaba inscripto dentro de CA Full Project. Dificultades encontradas y solución: Como en todo nuevo proceso, durante los primeros meses, se detectaron demoras en el seguimiento y algunas dificultades para que los integrantes compartan información. Para solucionarlo se diseñó un sitio web interno de acceso restringido en el que, a través de una interfaz similar a la de una red social, los integrantes pueden conocer las novedades del proyecto, compartir mejores prácticas y actualizar matrices de riesgo y mapas de actores. B. Evaluación y Cierre En su primer un año, el CA Full Project demostró resultados sumamente positivos: 1. Se desarrolló una gimnasia de alerta, seguimiento y análisis consistente entre áreas y en todo el país 2. Los programas de RSE se convirtieron en herramientas de los integrantes del proyecto en sus gestiones como parte del CA Full Project 3. Se incorporaron competencias de Asuntos Corporativos en las descripciones de las posiciones que fueron involucradas en el proyecto 4. &$ )XOO 3URMHFW IXH GHFODUDGR ³0HMRU 3UiFWLFD´ GH $VXQWRV &RUSRUDWLYRV GH $%,Q%HY \ ya está siendo implementada en otras operaciones de la Compañía en Europa y Asia, por ejemplo PREMIOS EIKON 2010 Categoría: Asuntos Públicos y Lobbying Caso: Conocer para actuar. Concientizando sobre los derechos de los pacientes con cáncer de mamas. Empresa: Roche Agencia de PR: Llorente & Cuenca Integrantes: Por Roche: Alejandra Loureiro, Jessica Claros;; Sandra Pecollo, Valeria Cáceres, Javier Brunero Introducción Roche es una compañía internacional líder en el sector de la salud que trabaja para transformar positivamente la vida de los pacientes. Para lograrlo, desarrolla productos y servicios que detectan, previenen, diagnostican y tratan enfermedades como el cáncer, la diabetes, la hepatitis, el HIV, el mal de Alzheimer y otros trastornos que plantean necesidades médicas no resueltas. Emplea a más de 80.000 personas en 150 países y tiene sede central en Basilea (Suiza). Mantiene acuerdos de cooperación con diferentes socios en investigación y desarrollo, área en la cual invierte el 20 por ciento del volumen total de sus ventas. En la Argentina, donde brinda trabajo a más de 450 personas, cumple en 2010 sus 80 años. Detrás de la campaña Referente en oncología Una de las líneas de trabajo de la División Farma de Roche es la de investigar y desarrollar medicamentos oncológicos cada vez más innovadores, seguros y efectivos. Fármacos orientados con mayor precisión a las necesidades médicas de cada grupo de pacientes que contribuyen a mejorar su calidad de vida y sobrevida. En línea con este compromiso, que lo ha convertido en referente mundial en Oncología, Roche Argentina organiza anualmente, desde hace varios años, campañas de concientización, prevención y detección de cáncer de mama. Campañas dirigidas a la comunidad en general y también a las organizaciones sociales que agrupan pacientes, y que han permitido incrementar el conocimiento público sobre el tema. Sin embargo, Roche descubrió que la concientización a favor de un mayor control encuentra su límite si, posteriormente, la falta de un diagnóstico preciso sobre el tipo de cáncer que sufre la paciente impide llegar al tratamiento más adecuado. Un derecho que todas las mujeres tienen pero que no todas conocen. Roche se propuso cambiar esa realidad, dando una vuelta de tuerca al trabajo de awareness que lleva adelante a través de una acción de incidencia en la esfera pública: de allí nació Conocer para actuar. Detrás de la campaña Asegurar los derechos de los pacientes Anualmente, se diagnostican un millón de casos de cáncer de mama en todo el mundo. Se trata de la segunda causa de muerte por cáncer entre las mujeres y, según se estima, en los países desarrollados afecta a una de cada ocho mujeres a lo largo de su vida. Además, aproximadamente el 25% de ellas expresa una proteína llamada Her2, que indica la presencia de un tumor más agresivo, de crecimiento más rápido y que no responde a las terapias convencionales. Aunque hasta no hace mucho tiempo la tasa de mortalidad del cáncer de mama Her2 positivo era muy elevada, se han descubierto terapias blanco-­dirigidas que permiten combatirlo con mayor eficacia, siempre que se llegue a una detección temprana. Para eso, el testeo Her2 es esencial. Se trata de un procedimiento sencillo que, sin embargo, no está incluido en el PMO (Plan Médico Obligatorio) que establece la Superintendencia de Servicios de Salud de la Nación Argentina. Y sin el cual, en opinión de los profesionales, no debería tomarse ninguna decisión de tratamiento. Detrás de la campaña Asegurar los derechos de los pacientes (cont.) Para poner el testeo al alcance de un sector más amplio de la población, Roche apoya desde 2006 la iniciativa Plan Nacional de Diagnóstico de HER2 (http://www.her2.com.ar/default_ES.htm), un servicio a la comunidad que consiste en ofrecer a las pacientes sin recursos económicos la posibilidad de realizarse, en forma gratuita, el testeo Her2. Para brindar cobertura nacional, el plan abrió 16 centros de testeo, ubicados en zonas estratégicas del país (Córdoba, Tucumán, Mendoza, Mar del Plata, Ciudad de Bs. As. y GBA). En cada uno de ellos se efectúan controles de calidad y se entrena permanentemente a los profesionales. Pese a los buenos resultados alcanzados, el plan no alcanza a cubrir todas las localidades del país ni a poner el testeo a disposición de todas las pacientes. Roche lo sabe y por eso decidió dar un paso más. Para aumentar el conocimiento sobre el cáncer de mama y la importancia de detectarlo lo antes posible. Para que las pacientes que son HER2 positivo lleguen a un diagnóstico preciso a tiempo. Para que se cumpla el derecho de todos a un tratamiento adecuado. Por estos motivos, Roche decidió trabajar en una campaña de concientización que propicie un cambio de conducta e instale tanto el hábito de los controles regulares para prevenir el cáncer de mamas como el testeo HER2 entre los estudios de rutina contemplados por el PMO. Detrás de la campaña Mejorar el acceso: conocer para actuar Esta campaña de concientización apuntó a mejorar el acceso de los pacientes con cáncer de mama al testeo HER2 para un diagnóstico y tratamiento adecuados, comenzando en la ciudad de Buenos Aires, donde miles de mujeres se atienden en el sistema de salud a diario. Para lograrlo, Roche trabajó junto a Sostén, una ONG reconocida por su dedicación a luchar por los derechos de los pacientes para: ‡ Crear espacios de discusión en los medios de comunicación sobre el diagnóstico temprano de las pacientes de cáncer de mamas y sus derechos, brindando información de valor agregado. ‡ Lograr la discusión y aprobación de este tema clave en la Legislatura del Gobierno de la Ciudad de Buenos Aires, para lograr la inclusión del testeo HER2 como un examen de rutina luego de la detección del cáncer de mamas en los hospitales porteños. La campaña, además, tuvo como foco estratégico reforzar las relaciones con las ONG de cáncer apoyando sus iniciativas para fortalecerlas y para llegar a través de ellas a la comunidad de pacientes y a la opinión pública en general. Detrás de la campaña ¿Para quiénes, cómo y qué? Público, estrategia y mensajes La estrategia de comunicación desarrollada para la campaña de concientización consistió en ‡ llegar a la comunidad a través de las ONG y los medios de comunicación con un mensaje claro, que permitiera dar a conocer los derechos de los pacientes de cáncer de mama, remarcando las posibilidades de diagnóstico y tratamiento adecuados;; ‡ lograr que el debate no sólo concientizara sino, aún más, condujera a una acción concreta como es reclamar por los derechos;; ‡ lograr la inclusión del testeo HER2 en el sistema de salud de la Ciudad de Buenos Aires, con el objetivo a largo plazo de obtener la inclusión en el PMO de la Nación;; ‡ comunicar el liderazgo de Roche en el tratamiento contra el cáncer de mama, principalmente a través de su biofármaco para tratar el subtipo Her2+. La campaña estuvo dirigida a: ‡ ONG dedicadas a la temática ‡ Pacientes y familias ‡ Comunidad en general ‡ Medios de comunicación ‡ Autoridades de la Legislatura de la Ciudad de Buenos Aires Detrás de la campaña Principales desafíos Por el desconocimiento sobre la temática (tanto de los derechos de pacientes como del testeo Her2), el proceso de concientización que Roche se propuso lograr junto a las ONG enfrentó retos ambiciosos: ‡ Crear mensajes adecuados para una diversidad de públicos con distintas necesidades de información: ONG, pacientes, periodistas, público en general. En el caso de los pacientes y las ONG que los contienen, haciendo foco tanto en los derechos como en la importancia de un testeo de subtipo genético de cáncer. En el caso de los medios, producir contenidos de peso para ser prensados. ‡ Posicionar un tema desconocido ±y con un alto componente técnico, como es el que se vincula a los subtipos de cáncer y los testeos que se ha desarrollado en los últimos años para detectarlos² en la agenda mediática. Si bien ha crecido, campaña tras campaña, el conocimiento público sobre el cáncer de mama y sobre la importancia de prevenirlo y detectarlo tempranamente, los avances científicos en torno a los subtipos genéticos son en gran medida desconocidos. ‡ Motivar a la comunidad en general, los pacientes y sus familiares a reclamar sus derechos. Es decir, ir un paso más allá de la información para lograr, con ella, la acción. ‡ Influenciar la agenda de la Legislatura de la Ciudad de Buenos Aires para la incorporación del testeo HER2 como estudio de rutina en todos los hospitales porteños. Detalle de acciones Conocer para actuar ¿Cómo crear una campaña novedosa, que atrajera la atención pública sobre un tema desconocido? ¿Cómo motivar a las mujeres a tomar genuina conciencia sobre sus derechos como pacientes? ¿Cómo incidir en la agenda pública? ¿Con quién sumar fuerzas? Roche eligió a Sostén, una reconocida asociación que lucha por la defensa de los derechos de pacientes con cáncer, para desarrollar en conjunto una campaña de concientización con el objetivo de movilizar a la comunidad a demandar a las autoridades de salud la cobertura del testeo HER2. Eventos abiertos y gratuitos, entrega de folletos en la calle, lanzamiento de globos, reuniones con ONG, una acción de lobby para mostrar a los legisladores porteños la importancia de la inclusión del testeo en el PMO y una campaña de medios fueron algunas de las actividades desarrolladas. Cada uno de estos eventos fue pensado y diseñado en función de un público diferente e incluyó materiales de comunicación propios y especialmente creados. Además, de apoyar las actividades de Sostén durante el mes de concientización, Roche preparó, además, una Guía para Pacientes con Cáncer de Mama que entregó a la ONG, y los asesores médicos de la compañía (oncólogos y patólogos ) escribieron un informe para presentar a las autoridades de salud. Detalle de acciones Un puente hacia la mujer La corta trayectoria y el bajo nivel de exposición que tiene el tema obligaron a incluir, entre las acciones de la campaña, una que le diera mayor visibilidad. Y que lo hiciera a través de una convocatoria de alto impacto, que combinara la seriedad que merece esta patología junto con el mensaje esperanzador que promueve Roche. $Vt VXUJLy ³(O SXHQWH GH OD PXMHU´ XQ FRQMXQWR GH DFWLYLGDGHV DELHUWDV \ JUDWXLWDV SDUD OD FRPXQLGDG
pacientes y sus familiares desarrolladas al aire libre en Puerto Madero. En estas actividades, que se extendieron durante octubre de 2009, miles de personas disfrutaron de música y arte. También hubo una entrega de premios al esfuerzo de quienes apoyaron a la ONG Sostén y una suelta de globos rosas, como mensaje positivo en la lucha contra la enfermedad. Además, y para celebrar el mes del Cáncer de mama, voluntarios de Sostén entregaron folletos informativos acompañados por flores a la masa de personas que transitan por la calle Florida, en Buenos Aires, durante cinco días de octubre. Detalle de acciones Juntos es más fácil Las asociaciones de pacientes son un aliado importante para Roche a la hora de brindar información de valor a la comunidad. Cumplen el rol de multiplicadoras de un mensaje claro y preciso, que permite combatir mitos y luchar contra la desinformación, y llevan adelante sus propias acciones de incidencia pública. Por eso, Conocer para actuar incluyó reuniones con 22 personas de distintos grupos de pacientes de cáncer de la Argentina. Representantes de ACIAPO, LALCEC, Apostar a la Vida, Ascenso por la Vida, Sostén, MACMA y FOE asistieron a talleres organizados por Roche en sus oficinas. El objetivo principal fue apoyar su trabajo por los derechos de los pacientes, capacitándolos en la temática. Los talleres brindaron herramientas para afirmar el liderazgo de las ONG y su labor de concientización, información y servicios disponibles para pacientes de cáncer de mamas. Algunos de los temas explorados fueron el sistema legal argentino de salud, los derechos de pacientes de cáncer, el sistema nacional de HER2 que provee Roche, su porfolio de cáncer de mama, las páginas de Internet y el centro de atención de la compañía. Detalle de acciones Una guía hacia la salud El diagnóstico de cáncer de mama puede ser una de las situaciones más difíciles de afrontar en la vida de una mujer. Miedo, falta de información y soledad son algunas de las sensaciones que predominan en ese momento. Para acompañar a las pacientes a atravesarlo y en línea con otro de los objetivos específicos de la campaña (resaltar la importancia del acceso oportuno al tratamiento con un mensaje esperanzador) 5RFKH HGLWy ³&iQFHU GH PDPD ¢DKRUD TXp"´ XQD JXtD TXH FRQWLHQH LQIRUPDFLyQ VREUH HO GLDJQyVWLFR
tratamiento y recuperación de esta enfermedad. No existen muchos materiales de divulgación sobre el cáncer de mama. Si bien ha crecido su difusión, el WHPD HV FRPSOHMR \ VLJXH JHQHUDQGR WHPRUHV TXH UHWUDVDQ XQ UiSLGR GLDJQyVWLFR 3RU HVR ³&iQFHU GH
PDPD ¢DKRUD TXp"´ H[SOLFD SDVR D SDVR \ GH XQD PDQHUD DPLJDEOH OR TXH XQD PXMHU GHEH HVSHUDU
durante el tratamiento. A lo largo de sus 106 páginas ofrece preguntas útiles para discutir con el médico y consejos para tener en cuenta en el abordaje personal de la enfermedad. Algunas de sus 10 secciones incluyen: biología de los tumores, tratamientos disponibles, ensayos clínicos y recuperación. Roche editó la guía con el respaldo de la Liga Argentina de Lucha contra el Cáncer (LALCEC) y auspiciada por la Asociación Argentina de Oncología Clínica, y la distribuyó a nivel nacional, además de publicar una versión online para que sea consultada por Internet. Detalle de acciones La importancia de una opinión formada Paralelamente, se desarrolló un plan de prensa con el objetivo de difundir estas acciones pero fundamentalmente para crear conciencia a través de los medios de comunicación, contribuir a la acción de lobby legislativo e incidir en un cambio de conducta social. La campaña de medios (gráficos, radiales, online y televisivos) hizo foco en la importancia de la prevención del cáncer de mamas y en el derecho de los pacientes a un diagnóstico y detección adecuados. Así, en tan solo 7 días (del 30-­09 al 6-­10), alcanzó al 46 por ciento de la población de Capital Federal y Gran Buenos Aires con 21 menciones en prensa. De este total, un 30 por ciento correspondió a artículos publicados en diarios, un 10 por ciento en revistas y un 17 por ciento en radio, televisión y medios online nacionales, incluidos Diario Clarín (sección Sociedad y suplemento Mujer), La Nación online, La Razón, BAE, Hoy (La Plata), Agencia Télam, Radio Continental (programa Bravo Continental), Radio El Mundo (programa Crecer con la vida), Crónica TV y diversos programas gráficos, electrónicos y radiales especializados, como Consultor de Salud y Buena Praxis. Detalle de acciones La importancia de una opinión formada (cont.) Estas menciones de prensa contaron con una voz autorizada que les dio jerarquía. El Dr. Reinaldo Chacón, Director Médico del Instituto Alexander Fleming y referente de amplia trayectoria y reputación en la temática, reportó los beneficios que Herceptin ±una droga desarrollada por Roche para tratar el cáncer de mama HER2 positivo, cuyo principio activo es el trastuzumab² trajo al tratamiento del cáncer de mama. Algunos extractos claves del mensaje del Dr. Chacón: ‡ ³(OSRUFLHQWRGHODVPXMHUHVFRQFiQFHUGHPDPDVVREUHH[SUHVDQXQJHQOODPDGR+HU(QORV
90, los antibióticos monoclonales (trastuzumab y lapitinab) comenzaron a ser utilizados contra este tumor, y combinados con quimioterapia y cirugía, alcanzDURQUHVXOWDGRVLQFUHtEOHV´ ‡ ³&XDQGR VH KDEOD GH FiQFHU GH PDPDV HV LPSRUWDQWH GLIHUHQFLDU HQWUH SUHYHQFLyQ \ GHWHFFLyQ
temprana. Prevención se trata de evitar causas que generan el desarrollo de la enfermedad, como fumar y la exposición al sol. La detección temprana es para diagnosticar la enfermedad tan pronto como sea SRVLEOHSDUDPHMRUDUODVRSRUWXQLGDGHVGHFXUD´ ‡ ³+DFHDxRVHOODQ]DPLHQWRGHWUDWDPLHQWRVPRQRFORQDOHVFRPRHOWUDVWX]XPDESURGXMHURQXQ
hito en la lucha contra el cáncer. Estos tratamientos biológicos fueron revolucionarios, terapias específicas TXHDOFDQ]DURQQLYHOHVDOWRVGHUHPLVLyQ´ Principales resultados Actuar para el cambio: derechos asegurados La campaña de concientización tuvo excelentes resultados cuantitativos y cualitativos. A través de ella, Roche Argentina logró sus objetivos: ‡ Fortaleció su relación con las ONG líderes en cáncer, en un marco de respeto y transparencia, brindándoles información valiosa para su labor cotidiana. Capacitó a 22 representantes de ONG con información de valor agregado y herramientas para generar concientización en la comunidad sobre la importancia de expandir los derechos de los pacientes con cáncer de mamas. ‡ Logró un exitoso llamado a la acción para apoyar el tema. Difundió los derechos de los pacientes posicionando en la agenda mediática un tema desconocido para la opinión pública, como es el testeo HER2, a través de acciones que convocaron a miles de personas y de una campaña de prensa que llegó al 46% de la población objetiva. ‡ Cumplió con su meta inicial a nivel incidencia pública. Gracias al trabajo conjunto entre Roche y Sostén en la campaña, la legislatura de la Ciudad de Buenos Aires emitió un documento (2129-­D-­09) declarando su adhesión a incorporar el testeo HER2 dentro de los servicios de rutina de los hospitales de Buenos Aires. Un legislador del partido del actual gobierno envió un proyecto de ley al Congreso Nacional Argentino para incluir el testeo HER2 en el PMO (Plan Médico Obligatorio). Si la ley es sancionada, todos los pacientes que no recibieron el testeo HER2 podrán beneficiarse de la medida legal. Principales resultados La campaña, en números Conocer para actuar contribuyó a posicionar un mensaje a favor de la provisión obligatoria del testeo HER2 para quienes luchan contra el cáncer de mama, desde una perspectiva positiva y de acción colectiva por el bien común. Logró llegar a pacientes, familiares y comunidad toda a través de: ‡ 21 menciones en prensa gráfica, radial y electrónica de alcance nacional en sólo 7 días, lo que permitió alcanzar al 46% de la población de Capital y GBA. ‡ Eventos al aire libre y una acción en vía pública (en la calle Florida) que alcanzaron a 15.000 personas. ‡ Talleres de capacitación de los cuales participaron 22 representantes de ONG, que luego multiplicaron este conocimiento sobre los derechos de los pacientes entre los destinatarios de cada una de las organizaciones. ‡ 1 adhesión de la legislatura de la Ciudad de Buenos Aires (2129-­D-­09) para incorporar el testeo HER2 dentro de los servicios de rutina de los hospitales de Buenos Aires. ‡ 1 proyecto de ley enviado al Congreso Nacional Argentino para incluir el testeo HER2 en el PMO (Plan Médico Obligatorio). Incluida la acción en vía pública, se estima un total de 10 millones de personas alcanzadas con este mensaje. Los derechos de los pacientes deben ser honrados. Es la única manera de asegurar un diagnóstico y tratamiento adecuados, capaces de salvar vidas, a todas las personas. Por eso Roche trabajó para generar concientización en los actores involucrados: pacientes, familiares, ONG, medios de comunicación, legisladores y la población en general. Conocer llevó a la acción y la acción, al cambio: el derecho al testeo HER2 en la Ciudad de Buenos Aires fue asegurado. Este fue el primer paso para generar acceso a nivel nacional a través del PMO. PREMIOS EIKON 2010 Categoría: Relaciones con la Prensa Caso: Posicionamiento del Bioparque Empresa: Fundación Temaikèn Integrantes: Por Temaikèn: Denise Berger, Jefe de RR.II y Comunicación y Agustín Allocco, Analista de Prensa y Marketing Introducción: Un poco de historia Temaikèn, nace de la unión de dos vocablos tehuelches, TEM (tierra) y AIKEN (vida), y evoca el respeto por la naturaleza. Se encuentra ubicado en Escobar, a 50 km de la Ciudad de Buenos Aires y fue inaugurado en Julio de 2002. Los más de 50 ambientes y 5500 animales, deben transmitir el concepto amplio de biodiversidad, de manera que las especies vegetales también sean las adecuadas para representar el contexto en el que habita el animal;; y el visitante sienta una contención visual, basada en la separación por barreras naturales y no artificiales como por ejemplo rejas. Temaikèn tiene como visión constituirse en una institución reconocida y ampliamente respetada a nivel mundial, a través de la preservación, conservación y divulgación de la flora y fauna, priorizando la autóctona y utilizando la educación, la investigación y la recreación como medios para lograr dicho objetivo. Hoy, trabaja en especies amenazadas en diferentes puntos del país como Tapires, Mariposas Autóctonas, Aguará Guazú, Ecosistema del Pino Paraná y Loro Vinoso. El problema: mucho más que un zoológico Temaikèn se inauguró hace 8 años con el objetivo de convertirse en un lugar dedicado al cuidado del medio ambiente a través de la educación y la recreación, y se autodefinía como un parque de animales silvestres. 6LQ HPEDUJR ODV LQYHVWLJDFLRQHV VREUH ³/D ([SHULHQFLD GHO 9LVLWDQWH´ DUURMDEDQ TXH HO S~EOLFR QR WHQtD
claro qué era Temaikèn, aunque mostraban resultados muy positivos en lo que cuidado del medio ambiente y conservación referían. El principal problema radicaba en que el público no veía a Temaikèn como un zoológico ni como un parque temático, sino como una mezcla de ambas. Lo mismo pasaba con los periodistas y líderes de opinión. Había que encontrar un concepto propio que lo definiera como marca, que fuera único e inigualable y que lo diferenciase de los zoológicos, porque ofrece una experiencia más profunda, que lo posicionara como algo diferente a todos los planes y salidas focalizado en la educación, la recreación y la conservación. En la encuesta, se revelaba la diferencia que veía el público entre un Zoo tradicional y Temaikèn. Ambos son lugares para ver animales, pero el Bioparque ofrece mucho más y son propuestas absolutamente distintas. ZOO TEMAIKÈN Urbano Agreste Cercano / céntrico (decenas de colectivos y dos líneas de subte pasan por la puerta) Lejano (solo llega la línea 60 de colectivos y la mayoría de la gente accede en auto Priorizan que los animales estén cerca de la gente Priorizan que los animales estén en su entorno Foco en los animales Foco en la relación entre la naturaleza y el ser humano Y ahora el Bioparque Había algo clave en la esencia de Temaikèn, y era el momento para adueñase del concepto: Temaikèn es un Bioparque y no lo estábamos comunicando. El concepto de Bioparque significa que es: una institución que combina los objetivos de Jardines Botánicos, Zoológicos, Acuarios, Museos de Historia Natural y Antropología, brindando una nueva experiencia de aprendizaje sobre la naturaleza y cómo jugar un papel importante en el presente y futuro del medio ambiente. El concepto era inexistente en Sudamérica, pero sí en países desarrollados de Europa. Este nuevo concepto aportaba atributos a la marca que reflejan los objetivos de Temaikèn y servía de factor diferenciador de la competencia. Por qué hablar de Bioparque? Por que era el momento perfecto. Estábamos frente a un contexto en el cual la conciencia ecológica y la preocupación por el cuidado del medio ambiente es uno de los principales temas del cual habla la gente. Invade los titulares de los medios más importantes del mundo y de Argentina, empresas y políticos lo incluyen en sus agendas y es eje central en el diseño de los programas curriculares de los colegios. A quiénes Para posicionar el concepto, se desarrolló una estrategia integral de comunicación cuyo foco era el Bioparque. Desde el área de prensa se acompañó con un plan a largo plazo, pero que debía obtener resultados concretos a corto plazo. Así, desde Prensa&RRII, la estrategia consistió en generar contenidos apuntados a: ‡ Medios de comunicación y prensa: general, especializada (mascotas, interés general y RSE), medios del interior, regionales, zonales y medios digitales ‡ Líderes de opinión ‡ Otras Fundaciones y ONGs afines ‡ Autoridades: locales y del sector ‡ Público general El paraguas de la estrategia fue la educación y la conservación, mientras que el camino fue la construcción de un concepto específico: ³FRPXQLFDFLyQTXHHQVHxD´ Objetivos Uno de los primeros objetivos fue la generación de contenidos de temas ambientales, animales y de cuidado del medioambiente garantizando el flujo permanente y dinámico de la información ubicando a Temaikèn como fuente de información, no sólo de animales, sino de todo aquello que se refiriera al medioambiente como problemáticas ambientales, contaminación, flora, etc. Con los medios, se apuntó a construir relaciones sólidas y sostenidas en el tiempo, implementando acciones de relacionamiento y fidelización con los productores periodísticos, los editores, redactores y líderes de opinión de temas ambientales y animales. En los mensajes, se difundieron todas actividades que funcionaron como posicionadoras en lo que a las tareas de conservación respecta;; como tareas de rehabilitación y acciones ambientales. Todos los contenidos, tenían la premisa de reflejar a Temaikèn como un Bioparque, término desconocido en el país y del cual la organización debía adueñarse. Estrategia Se generó un kit de prensa con toda la información necesaria para el armado de notas: dossier, fotos, videos y referencias internacionales. Se definieron los voceros de acuerdo a la temática particular y se implementó su entrenamiento diferenciado en base a la temática, como así también al target, para DSXQWDUDSRVLFLRQDUVHFRPR³IXHQWHGHLQIRUPDFLyQ´HQWHPDVGHPHGLRDPELHQWH Qué decir Los contenidos jugaron un rol muy importante, ya que el objetivo era convertir a Temaikèn en un generador de sucesos noticiables, adaptados a los diferentes segmentos y diferenciarse de la comunicación de otros zoológicos del país. Los temas se estructuraron a lo largo del año para aprovechar los períodos estacionales, los fines de semana largo y las fechas especiales. ‡ Institucionales ‡ Vacaciones ‡ Fechas Especiales ‡ Turismo ‡ Conservación ‡ Educación ‡ Investigación -­ Rehabilitación ‡ Animales ‡ Medio Ambiente ‡ Infantiles. Los medios Para poder llegar a cada uno de los medios, se gestionó un plan específico: Con los medios locales (Escobar, Pilar y alrededores) se generaron acciones de relacionamiento con los titulares de cada uno, invitando a descubrir el detrás de escena del Bioparque junto a su familia, además que se puso a disposición premios con los que realizaron juegos, concursos y sorteos con sus lectores, oyentes y televidentes. Con relación a los medios digitales, se aprovechó su versatilidad y velocidad para la difusión de contenidos de último momento, fotos y videos;; además que al estar linkeados a las redes sociales, el poder de viralización de los sucesos noticiables tomó una importancia relevante. Se desarrollaron kits de prensa online con entrevistas digitales pregrabadas, un canal en Youtube con videos de las diferentes acciones que se iban realizando y una oficina virtual de prensa con material para descargar. Todo esto en conjunto con el àrea de marketing. Con el incremento de repercusiones en los medios online, empezaron a surgir notas en blogs, fotos de los visitantes, comentarios y discusiones, foros y respuestas de videos. Esto requirió un grupo de acciones de relacionamiento con bloggers, y respuestas a todos los contenidos que empezó a generar nuestro público. Medios gráficos: se contactaron a medios de divulgación científica y medioambiente y se los invitó a conocer los proyectos de conservación de Temaikèn, el Centro de Reproducción de Especies y se generaron viajes a la zona de trabajo de los biólogos para conocer los programas de conservación, sobre todo a la reserva de Temaikèn en Misiones. Para apropiarse del espacio de fuente de información ambiental, se hizo hincapié en las incautaciones provenientes del tráfico ilegal, las rehabilitaciones de animales y las posteriores liberaciones en el ambiente natural, que tomaban trascendencia nacional e internacional. Los medios infantiles fueron estratégicos, ya que además de ser cercanos al público, servían como fuente de información para los docentes y alumnos. Se difundieron contenidos de animales, medioambiente, reciclado y acciones que podían ser llevadas a cabo por los chicos, tanto desde su hogar como también desde el ámbito de la escuela. Los chicos consumen ecología, animales y divulgación a través de programas infantiles ubicados en toda la grilla. Se generaron este tipo de contenidos, y se los ofrecieron a los diferentes programas como ser Zapping Zone de Disney Channel. Los departamentos comerciales de las radios filtraban el contenido, por lo que se empezaron a habilitar entradas para sorteos y concursos, siempre con consignas vinculados a temas de conservación. Luego se generaron reuniones con productores y se empezaron a coordinar notas de datos curiosos. Por ejemplo, cómo reaccionan los animales ante fenómenos naturales (tsunamis y terremotos), porqué los tiburones atacan a los humanos, entre otros. Para televisión, se buscaron notas en programas de cable de interés general, medio ambiente, infantiles y por último, en los noticieros nacionales. Los programas de interés general centraron las notas en temas turísticos, como la apertura de nuevos recintos, posicionando a Temaikèn como una escapada a pocos minutos de la Ciudad. Se gestionó la presencia de móviles en vivo, y en el caso de que no coincidieran con el horario de emisión, VHJHVWLRQDEDQORV³YLYRV´\VHHQYLDEDQDOFDQDOSDUDTXHORSXGLHUDQVDFDUGHDFXHUGRDODVQHFHVLGDGHV Se difundieron los programas de conservación y educación que se llevan adelante por la Fundación, como así también liberaciones de especies, rehabilitaciones de animales e incautaciones provenientes del tráfico ilegal en los programas de contenidos de medio ambiente como Recurso Natural, Científicos Industria Argentina y TN Ecología. Además, para lograr ser fuente de información se comenzaron a enviar gacetillas con contenidos diferentes a los que se esperaban recibir. Por ejemplo, durante un período de invasión de murciélagos a la Ciudad de Buenos Aires, se enviaron contenidos con información sobre las especies de murciélagos, porqué se acercaban y qué medidas podían ser tomadas. Esto repercutió por ejemplo en una nota con el Jefe de Veterinarios en el piso del noticiero de Telefè. Los conductores de noticieros se referían a Temaikèn como un zoológico ubicado en la zona norte, un parque temático de Escobar y no había conocimiento exacto de las tareas que se realizaban. A modo de HMHPSOR -RUJH -DFREVRQ GH 7HOHIq 1RWLFLDV VH UHIHUtD DO %LRSDUTXH FRPR ³7DPDLNHQ´ &DQDO \ 71 QR
hacían notas;; Canal 9 y América 2 no asistían en forma asidua a las actividades y novedades que se los comunicaba. Para revertir esta situación, se estableció como objetivo el relacionamiento y la fidelización de los conductores y productores periodísticos de los noticieros, por medio de almuerzos y cenas, regalos con motivos del día del periodista, etc, El interior Una de las principales tácticas consistió en invitar en dos etapas a los periodistas más importantes y referentes de cada plaza. Ellos viajaron y se los invitó a un recorrido por todo el detrás de escena de Temaikèn. Por otra parte, También también viajó a las plazas donde tiene mayor presencia, consecuencia de los proyectos de conservación que lleva adelante (loro vinoso, ecosistema del pino Paraná y mariposas autóctonas en Misiones). Entonces, se realizaron reuniones con los medios locales, y se los invitó a los lugares donde se desarrollaban las acciones para que pudieran conocerlos y en consecuencia difundirlos. La ventaja diferencial estaba en que no se enviaban gacetillas con datos, sino que se los invitaba a vivir la experiencia Esto se replicó en las provincias de Mendoza, con las liberaciones de cóndores, en la provincia de Córdoba con el Aguará Guazú y en la provincia de Formosa y Chaco con el proyecto de conservación del Tapir. Relacionamiento y Fidelización Todas las acciones con los medios pudieron ser llevadas adelante apoyadas con un programa de relacionamiento y fidelización a mediano y largo plazo. Incluía eventos especiales de presentación de novedades, salutaciones de cumpleaños, regalos y saludos de nacimientos, regalos institucionales, día del periodista, almuerzos y cenas. El saludo no buscaba ser sólo un saludo, sino que sumaba un contenido ambiental o de conocimiento como todas las acciones comunicacionales. Por ejemplo, para el día del periodista se enviaban pequeñas plantas aromáticas con su descripción y una explicación que las mismas sirven de reemplazo a los insecticidas. Así, nos diferenciábamos de ser sólo un lugar de animales. Para los cumpleaños se enviaban tarjetas de saludo, invitando a pasar el día junto a su familia disfrutando del contacto con la naturaleza. Se definió también que como cierre del año se coordinarían almuerzos, desayunos o cenas con los periodistas y medios que mejor relación se generó. La consigna no era una nota o entrevista, sino un encuentro para agradecer el apoyo de todo el año. Resultados Durante el ejercicio 2009-­10 se generaron 1355 repercusiones en los medios, lo que representó un promedio de 3.71 notas por día durante los 365 días del año y en consecuencia un incremento de casi un 17% con relación al mismo período del año anterior. El tema de mayor relevancia fue la apertura de El Lugar de las Aves con 379 repercusiones, concentradas principalmente en vacaciones con mantenimiento de la noticia en los meses posteriores. Según la encuesta de visitantes realizada durante el primer trimestre del año 2009, el 73% de los visitantes de Temaikèn lo identifican como Bioparque. Los medios periodísticos comenzaron a referirse a Temaikèn como un Bioparque, y en muchas oportunidades cuando no podían mencionar a Temaikèn por un tema comercial, dejaron de referirse como ³HO]RROyJLFRGH(VFREDU´DFDPELRGHO%LRSDUTXHGH]RQDQRUWH Esta afirmación muestra, como a lo largo del tiempo y gracias a una estrategia integral entre todas los sectores de la organización, se logró posicionar el concepto de Bioparque. En el cuadro se visualiza el incremento de repercusiones de los últimos períodos, lo que ejemplifica de manera clara los resultados obtenidos desde la implementación de la estrategia de prensa con una táctica para cada tipo de medio y cada target específico. Con el fin de dar mayor detalle al estudio de los resultados, se adjuntan como Anexos al presente dos informes: el primero correspondiente a las repercusiones resultantes del período 2008-­ 2009 y el segundo con las obtenidas entre el 2009-­2010. PREMIOS EIKON 2010 Categoría: Relaciones con la Prensa Caso: Programa Ejecutivo PwC para Periodistas (PePP) Empresa: PricewaterhouseCoopers (PwC) Agencia de PR: RFB Lynch Partners Integrantes: Por PricewaterhouseCoopers: Javier Casas Rúa, socio líder de Markets;; Carolina Ares, gerente de Markets y Juan Pablo Giovaneli, Responsable de Comunicación y Prensa de PricewaterhouseCoopers Por RFB Lynch Partners : Ángeles Alonso, Marina López Saubidet y Juan Carlos Lynch, consultoras y CEO de RFB Lynch Partners a. Introducción a. 1. Acerca de PricewaterhouseCoopers PricewaterhouseCoopers (PwC) ofrece servicios de auditoría, consultoría y asesoramientos impositivo y legal centrados en la industria, para construir confianza pública y agregar valor a sus clientes y partes interesadas. Más de 163.000 personas en 151 países comparten conocimiento, experiencias y soluciones a lo largo de nuestra red, para desarrollar nuevas perspectivas y brindar asesoramiento práctico. En Argentina, la firma cuenta con 1.679 colaboradores y una red de servicios a nivel nacional, con oficinas en Buenos Aires, Córdoba, Rosario y Mendoza. a. 2. Acerca del PePP Consciente de que los periodistas constituyen uno de los públicos de interés clave para la compañía, PwC entiende que una auténtica y positiva relación con la prensa comienza por ofrecer un buen servicio, comprender las necesidades del periodista, y ayudarlo a hacer su trabajo. En este contexto se concibió la idea de realizar una actividad de capacitación y formación académica para periodistas que acercara a los socios de la firma a quienes trabajan en las redacciones periodísticas de los principales medios de comunicación. Así, el Programa Ejecutivo PwC para Periodistas (PePP) es una actividad de capacitación en la que los socios de la firma comparten su conocimiento, experiencia y know how con periodistas argentinos y extranjeros. El objetivo del programa es dar valor agregado a profesionales de los medios y suministrarles información y conocimiento técnico actualizado sobre los temas económicos y financieros más relevantes de la actualidad, que le sirvan de contexto para entender mejor la realidad de las empresas y del propio país. a. 3. Objetivo Este relacionamiento resultaría también un modo ideal tanto para ampliar los temas en los que PwC ya es una fuente confiable y autorizada como para posicionar nuevos temas. PwC cuenta con la capacidad para ofrecer valiosa información y consulta para la prensa, al ser parte de una red global de conocimiento. Esta acción contribuiría a consolidar la relación entre PwC y los medios;; es decir, entre los socios, directores y gerentes de PwC y los periodistas. De esta manera, esta actividad aportaría en forma importante a conseguir el objetivo macro de todas las acciones de PwC orientadas a la prensa: tener una mayor y mejor presencia en los medios para alinear las actividades de comunicación con la estrategia de negocios. La propuesta de realizar una actividad de formación académica para periodistas tiene como objetivo concretar una acción de goodwill que aproveche y rentabilice: ‡ los contenidos que posee PwC gracias al sector en que desarolla su negocio y que le permite contar con un vasto conocimiento y una importante experiencia en los más variados temas de las más diversas industrias;; ‡ el equipo de socios, directores o gerentes de alto nivel profesional y reconocido prestigio en el mercado;; ‡ la alta reputación de marca, tanto a nivel de la opinión pública general como así también a nivel de los grupos que constituyen el universo de públicos prioritarios para PwC. $Vt 3Z& FRQWDED FRQ ORV FRQWHQLGRV HO ³FXHUSR GRFHQWH´ \ OD DXWRULGDG VXILFLHQWH SDUD LPSDUWLU XQD
capacitación de este tipo. Y estos tres atributos parecían suficientes para obtener una excelente respuesta de una audiencia de periodistas que saben apreciar estas oportunidades de capacitación y estudio sin costo y donde además pueden establecer un networking de suma utilidad para su trabajo, tanto con colegas de otros medios de comunicación como con los socios y referentes de PwC. Así, se concibió este programa para periodistas, una capacitación intensiva que debía durar una semana, brindando un panorama completo y muy actual sobre distintos temas de interés y de tendencias para los periodistas. En este sentido, y para darle una identidad a la formación que contribuya al propio posicionamiento de la propuesta académica, se pensó denominarlo como un programa ejecutivo de capacitación. Así, se definió el nombre Programa Ejecutivo PwC para Periodistas (PePP). a. 4. Público objetivo y mensajes El universo de periodistas a invitar se planteó en forma abierta. Incluía a los principales referentes de cada medio: a redactores, editores y directores periodísticos de diarios, revistas, portales y agencias de noticias;; a productores y conductores de radio;; e incluso a los alumnos de las Maestrías de Periodismo de La Nación ± Universidad Di Tella y Clarín ± Universidad de San Andrés. Estuvo dirigida a la prensa en general, con especial foco en los medios nacionales, en periodistas especializados en Economía & Negocios, así como en Finanzas, RSE y Management. a. 5. Canales de comunicación y acciones soporte La comunicación y difusión del programa fue dirigida específicamente a directivos, editores, jefes de redacción y gerentes de noticias. De este modo, PwC se garantizaba un beneficio por partida doble: a. Alcanzaba con un mensaje de colaboración y alto impacto positivo a los principales referentes de cada medio. Los editores utilizaban al PePP como un beneficio de capacitación a sus mejores talentos. b. Al ofrecer el programa a quienes tienen poder de decisión, se aseguraba que los interesados en asistir ya contarían con la autorización de sus jefes. El diseño de todas las piezas que se utilizaron para esta acción: logo, invitación, presentaciones y materiales para los alumnos, entre otras, se correspondió con una identidad propia y determinada para el Programa. La primera comunicación del lanzamiento del PePP se hizo por medio de una pieza de marketing directo en formato teaser. En concreto, se envió a más de 200 editores, jefes de redacción, gerentes de noticias y SHULRGLVWDVHQJHQHUDOXQELUUHWHFRQHOORJRGH3Z&\XQDIUDVHGH6pQHFD³1ROOHJDantes el que va más UiSLGRVLQRHOTXHVDEHDGyQGHYD´6yORHVR Una semana después, y siguiendo la lógica del birrete, cada uno de los que recibieron el primer envío, recibió un correo electrónico con un brochure que invitaba al programa, bajo el lema: 5 días, 10 temas, muchas oportunidades para estudiar y capacitarte sobre las tendencias, las problemáticas y los nuevos intereses que predominan hoy en el mundo de las empresas. En este segundo envío, se instaba a los periodistas a ingresar en www.pwc.com/ar/pepp, un micrositio desarrollado especialmente para el programa en el que encontrarían un quiz de preguntas y respuestas sobre la economía y las empresas argentinas, que luego lo derivaba a un formulario de inscripción al programa. Por supuesto, esta acción se acompañó con un seguimiento telefónico a toda la base del mailing original. Todos estaban ya al tanto de la iniciativa, que a esa altura, ya corría de boca en boca en las redacciones. Muchos periodistas, que no fueron incluidos en el listado de contactos original, comenzaron a comunicarse directamente con RFB Lynch, mostrándose interesados y con intención de lograr una inscripción en el PePP. Luego de este envío, se hizo un tercero, realizado exclusivamente a los periodistas inscriptos. Allí se les entregó un cronograma detallado del programa, la credencial personal de cada uno y un cuaderno con un lápiz a mina y una birome para tomar apuntes durante las clases. b. Ejecución del pepp Para definir el contenido del Programa se tomó como plataforma el listado de temas principales definido en el Plan de Prensa 2009 de PwC: Tax & Legal Services (TLS), Desarrollo Sostenible & RSE, Financial Services, Recursos Humanos (RR.HH.), Tecnología (IT), Agribusiness, Forensic Services, International FinanciDO5HSRUWLQJ6WDQGDUGV,)56\0HUJHUV$FTXLVLWLRQV0$¶V$VtVHVHOHFFLRQDURQORVVLJXLHQWHV
diez temas, elegidos por tres criterios principales: grado de atractivo, nivel de dimensión pública e importancia para la reputación de PwC. ‡ Desarrollo Sostenible + RSE ‡ Finanzas: The day after tomorrow ‡ IFRS: Marco regulatorio contable ‡ 0$¶V)XVLRQHV\$GTXLVLRQHV ‡ 55++0DQDJLQJ7RPRUURZ¶V3HRSOH ‡ Tecnología: Technology Insights ‡ Agribusiness: un repaso por la situación argentina actual ‡ Medios de Comunicación ‡ TLS: el marco tributario en una Argentina cambiante ‡ Forensic Services: el fraude corporativo en las compañías Las clases se impartieron en una semana, con una cursada que fue de lunes a viernes en el horario de 9.30 a 13.00 hs. Cada día se dividió en dos clases, con módulos de 90 minutos cada una, más un break de 30 minutos. El curso se desarrolló en el auditorio de PwC, se ofreció un servicio de catering (cafetería, bebidas, medialunas y sandwiches). Y, en cuanto a la cantidad de alumnos, se estimó un número cercano a los 20 periodistas, aunque luego resultaron inscriptos 48. Para contar con el certificado de asistencia al PePP, se fijó como requisito alcanzar un mínimo de 80% de presencia. Los periodistas podían faltar como máximo a dos módulos, es decir, a un día completo de los cinco que conformaban el programa. Sólo con la cursada los periodistas podían acceder al certificado. Una de las fortalezas de PwC para implementar esta capacitación para periodistas radica precisamente en HO DEXQGDQWH PDWHULDO H LQIRUPDFLyQ FRQ TXH FXHQWD OD HPSUHVD SDUD QXWULU FDGD ³PDWHULD´ DGHPiV GH
TXHVHWUDWDGHFRQWHQLGRVGHJUDQDFWXDOLGDG(VDVtTXH3Z&VHGHILQHFRPRXQD³HPSUHVDGHJHVWLyQGHO
FRQRFLPLHQWR´ $O PLVPR WLHPSR ORV VRFLRV GLrectores o gerentes que actúan como profesores, pueden desarrollar muy bien ejemplos a través del método del caso, porque trabajan con empresas y realidades concretas, que les permiten relacionar el contexto local con tendencias que se están dando en otros países del mundo. 8QD LQLFLDWLYD DGLFLRQDO HV OD FRPXQLGDG ³$OXPQL 3Z&´ OD $VRFLDFLyQ GH $QWLJXRV $OXPQRV GHO 3H33 (O
objetivo es mantener el contacto con ellos y entre ellos, a través del envío regular de información y la convocatoria a alguna clase especial de actualización o explicativa de algún tema coyuntural. Aunque todavía no está implementado, se realizará en los próximos meses. La comunidad es una herramienta eficaz para posicionar la capacitación y generar branding de cara a los periodistas. C. Evaluación de resultados El PePP constituyó la primera iniciativa de PwC en el ámbito de las capacitaciones para periodistas. Los atributos más destacados de la acción fueron su condición de original, la actualidad y vigencia de sus contenidos, su nivel profesional y su valor práctico para los periodistas. La mayor virtud de esta iniciativa fue generar un espacio exclusivo para los periodistas donde pudieran interactuar con los socios de la firma, referentes en cada industria, conocer más y mejor la realidad local e internacional respecto de los temas planteados y generar una relación con la compañía a partir del conocimiento directo y de la admiración por su know how. Sin duda, el prestigio de la marca, el nivel de los expositores, la selección de temas y la calidad de los medios convocados representaron un activo de suma importancia para asegurar la excelente repercusión lograda. Algunos indicadores que reflejan el éxito de esta primera edición del PePP: ‡ El promedio diario de asistentes fue de 26,4 periodistas. ‡ Asistencia total superior a 40 periodistas. ‡ 28 periodistas asistieron al 80% del curso y accedieron al certificado. ‡ 14 periodistas tuvieron asistencia perfecta. ‡ El 39% de los asistentes fueron editores de secciones de negocios y directores periodísticos. El 61%, redactores. ‡ El 37% de los periodistas trabajan en revistas de negocios;; 24% en diarios, 18% en portales de información, 16% en radio y 5% en agencias de noticias. ‡ Asistieron periodistas de: los diarios La Nación, El Cronista, Ámbito Financiero, BAE y La Razón;; las revistas Mercado, Apertura, Prensa Económica, Newsweek, Ecosistema, Sophia y Grupo de Revistas La Nación;; las agencias Noticias Argentinas (NA) y Télam;; los portales Cronista.com, Lanacion.com y Apertura.com;; y las radios Continental, Rivadavia y FM Identidad. ‡ Los asistentes evaluaron cada clase de 1 a 10, de acuerdo a su interés por el tema y a la calidad de las exposiciones: la calificación promedio que obtuvo todo el programa fue de 8,2 puntos. ‡ Algunos testimonios que se relevaron de los propios asistentes: o ³0X\SURGXFWLYRHQJHQHUDOEXHQRVRUDGRUHVHLQWHUHVDQWHVWHPDV´ o ³%XHQFRPSHQGLRGHORVWHPDVDOWRQLYHOGHSRQHQFLDV´ o ³0X\DJUDGHFLGR7HQJRQXHYDVKHUUDPLHQWDVSDUDPLWUDEDMR´ o ³,QWHUHVDQWHLQLFLDWLYDLPSRUWDQWHTXHVLJD´ o ³8QRGHORVPHMRUHVSURJUDPDVDORVTXHKHDVLVWLGR´ o ³0HJXVWDUtDTXHYXHOYDDUHDOL]DUVHPHSDUHFHPX\~WLO\QHFHVDULR´ o ³1RV DFHUFD D ORV SHULRGLVWDV D OD VLWXDFLyQ HPSUHVDULDO DUJHQWLQD \ PXQGLDO QR VROR HQ WHPDV
ecoQyPLFRVVLQRHQWHPDVGLYHUVRVFRPRPHGLRDPELHQWHVHJXULGDG55++HWF´ ‡ Algunas repercusiones que PwC obtuvo en los medios a partir de este programa (resultados relevados hasta dos semanas después de la finalización del programa;; hay que tener en cuenta que después de ese momento es probable que se hayan generado más notas aún): o Entrevista del diario La Nación para nota de fraude corporativo o (QWUHYLVWDGHOGLDULR%$(SDUD0$¶V o Columna de opinión en la sección de Empleos de La Nación o Columna de opinión para especial de Information Technology o Entrevista de la revista especializada Genoma o Entrevista de la revista Apertura para nota sobre finanzas o Entrevista de la revista Genoma para nota de RR.HH. o Columna de opinión sobre RSE para revista Newsweek o Entrevista sobre M&A para la sección de Empleos de La Nación o Columna de opinión para la revista Ecosistema o (QWUHYLVWDGH$SHUWXUDSRUWHPDGH0$¶V o Entrevista de La Nación por tema de Empleos ‡ El 100% de los encuestados señaló que le gustaría que el programa se realice anualmente PREMIOS EIKON 2010 Categoría: Relaciones con la Prensa Caso: Seguridad Pública Empresa: Motorola Agencia de PR: Colombo-­PR Integrantes: Por Motorola: Gustavo Wrobel, Director Corporativo de Comunicaciones para América Latina de Motorola;; Andrea Modarelli, Analista senior de comunicaciones externas de Motorola. Por Colombo-­PR: Patricio Carvajal, Director General de Colombo PR;; Ariel Pérez, Coordinador de cuentas corporativas de Colombo PR. Diego Bubillo, ejecutivo de B2B de Motorola, Colombo PR. Introducción Esa palabra tan temida, la inseguridad ³6yOR XQD VHQVDFLyQ´ GHFtDQ GHVGH HO RILFLDOLVPR PLHQWUDV TXH PHGLRV \ RSRVLFLyQ JULWDEDQ GHVGH OD
vereda de enfrente con una misma voz que era un gran problema social. Lo cierto es que en los últimos tiempos la inseguridad en el país es una realidad, que día a día muestra la peor de sus caras. Ante este escenario, y teniendo en cuenta la capacidad de la tecnología de colaborar para mejorar la situación, a principios de 2009 desde Motorola se detectó la necesidad de presentar todo el portafolio de Seguridad Pública que provee la empresa. La tecnología facilita la integración de las comunicaciones entre todas las fuerzas de seguridad, incluyendo a policía, bomberos, ambulancias y centros médicos, para una acción eficiente. A través de distintas soluciones se puede lograr una comunicación ininterrumpida, para estar siempre disponible ante cualquier tipo de situación. Gracias a tecnologías como la video vigilancia es posible monitorear zonas peligrosas, con el fin de prevenir los delitos y actuar de manera coordinada y veloz ante situaciones críticas. La banda ancha inalámbrica permite que las fuerzas del orden tengan acceso en tiempo real a información que les facilita la toma de decisiones. Las computadoras móviles y las radios digitales agilizan la comunicación, ya que permiten que en pocos segundos se pueda coordinar una acción frente a un hecho puntual. Con el foco puesto en estas soluciones, se creó una campaña integral de Seguridad Pública centrada en relaciones con los medios. El otro lado de la compañía Motorola es conocida mundialmente por su innovación en comunicaciones y está enfocada en optimizar la manera en que el mundo se conecta. Pese a que está históricamente relacionada con los teléfonos celulares, no todo el mundo sabe que la compañía es la principal responsable del detrás de escena de las comunicaciones: desde infraestructura de banda ancha, soluciones de movilidad empresarial y seguridad pública, hasta video de alta definición y dispositivos móviles. Motorola lidera la próxima generación de innovaciones que permiten a las personas, empresas y gobiernos estar más conectados y ser más móviles. En el año 2009 Motorola tuvo una facturación de 22 mil millones de dólares, y con más de 80 años de experiencia en el mercado, es una empresa líder que inventa la tecnología de hoy y mañana. Tengo un plan, para mejorar la seguridad Aunque la frase puede recordar a la promesa electoral de algún dirigente político, ante la necesidad de presentar las soluciones de Seguridad Pública, y demostrar su eficacia, se ideó un plan de relacionamiento con los medios, dividido en tres grandes pilares: ˹ La presentación de todas las soluciones de Motorola orientadas a Seguridad Pública. ˹ La detección y comunicación de casos de éxito locales y regionales, donde ya se encontraban funcionando las tecnologías de la compañía, para mostrar resultados concretos que validen los dichos de la empresa. ˹ El futuro de la seguridad pública: La presentación de nuevas tecnologías, que optimizan las soluciones ya existentes. ˹ &RQFHSWR³&UHDQGR&LXGDGHV\FRPXQLGDGHVVHJXUDV´ Para llevarlo a cabo, se realizaron una gran cantidad de acciones a lo largo de todo el año, entre las que destacaremos el evento de presentación MOTOTECH, donde se dieron a conocer todas las soluciones para Seguridad Pública;; los casos de éxitos de ciudades locales y regionales orientados a Seguridad y Videovigilancia;; el lanzamiento de XAVER, un dispositivo que permite a las fuerzas policiales o militares ver a través de las paredes en situaciones críticas;; y un Press Tour al Centro de Desarrollo de Software de Motorola en Córdoba, en el que se presentó Premier One, un software inteligente de seguridad pública GHVDUUROODGRORFDOPHQWHHQ$UJHQWLQDSRUODFRPSDxtDSDUDFHQWURVGHHPHUJHQFLD³´TXHVHHVWDUi
probando en ciudades de Estados Unidos. Objetivos -­ Elevar la visibilidad del portafolio de soluciones de Motorola ante periodistas, opinión pública y potenciales clientes como una alternativa ideal para mejorar la seguridad y las comunicaciones en Ciudades y Comunidades del país. -­ Presentar las soluciones tecnológicas para cada tipo de cliente en función de su necesidad: gobierno nacional, provincial, municipal y empresas. -­ Posicionar a los voceros de Motorola como referentes ante los medios de la temática de tecnología aplicada a la seguridad. -­ Reforzar, a través de los periodistas, los beneficios y las diferencias entre las soluciones tecnológicas que ofrece la compañía: sistemas de radiocomunicación, banda ancha inalámbrica, computadoras móviles, accesorios, las radios digitales MOTOTRBO, aplicaciones, etc. Público Al ser un tema sensible que afecta a toda la sociedad, Motorola es conciente de que la campaña debía tener una segmentación de públicos adecuada, con el fin de llegar a todos. Por esa razón, los públicos a los que se dirigió la campaña fueron divididos en dos niveles: masivo y especializado. Por un lado, debía llegar a líderes de opinión, medios masivos, tecnológicos y bloggers, con el fin de elevar la visibilidad ante la opinión pública. En segundo lugar, el plan se enfocó en medios verticales (seguridad, municipales, gubernamentales, retail, transporte, oil&gas) y empresariales y potenciales clientes, como autoridades públicas y corporativas. La comunicación a ambos públicos se realizó simultáneamente a lo largo del año, a través de distintas acciones. MOTOTECH, las cartas sobre la mesa El primer gran paso que dio Motorola ante este escenario fue presentar todas sus soluciones orientadas a Seguridad Pública, con dos eventos realizados en abril bajo el mismo nombre: MOTOTECH. Una antigua casona de Recoleta, que lOHYDHOQRPEUH³/RGH$EHUJ&RER´VH FRQYLUWLySRUXQGtDHQXQ
centro de mando de fuerzas del orden: las habitaciones simularon ser puestos de control y, en ambientes donde se respiraba la última tecnología, se presentaron las soluciones de Seguridad Pública de la empresa: Sistemas de Radiocomunicación;; aplicaciones de Seguridad Pública;; MOTOTRBO, la evolución digital de las radios;; el portafolio de banda ancha inalámbrica;; computadoras móviles y las ventajas de la videovigilancia. Bajo todo este abanico GH VROXFLRQHV VH LQWURGXMR HO FRQFHSWR GH ³&LXGDGHV \
&RPXQLGDGHV6HJXUDV´ Los eventos fueron orientados a dos públicos: la presentación para prensa, en la que participaron más de 30 periodistas de diarios nacionales, revistas de mercados verticales y sitios especializados. Bajo el FRQFHSWR ³&RQ ODV VROXFLRQHV GH PRYLOLGDG GH 0RWRUROD HV SRVLEOH FUHDU FLXGDGHV \ FRPXQLGDGHV PiV
VHJXUDV HQ HO SDtV´ \ FRQ HO &(2 GH 0RWRUROD $UJHQWLQD 3DEOR 2UVHL DO IUHQWH GH OD SUHVHQWDFLyQ VH
dieron a conocer las soluciones. Los resultados de esta primera etapa se pudieron ver en los medios, con más de 60 publicaciones, y en los contratos que cerró la compañía. En la otra presentación participaron más de 100 potenciales clientes, entre los que se destacaron las autoridades militares, policiales y gubernamentales;; entidades de emergencia y empresas de logística, oiil&gas y seguridad. La única verdad es la realidad: casos de éxito +DFH PiV GH GRV PLO DxRV $UWLVWyWHOHV \D GHFtD TXH ³OD ~QLFD YHUGDG HV OD UHDOLGDG´ 7omando este concepto como bandera, la compañía decidió comunicar los casos de las ciudades que ya estaban utilizando tecnologías de Seguridad Pública de Motorola, para demostrar el funcionamiento real de todas sus soluciones. La comunicación se realizó a través de anuncios de prensa, entrevistas exclusivas con medios especializados y desarrollo de artículos de interés periodístico. En cada caso se buscó un diferencial, con el fin de autentificar la eficacia de distintas soluciones. En la búsqueda de fortalecer el posicionamiento de Motorola en el área, el plan original se modificó y se optó por comunicar no sólo los casos de éxito de Argentina, sino también los regionales. Los casos más relevantes del año fueron: Campana: ³/R SULPHUR HVODVDOXG \ ODVHJXULGDG´ GLMHURQHQODFLXGDG ERQDHUHQVH GH&DPSDQD<DVtSDVyFRQOD
estrategia digital del municipio, que consistió al principio en poner en red a las organizaciones de la salud y seguridad, instalar un sistema de videovigilancia e informatizar el Hospital Municipal. El proyecto, iniciado en noviembre de 2008, utiliza tecnología de banda ancha inalámbrica Motorola. En junio de 2009, las autoridades afirmaron que la cantidad de delitos se redujo en 62% en los primeros 4 meses desde la instalación definitiva del sistema de video vigilancia. Se realizaron 4 entrevistas con participación de las autoridades y se distribuyó un comunicado a medios especializados, con lo que se obtuvieron 17 repercusiones. Berazategui El municipio presentó una implementación avanzada de seguridad pública con soluciones de Motorola. El proyecto generó interés en medios de tecnología, verticales y de sociedad por lo avanzado del caso y por ser el primer municipio del país en completar el plan de seguridad nacional del gobierno. Para dar a conocer el caso, se realizó una visita con Information Technology para generar una publicación de alto impacto en el sector. Luego de la publicación, se distribuyó un comunicado que logró 15 publicaciones. Pigüé La municipalidad, ubicada en el partido bonaerense de Saavedra, digitalizó su infraestructura de comunicaciones con el portafolio de banda ancha inalámbrica de Motorola. Gracias a este proyecto, el municipio beneficia a sus habitantes con conectividad a Internet, servicios para la ciudadanía y video vigilancia. El caso se destacó porque demostró que no es necesario un gran presupuesto para convertirse en una ciudad digital. Se gestionó la publicación en exclusiva con el medio Punto Gov y se envió el comunicado de prensa, por lo que se obtuvieron 10 publicaciones más. San Pablo La Secretaría de Seguridad Pública del Estado de São Paulo digitalizó los sistemas de radio de la policía de Presidente Prudente y de otros ocho municipios de la región con tecnología Motorola. El resultado fue una atención más ágil y una mayor seguridad para la población. Al no ser local, se distribuyó un comunicado masivo, que también logró 6 repercusiones en diversos medios. Cartagena El Distrito Turístico y Cultural de Cartagena de Indias optó por tecnologías de Motorola para la ampliación de la cobertura de la red de video vigilancia implementada de manera exitosa en 2008, contribuyendo así DTXH&DUWDJHQDVHDXQDFLXGDGPiVVHJXUD/DVDXWRULGDGHVGHOPXQLFLSLRGHFODUDURQTXH³SDUDOD3ROLFtD
Metropolitana de Cartagena este sistema de video vigilancia se ha convertido en una herramienta fundamental en el propósito de mejorar las condiciones de seguridad y convivencia en la ciudad, en la medida en que mejora sus tiempos de respuesta, optimiza sus recursos humanos, agiliza los procesos de MXGLFLDOL]DFLyQ \ JHQHUDSHUFHSFLyQ GH VHJXULGDG´$QLYHOFRPXQLFDFLRQDOVH JHVWLRQyXQDHQWUHYLVWDFRQ
un vocero regional con el medio Área Urbana y se distribuyó un comunicado que obtuvo 4 publicaciones. El futuro de la seguridad pública Motorola siempre se destacó por su liderazgo en innovación, y por eso mismo el cierre del plan debía estar condimentado con el color de lo que se viene. Con el portafolio de productos y soluciones presentado públicamente y el posicionamiento logrado a través de los casos de éxito, en el último trimestre la comunicación se enfocó en presentar el futuro de la tecnología para Seguridad Pública. Para ello, Motorola se centró en dos acciones: la presentación local de XAVER, un dispositivo que permite a las fuerzas policiales o militares ver a través de las paredes;; y el anuncio del desarrollo, en el Centro de Córdoba de Premier One, el software utilizado en la nueva generación de tecnologías para la seguridad pública en Estados Unidos. Presentación Xaver Desde que apareció Superman, ver a través de las paredes fue uno de los sueños más deseados por todos. Motorola lo hizo posible. Con el fin de reforzar su posicionamiento en Seguridad Pública y ofrecerles a las autoridades una solución única, Motorola lanzó en Octubre los equipos de la línea XAVER, los cuales permiten visualizar a través de paredes sólidas en situaciones de emergencia u operaciones tácticas. Con un peso de sólo 15 kg, este radar genera imágenes de lo que sucede del otro lado de muros de hasta medio metro de espesor y puede ser transportado en un bolso. Se realizaron dos eventos con demostraciones del producto: uno orientado a potenciales clientes (autoridades, fuerzas policiales y militares, etc) y otro orientado a prensa. Además, con el objetivo de darlo a conocer al público masivo, se generó una nota en Telefé Noticias, donde se hizo una demostración en vivo del dispositivo. La comunicación del producto obtuvo más de 30 repercusiones en medios de primera línea, y entrevistas con 5 radios de los voceros regionales que vinieron al país para la presentación. Anuncio Premier One Como cierre del Plan, se realizó un Press Tour al Centro de Desarrollo de Software en Córdoba, que estaba cumpliendo 8 años. Allí se comunicó oficialmente Premier One, un software íntegramente desarrollado en el país y que ya se utiliza en aplicaciones de seguridad pública en Estados Unidos, en ciudades como Washington DC, Nashville, Ventura, Cincinnati y North Hempstead, entre otras. Esta tecnología brinda al personal de las fuerzas de seguridad un acceso rápido y confiable a la información de personas, bienes y vehículos desde cualquier sitio. Las capacidades avanzadas de este software incluyen el monitoreo del estado dentro de un vehículo, mapas, buscapersonas, información e integración con fotografías;; capacidad de texto y voz;; correo electrónico, transferencia inalámbrica de archivos, soporte para lectores de código de barras y bandas magnéticas, entre otras funcionalidades. Todo esto colabora para el ahorro de tiempo y optimiza el trabajo de las fuerzas de seguridad. En el Press Tour participaron importantes medios como Clarín, El Cronista, Newsweek e Information Technology, en los cuales se obtuvieron notorias publicaciones. Además, se distribuyó un comunicado anunciando el sofware que obtuvo 22 repercusiones más. Resultados Con la diversidad de acciones realizadas a lo largo del año, Motorola superó ampliamente las expectativas planteadas. Más allá de los exitosos resultados, la compañía logró un posicionamiento clave en el sector, y hoy ya es consultada espontáneamente por los medios en los temas relacionados con seguridad pública. El análisis de las notas publicadas, los comentarios de los periodistas y la participación en los distintos tipos de eventos permitieron la llegada a todos los públicos. Y sobre todo a que los medios cubrieran cada una de las acciones realizadas con estos productos que eran desconocidos para la mayoría y capitalizando de esta manera todas las oportunidades para lograr mayor valor de marca. La presencia de Motorola en todos los artículos demuestra el liderazgo indiscutido de la empresa y las publicaciones resultaron altamente positivas, logrando que los objetivos planteados al inicio de la campaña sean superados. Análisis Cuantitativo Valor Publicitario Representativo Al no existir una medida aprobada unánimemente para la evaluación de las publicaciones de prensa, al momento de mostrar los resultados consideraremos una de las medidas más utilizadas: el valor publicitario representativo, que es la equivalencia entre los centímetros por columna que ocupa cada publicación respecto de su costo en tarifas publicitarias brutas. El valor publicitario representativo de la campaña de Seguridad Pública, hasta diciembre del año pasado, alcanzaba los US$ 134.477, que equivale en pesos argentinos a $525.805. En total, se registraron 157 publicaciones. Mensajes Reflejados en los Medios ‡ ³/D6HJXULGDGHPSLH]DSRUODLQWHOLJHQFLD´02727(&+± La Nación ‡ ³&LXGDGHV'LJLWDOHVFLXGDGHVVHJXUDV´02727(&+± Ebizlatam ‡ ³&RPR6XSHUPDQSHURUHDO´;$9(5± Telefé Noticias ‡ ³0RWRURODYHDWUDYpVGHODSDUHG´;$9(5± Information Technology ‡ ³8QHTXLSRGH0RWRURODSDUDYHUDWUDYpVGHODVSDUHGHV´;$9(5± Agencia DERF ‡ ³%HUD]DWHJXLWLHQHYLGHRYLJLODQFLD´± Portinos ‡ ³9LJLODQFLD:L-­),´± Bloggers ‡ ³3LJpFRQHFWDGD´± Puntogov ‡ ³8QELHQFRUGREpV´± Newsweek ‡ ³/DWRQDGDFRUGREHVDFRQWDJLDDOQRUWHDPHULFDQR´± Clarín Conclusiones Los resultados están a la vista y demuestran claramente el nivel de visibilidad que logró la campaña en los medios, pero más allá de la cantidad de publicaciones es importante destacar el posicionamiento que logró Motorola en el sector de Seguridad Pública, tanto entre sus clientes como entre los periodistas, que ya identifican a la empresa como una de los jugadores claves del sector y la consultan espontáneamente cuando están trabajando con ese tema. El riesgo que se corrió por tratar con un tema sensible como la inseguridad pudo verse disminuido por la FUHDFLyQGHOFRQFHSWR³&LXGDGHV\&RPXQLGDGHV6HJXUDV´VLQKDFHUDOXVLyQDODLQVHJXULGDGQXQFD\ODV
declaraciones de los voceros. Más allá de que los medios abordaron esta temática, ninguno mal interpretó el concepto o vinculó la campaña con fines políticos. En conclusión, Motorola es uno de los líderes globales en soluciones de Seguridad Pública, con la campaña desarrollada por la compañía, junto a su agencia de prensa Colombo PR, se logró dar a conocer ese liderazgo a todos los públicos propuestos a nivel local. PREMIOS EIKON 2010 Categoría: Relaciones con la prensa (PYME) Caso: FACARA Por un transporte de vertical seguro Empresa: Federación de Asociaciones y Cámaras de Ascensores de la República Argentina (FACARA). Agencia de PR: Consultora Visión Empresarial Integrantes: Por Visión Empresarial: Yésica Marina Bernardou ± Licenciado Fernando Gabriel Caniza Introducción Se deberá detallar brevemente la naturaleza de la compañía o institución para la que ha sido realizado el plancomunicacional. Quiénes somos La Federación de Asociaciones y Cámaras de Ascensores de la República Argentina, FACARA, es una entidad sin fines de lucro que reúne a cámaras y asociaciones de empresas dedicadas a la fabricación, instalación y conservación de elementos utilizados en el transporte vertical de personas y objetos. Nuestro principal objetivo es promover y fortalecer la Industria y Prestación de Servicios de Transporte Vertical a nivel Nacional, para mejorar las relaciones entre las entidades gremiales y trabajar con criterios unificados en un continuo perfeccionamiento de la actividad. Reseña histórica En agosto de 1990 se crea la Federación de Ascensores de la República Argentina (F.A.R.A) con la finalidad de nuclear a todos los exponentes del Sector, bajo un óptica integradora de todas las ciudades del país, constituyéndose como un espacio neutral para las distintas expresiones técnicas y comerciales. En el año 2.002 la Dirección General de Personería Jurídica nos solicita cambiar nuestra denominación a FACARA y es así que obtenemos nuestra actual identidad: Federación de Asociaciones y Cámaras de Ascensores de la República Argentina. También deberá identificarse el problema (causa y consecuencia) por el cual se implementó dicho plan. La Federación de Asociaciones y Cámaras de Ascensores de la República Argentina (FACARA), después de 7 años de actividad sin comunicación, decidió lanzar una campaña de comunicación a partir de la realización del Primer Congreso Nacional de Transporte Vertical, detallar los objetivos impuestos para el programa respectivo, incluyendo lapsos y/o tiempos previstos para su cumplimiento. Objetivos generales: 1) Posicionamiento de la FACARA como una institución que proyecta a la sociedad: confianza, seguridad, respaldo. La misión es la responsabilidad de difundir y promover una mayor calidad en el sector de los ascensores. 2) Concientizar a la población en general, y al mismo tiempo, a los administradores, técnicos, conservadores y empresarios, en particular, acerca de la necesidad de elevar el estándar de calidad para la prevención de accidentes. Objetivos particulares: 1) Revertir la percepción negativa de la opinión pública sobre el mercado de los ascensores. 2) Crear conciencia sobre la responsabilidad de los técnicos, administradores, propietarios y organismos de control vinculados al sector. 3) Generar estadísticas propias de interés público disponibles para la consulta del periodismo, funcionarios, empresarios y ciudadanos, entre otros actores sociales. 4) Comunicar sistemáticamente temas relacionados con la prevención de accidentes. 5) Aumentar la cantidad de asociados a la FACARA. Identificar los públicos a los que el plan apuntó y el mensaje que era necesario transmitir. Publico externo: usuarios, administradores, periodistas, líderes de opinión, funcionarios de organismos estatales locales, regionales y nacionales, legisladores Público interno: asociaciones y cámaras integrantes de la FACARA, técnicos, conservadores y empresarios Mensaje: El sector del transporte vertical es clave ya que tan sólo en CABA 3 millones de personas utilizan ascensores, mientras que se realizan 50 millones de viajes por día en todo el país. Se estima además que al menos en Buenos Aires existen 140.000 equipos en funcionamiento y otros 60.000 distribuidos en el resto de las provincias. Al mismo tiempo, las estadísticas de la Federación indican que el parque de ascensores se encuentra dividido en: 74% viviendas, 11% instituciones de sanidad y 15% edificios de oficinas. Y otra particularidad es que el 80% del mercado de las empresas de ascensores son Pymes nacionales, mientras que el 20% se halla en manos de firmas multinacionales. Dada la importancia de esta actividad y los riesgos permanentes que sufren los usuarios, el presidente de OD )$&$5$ 5XEpQ *DUFtD VH UHILULy D OD QHFHVLGDG GH ³FRPXQLFDUVH FRQ OD RSLQLyQ S~EOLFD XVXDULRV
finales, empresarios, administradores, propietarios, autoridades gubernamentales y organismos de control para crear conciencia sobre el uso y mantenimiento de los ascensores para tener un Transporte Vertical FDGDYH]PiVVHJXUR´7DOHVDVtTXHOD)HGHUDFLyQVHKDSODQWHDGRHOREMHWLYRGHWUDEDMDUGHPDQHUD continua sobre la prevención de accidentes ya que la mayoría de las veces resultan hechos evitables. Detallar cuáles fueron los canales de comunicación (internos y/o externos) utilizados. Canales externos: diarios, revistas, radios, sitios Web y redes sociales Canales internos: newsletter, envío de clipping de prensa por email e impreso. Acciones realizadas que fueron los soportes del plan comunicacional. Se realizó un evento de relaciones públicas, el 30 de septiembre de 2009, con el exitoso Primer Congreso de Transporte Vertical, en el auditorio de la Universidad Argentina de la Empresa. Desayuno de prensa en diciembre de 2009 b) Ejecución del plan Se elaboró un plan anual de comunicación basado en la realización de una Campaña de Bien Público para ejecutar en diferentes etapas: en principio, con el motivo del Congreso Nacional de Transporte Vertical se apuntó en primer término a los medios de comunicación gráficos y radiales, locales y nacionales, a través del envío de gacetillas de prensa por e-­
mail, con contacto telefónico y personal con los periodistas. También se enviaron carpetas con información impresa y en formato CD. Asimismo se enviaron newsletters y se utilizaron redes sociales como Twitter, Facebook, Sonico y NING. El Plan por etapas: Se propone planificar y desarrollar diferentes canales de comunicación para difundir mensajes institucionales coherentes y unificados acerca de la actividad y los intereses colectivos que persigue la FACARA. Se propone establecer diferentes etapas en la comunicación. La primera será más intensiva y de carácter masivo, abarcará a los diferentes públicos: medios de comunicación, asociados de todo el país, cámaras colegas, técnicos, administradores, funcionarios y la sociedad en general.(Corto plazo) Una segunda etapa que también contempla a la anterior pero será más selectiva y con un acercamiento personalizado a todos los asociados. (Mediano plazo) Entramos en esta etapa potenciando el vínculo con los medios en las provincias, especialmente donde se encuentran los asociados La tercera etapa será mixta, oscilará entre los mensajes masivos y aquellos que resulten estratégicos para las necesidades de los asociados. (Largo plazo) Tácticas de campaña para el 2010 Se proponen múltiples herramientas de comunicación para cumplir con estos objetivos. En esta etapa inicial se desarrolla: Contacto directo con líderes de opinión. (Relaciones públicas con la prensa) Gestión de la comunicación con entrevistas, notas, informes y gacetillas en medios de comunicación gráficos y digitales, aunque también radios. Envío de notificaciones institucionales periódicas (e-­mail, cartas, material informativo, etcétera) a los asociados y/o periodistas especializados. Renovación del sitio Web, agregando mayor dinamismo visual e información c) Evaluación/Pruebas Es muy importante destacar el cumplimiento de los objetivos planificados para esta campaña de lanzamiento y su coherencia con los objetivos de largo plazo. Para la prensa resultó muy atractivo el enfoque de Campaña de Bien Público, que sumado a la condición de organización sin fines de lucro, la FACARA consiguió una visibilidad superior a la de una empresa, con un promedio de 4 menciones por nota periodística hasta llegar a las 425 en sólo 115 publicaciones. Como consecuencia del lanzamiento de esta campaña la FACARA vio incrementada su participación en notas sobre el panorama del sector empresarial en general y del mercado de los ascensores en particular, perspectivas económicas del país y de la industria de la construcción en particular. En el Congreso realizado en la UADE se acercaron diarios nacionales, revistas especializadas, radios y hasta canales de TV. En cuanto a los resultados de la campaña de prensa Campaña de Bien Público Por un Transporte Vertical Seguro son más que alentadores dado que también tuvieron muchas consultas de de funcionarios y hasta la convocatoria para participar en el nuevo Polo de Investigación y Desarrollo Tecnológico que está desarrollándose en el Centro Metropolitano de Diseño (CMD), en la ciudad de BuenosAires. La idea del plan apunta a concientizar a la opinión pública pero también a que la actividad pueda competir mejor y expandirse, pues para que la actividad sea dinámica y pueda brindar productos más seguros y confiables debe crecer, investigar y expandirse. Asimismo las repercusiones del Congreso fueron muy intensas durante más de tres meses de lanzada la campaña. Datos destacados de la campaña: Cantidad de gacetillas, y notas/reportajes periodísticos publicados hasta la actualidad: 115 (15 de septiembre al 30 de mayo) a razón de 1 publicación cada 2 días. Conceptos diferenciales que salieron publicados con mayorrepetición ordenados por jerarquías de importancia: seguridad, confianza, prevención, tecnología, mantenimiento, industria nacional, Pymes, exportación y generación de empleo. Cantidad de veces que se mencionó el nombre FACARA en la prensa gráfica: 425, a razón de un promedio de 4 menciones por publicación, superior al promedio de una empresa. Aumentó un 30% la cantidad de contactos con la FACARA Cantidad de consultas telefónicas: aumentó el 15 por ciento Cantidad de visitas a la Web: 2582 en todos los meses Cantidad de suscriptos al newsletter: 600 (más del 50% de las empresas que hay en el país, y que a su vez las reenvían a cada uno de sus empleados, que representan cómo mínimo 4 personas por empresa). Se registró un 20 % más en el flujo de visitas a la Web.
PREMIOS EIKON 2010 Categoría: Relaciones con la Prensa (Regional) Caso: Ciudades Digitales Empresa: Motorola Agencia de PR: Colombo PR Integrantes: Por Motorola: Gustavo Wrobel, Director Corporativo de Comunicaciones para América latina de Motorola;; Andrea Modarelli, Analista senior de comunicaciones externas de Motorola. Por Colombo-­PR: Patricio Carvajal, Director General de Colombo PR;; Ariel Pérez, Coordinador de cuentas corporativas de Colombo PR. Diego Bubillo, ejecutivo de B2B de Motorola, Colombo PR Introducción Quién es Motorola Motorola es conocida mundialmente por ser una compañía destacada por la innovación en tecnología y comunicaciones. Está enfocada en optimizar la manera en que el mundo se conecta. Desde infraestructura de banda ancha inalámbrica, soluciones de movilidad empresarial y seguridad pública, hasta video de alta definición y dispositivos móviles, Motorola lidera la próxima generación de innovaciones que permiten a las personas, empresas y gobiernos estar más conectados y ser más móviles. En el año 2009 Motorola tuvo una facturación de 22 mil millones de dólares, y con más de 80 años en el mercado, es una empresa líder que inventa la tecnología de hoy y mañana. El escenario Tradicionalmente, Motorola ha sido una empresa muy identificada con la innovación tecnológica, fundamentalmente gracias a varios acontecimientos históricos que tuvieron a la compañía como protagonista. Las primeras palabras transmitidas desde la luna, sin ir más lejos, fueron a través de una radio Motorola;; y este tipo de sucesos fueron moneda corriente durante los más de ochenta años de vida de la compañía: la primera radio de dos vías, el primer escáner láser de mano, el primer lector de código de barras y el primer teléfono celular fueron invenciones de Motorola. Debido al aspecto masivo de la tecnología celular, Motorola se impuso con una gran identificación del público como fabricante de teléfonos móviles. No obstante, Motorola posee un amplio y variado portafolio de productos tecnológicos. Dentro del mismo coexisten diversas soluciones tecnológicas que incluyen soluciones de conectividad de banda ancha inalámbrica, videovigilancia, sistemas de radiocomunicaciones y soluciones de movilidad empresarial y seguridad pública, entre otras cosas. Estos productos de Motorola son la base tecnológica que permiten desarrollar una ciudad digital y fueron, justamente, el eje central de ODFDPSDxDGHQRPLQDGD³&LXGDGHV'LJLWDOHV´ Una ciudad digital es, fundamentalmente, una ciudad conectada en red, dentro de su área urbana y zonas aledañas, permitiendo la conexión total tanto en su interior como hacia el exterior. Los avances tecnológicos posibilitan hoy establecer un ámbito urbano de conexión permanente, donde los ciudadanos, las empresas y el sector público pueden mantenerse comunicados entre sí o fuera de los límites de la ciudad a través de Internet. Las tecnologías inalámbricas de banda ancha y los distintos dispositivos portables, a su vez, incorporan movilidad a las conexiones, lográndose una mayor libertad de uso. En síntesis, la ciudad digital supone estar conectados siempre en cualquier lugar, permitiendo la modernización organizativa de la ciudad, un avance hacia la Sociedad de la Información y un nuevo concepto de ciudadanía. Para esto, Motorola posee un portafolio de productos que abarca desde la infraestructura y los equipos de red, hasta los dispositivos móviles utilizados por el usuario final (radios, celulares, computadoras móviles) y sistemas de seguridad pública, como por ejemplo videovigilancia a través de cámaras controladas a distancia de forma inalámbrica. Teniendo en cuenta este escenario, a principios de 2008 Motorola identificó como primera necesidad mejorar su posición en cuanto al reconocimiento de marca relacionado con este portafolio de productos tecnológicos destinados a la digitalización de ciudades. Además, la compañía descubrió una segunda necesidad: mejorar la visibilidad, posicionamiento y reconocimiento de estos productos dentro del sector de municipalidades, algo que había logrado con buenos resultados entre otros segmentos de clientes, como es el caso de gobiernos provinciales y nacionales. Por tanto, en síntesis, el desafío principal era lograr un buen posicionamiento frente a potenciales clientes provenientes del segmento de municipalidades. Y en segundo lugar alcanzar un buen posicionamiento de la marca en el segmento de productos de comunicación y movilidad para gobiernos y seguridad pública Frente a estos desafíos, y luego de un extenso análisis interno, Motorola diseñó un plan integral de branding y comunicación, denominado Campaña de Ciudades Digitales. El plan estuvo integrado por una gran variedad de acciones de comunicación, entre las que se destacó el lanzamiento de un ranking a nivel de América Latina denominado Ranking Motorola de Ciudades Digitales, apoyado por otras acciones como el desarrollo de contenido editorial para medios, infografías, Casos de Éxito, artículos, columnas de opinión y otros documentos, además de la presencia de oradores en eventos de la industria y tradeshows, presencia en la Web, comunicados de prensa y entrevistas con voceros de la compañía, entre otras acciones. A quiénes queríamos hablarles y qué queríamos decirles Una de las complejidades que presentó la campaña fue que debía apuntarse a diversos públicos target, y desde diferentes ángulos. La campaña tenía cómo público objetivo principal a los potenciales clientes, es decir, las municipalidades de los distintos países de América Latina. Pero para ello debía alcanzarse a las autoridades públicas y decisores de compra de tecnología de los municipios, lo que representaba un desafío adicional. Un segundo objetivo fue llegar a cierto nivel calificado de la opinión pública, sobre todo líderes de opinión, que pudiesen explicar a las diferentes administraciones municipales de los beneficios que significa habitar en una ciudad digital. Y, por supuesto, además de ser una herramienta para llegar con el mensaje al público target, los medios de comunicación fueron, en sí mismos, uno de los principales públicos objetivos, aunque enfocando las acciones de comunicación para los medios más afines: Medios verticales como municipalidades y gobierno, salud y educación ‡ Medios empresariales ‡ Medios especializados en tecnología ‡ Bloggers de las áreas mencionadas Cómo hicimos lo que hicimos Una vez que, exhaustivo análisis interno mediante, se determinó cuál era el escenario, cuáles eran los mensajes que debían ser transmitidos y el público objetivo a quién debía dirigirse, se elaboró la estrategia, que estuvo signada por dos elementos clave: por un lado, la creación y lanzamiento del Ranking Motorola de Ciudades Digitales y todas las acciones de comunicación que rodearon ese proyecto y, por otro lado, las tácticas de comunicacióQ LPSOHPHQWDGDV SDUD ORJUDU TXH HO WpUPLQR \ HO FRQFHSWR ³FLXGDG GLJLWDO´ VHD
relacionado con Motorola por el público objetivo. Como resultado, el plan de Ciudades Digitales abarcó una serie de variadas acciones con foco principal en relacionamiento con los medios, y tácticas complementarias de relaciones públicas y diversos tipos de documentos de comunicación que, en su conjunto, respondieron a una estrategia diseñada para tener un doble enfoque: una estrategia regional y una estrategia por país. La puesta en marcha del plan consistió en una doble acción de tácticas de relacionamiento con los medios y tácticas de relaciones públicas. Para ello se recurrió al envío constante de información para vincular a la marca al concepto de ciudades digitales, la gestión de entrevistas con medios de información general, tecnología y economía y negocios, encuentros informales con periodistas, entrevistas one-­to-­one con periodistas de medios tier one y el envío de cartas a los principales municipios para estimularlos a inscribirse al Ranking Motorola de Ciudades Digitales, entre otras acciones. El Ranking Motorola de Ciudades Digitales fue la principal acción de comunicación del plan, en torno de la cual giró gran parte de la estrategia. El Ranking fue un estudio desarrollado por Convergencia Research bajo encargo de Motorola, con el objetivo de relevar el avance de digitalización en las ciudades de América Latina.. Para lograr mayor visibilidad a nivel regional, se determinó que el estudio incluyera a todas las ciudades de América Latina que deseaban participar del proceso de evaluación del nivel de digitalización. El estudio se realizó en dos etapas. La primera fase, realizada entre octubre de 2008 y febrero de 2009, tenía como objetivo medir los niveles de digitalización a partir de los esfuerzos realizados por parte de la administración pública de los distintos municipios. Un total de 150 ciudades de toda la región se registraron en el ranking. A partir de los resultados de esta primera etapa se clasificaron a las ciudades en ciudades digitales líderes, avanzadas, intermedias e iniciales. Las 25 ciudades líderes pasaron a una segunda etapa de análisis en la que se identificó a la ciudad más digital de América latina y se elaboró el ranking, según el puntaje obtenido por cada municipio finalista en virtud de las variables evaluadas. Cómo comunicamos el Ranking Motorola de Ciudades Digitales Para lo referente a la comunicación del Ranking Motorola se decidió realizar una separación temporal de las actividades, divididas en acciones previas, durante y posterior para cada una de las dos etapas del estudio. Por lo tanto, fueron desarrolladas en primera instancia acciones y materiales para el pre-­
lanzamiento, lanzamiento y mantenimiento posterior del lanzamiento del ranking. Y finalmente actividades y documentos pre-­anuncio de los ganadores del ranking, anuncio de ganadores y mantenimiento posterior. El Ranking Motorola tuvo una importancia estratégica central dentro de la campaña de comunicación de Ciudades Digitales. El objetivo era, a través de este estudio, lograr visibilidad a nivel regional, asociación GHODPDUFD0RWRURODDOFRQFHSWRGH³FLXGDGGLJLWDO´\HODFHUFDPLHQWRGHODFRPSDxtDDVXS~EOLFRFODYH\
potenciales clientes: las municipalidades y municipios de América Latina. Cada uno de los distintos documentos de comunicación elaborados para el Ranking Motorola fue pensado con un objetivo puntual. Los comunicados de prensa fueron desarrollados con el objetivo de enviar información relevante, fomentar la inscripción de los municipios, lograr una amplia visibilidad a nivel regional y obtener una cantidad relevante de publicaciones. Las columnas de opinión y los artículos de interés, por su parte, fueron elaboradas con el objetivo puntual de lograr publicaciones de mayor calidad, con un profundo nivel de información acerca del estudio y de las ciudades digitales. Asimismo, los diferentes artículos de prensa y columnas de opinión fueron ideadas de manera tal de abordar la temática en dos niveles de información: con foco en medios especializados, con información más técnica;; y con foco masivo, con un nivel de información más adecuado para el entendimiento del público en general. Además de los materiales de comunicación elaborados para divulgación, fueron realizados otros documentos para uso interno de Motorola, como ser una plataforma de mensajes clave de la campaña y preguntas y respuestas (Q&A) para voceros. El objetivo de estos materiales fue la unificación de los mensajes a ser transmitidos por parte de los voceros de Motorola en sus contactos con la prensa y demás audiencias clave. También fueron diseñados slides de Power Point sobre las distintas etapas del Ranking Motorola para voceros, con el objetivo de ser utilizado en presentaciones y eventos regionales. Nuestro calendario de actividades Para dar inicio al plan, se desarrolló un calendario de actividades que integró las acciones de comunicación, relacionamiento con los medios y las iniciativas de relaciones públicas. En primera instancia, en la etapa previa al lanzamiento del Ranking Motorola se realizó un anuncio pre-­lanzamiento, para generar expectativa, despertar el interés del público en general, y lograr una amplia visibilidad en los medios. Adicionalmente se enviaron cartas a los municipios para motivar la inscripción de los mismos y se puso on-­line una página Web exclusiva del Ranking Motorola, con información, bases de participación y la posibilidad de iniciar la inscripción on-­line. Luego del lanzamiento del ranking, con el objetivo de mantener el interés y la visibilidad del estudio en los medios, se realizaron diversos anuncios, entre ellos el número de ciudades inscriptas a nivel regional y las ciudades inscriptas por cada país participante;; esto último en coordinación con las distintas agencias de prensa de Motorola en la región para lograr un resultado de publicación más certero. Además, se desarrolló un listado completo de las ciudades inscriptas para envío como material adicional a la prensa. Siguiendo una lógica similar, de estrategia regional y por país, en una segunda instancia se comunicó mediante anuncios cuáles fueron las ciudades finalistas del ranking a nivel regional y un anuncio local destacando el número de municipios clasificados para la segunda etapa del estudio en cada país, también con trabajo coordinado con las diferentes agencias. Además de los anuncios ya mencionados, la primera etapa del calendario contó con la elaboración de materiales extras, con el objetivo de mantener el tema en la agenda de los medios, dar a conocer de qué se trata una ciudad digital, lograr la asociación de Motorola con el término y continuar con un alto nivel de visibilidad del ranking. Se realizaron entonces artículos de interés general, bajo diferentes enfoques, como por ejemplo la mejora el sistema de salud en las ciudades digitales, o la reducción de los índices de inseguridad mediante la digitalización de municipios. Además se realizó en esta primera etapa un artículo, con foco regional y de interés general, que reflejaba los resultados principales del estudio hasta el momento, bajo el título: Panorama de la digitalización de ciudades en América latina. También, aprovechando instancias electorales en Argentina, se elaboró una columna de opinión a nivel local con el título: La digitalización de ciudades, una propuesta ausente en estas elecciones. De esa manera se aprovechó un momento coyuntural para dar visibilidad a la campaña de comunicación. Adicionalmente se desarrollaron materiales para voceros: PPT con los mensajes más relevantes de la primera etapa del estudio, para ser utilizado en presentaciones y eventos regionales y para unificar el mensaje por parte de Motorola;; Key Messages y Q&A. Para la segunda etapa, también se implementó una separación temporal de las acciones, divididas en pre-­
anuncio, divulgación de los resultados del Ranking Motorola de Ciudades Digitales y tácticas de mantenimiento posterior. Además, durante esta etapa se intensificó el desarrollo de materiales específicos para cada uno de los países de la región a fin de lograr un mayor impacto en publicaciones. Además se efectuaron anuncios de los resultados del Ranking por país, tomando los 7 principales mercados de la región, para aprovechar la tarea de las diferentes agencias de prensa de Motorola a nivel regional. Estos anuncios hacían foco en alguna característica diferencial que mostrara cada país tras la HYDOXDFLyQ GH OD SULPHUD HWDSD GHO HVWXGLR FRPR SRU HMHPSOR ³/RV PXQLFLSLRV DUJHQWLQRV ILQDOLVWDV GHO
Ranking Motorola de Ciudades Digitales muestran diferHQWHVHVWUDWHJLDVGHGLJLWDOL]DFLyQ´R³%UDVLODSXQWD
DOEHQHILFLRGHVXVFLXGDGDQRVFRQODGLJLWDOL]DFLyQGHODVFLXGDGHV´ Por otra parte, se crearon una serie de anuncios basados en información relevante proveniente del estudio del Ranking Motorola. De esta manera se consiguieron publicaciones regionales con eje en el ranking, pero KDFLHQGRIRFRWDPELpQHQHOFRQFHSWRGH³FLXGDGGLJLWDO´DVRFLDGRFRQODPDUFD0RWRUROD3RUHMHPSOR³(O
70% de las ciudades inscriptas en el Ranking Motorola de Ciudades Digitales posee planes de conectividad SDUDIRPHQWDUODLQFOXVLyQGLJLWDO´ Esta segunda instancia de comunicación estuvo marcada por la aparición de nuevos materiales adicionales. Se destacan las infografías y los Casos de Éxito, que fueron utilizados como una forma de mantener la visibilidad del tema en los medios. Entre los Casos de Éxito se pueden citar como ejemplo a Santa Marta y Ciudad de Dios (Brasil), los municipios de Marcos Paz, Campana y Berazategui (Argentina) y Aguas Calientes, Veracruz y Boca del Río (México), entre otros. Las infografías fueron desarrolladas para lograr principalmente el interés de los medios gráficos, y en segundo lugar los medios on-­line. Fueron acompañadas de textos explicativos que informaban: qué es una ciudad digital, los beneficios de una ciudad digital, cómo se conecta una ciudad digital y el portafolio de productos que permiten lograr una ciudad digital, entre otros. El desarrollo de las infografías fue pensado para tener un esquema gráfico explicativo de una ciudad digital. Sin embargo, la estrategia fue ampliada y llevada a casos prácticos locales por diferentes países, con el objetivo de llamar el interés y lograr publicaciones de calidad en cada país. Para estos casos, se realizó una infografía sobre la ciudad capital o ciudad más representativa de varios países de América Latina, mostrando gráficamente un sector, edificio, o monumento reconocido y característico de dicha ciudad. Además de la infografía de una ciudad tipo, se realizaron una para cada una de las ciudades relevantes: Buenos Aires (Argentina), Bogotá (Colombia), Caracas (Venezuela), Ciudad de Guatemala (Guatemala), Lima (Perú), México D.F. (México), Quito (Ecuador), San Juan (Puerto Rico), San José (Costa Rica), San Pablo (Brasil), Santiago de Chile (Chile), dando como resultado la elaboración de 12 infografías. La gestión con los medios de estas infografías fue muy exitosa, ya que despertó un gran interés en cada uno de los países. Como resultado se obtuvieron publicaciones de calidad en los medios más reconocidos de cada país. ,QIRJUDItD³%XHQRV$LUHV'LJLWDO´ Tras la finalización de los anuncios correspondientes al Ranking Motorola de Ciudades Digitales, se realizó una serie de materiales de divulgación como corolario de la acción. Fue elaborado un artículo de interés general: Panorama de la digitalización de ciudades en América Latina, una columna de opinión: Reducir la brecha digital: una materia pendiente en América Latina y una crónica imaginaria de cómo sería un día en la vida de un habitante de una ciudad digital en América Latina. Y como apoyo a las publicaciones fue desarrollado un resumen ejecutivo del estudio, con los datos principales disponibles para la prensa. La segunda y última etapa de la campaña de Ciudades Digitales también contó con materiales de comunicación para voceros: documento en formato .ppt con los mensajes más relevantes del estudio para ser usado en presentaciones y eventos, Key Messages y Q&A para mantener la cohesión del mensaje de Motorola. Finalmente fueron elaborados materiales para relaciones públicas, que incluyó: ‡ Carta de agradecimiento y felicitaciones a las ciudades finalistas del ranking ‡ Carta de agradecimiento a todas las ciudades inscriptas en el ranking ‡ Libro sobre los resultados del Ranking Motorola de Ciudades Digitales Los resultados de la campaña de Ciudades Digitales fueron ampliamente satisfactorios. En total, en lo que respecta al Ranking Motorola, fueron enviados 22 anuncios y 12 infografías que, junto a artículos y columnas de opinión, lograron un alto impacto en los medios y en los potenciales clientes. Gracias a la amplia visibilidad obtenida con las publicaciones, fueron inscriptos voluntariamente 150 municipios de 15 países de América Latina para participar del estudio. En los medios, por su parte, fueron gestionadas 142 entrevistas y se obtuvieron 1.245 publicaciones desde el comienzo de la campaña de Ciudades Digitales, en octubre de 2008 hasta octubre de 2009. 2008 2009 Total Publicaciones 231 1054 1.285 Entrevistas 54 88 142 142 entrevistas gestionadas Campaña Ciudades Digitales -­ Entrevistas por Quarter 08/09 1.285 publicaciones obtenidas desde el comienzo de la campaña de comunicación Campaña Ciudades Digitales -­ Publicaciones por Quarter 08/09 Cantidad de publicaciones totales por país Campaña Ciudades Digitales -­ Total Clipping por país Otro de los excelentes resultados obtenidos mediante la campaña de Ciudades Digitales puede cuantificarse a través de una encuesta de aplicación telefónica anónima, en la cuál se evaluó el UHFRQRFLPLHQWRGHPDUFDDVRFLDGRDOWpUPLQR\DOFRQFHSWRGH³FLXGDGGLJLWDO´/RVGDWRVDUURMDGRVLQGLFDQ
TXHHOGHORVHQFXHVWDGRVFRQRFHQHOWpUPLQR³FLXGDGGLJLWDO´\DOFRQVXOWDUVREUHODVWUHVHPSUHVDV
que vinculan a ese concepto 87,5% lo vinculó a Motorola. Además, el 50% de los encuestados mencionó a Motorola como primera opción. En segunda instancia, 43,7% de los encuestados vinculó el concepto con el principal competidor de Motorola en el segmento. Casi un 40% de los encuestados no pudo mencionar una WHUFHUD PDUFD UHODFLRQDGD FRQ HO FRQFHSWR ³FLXGDGGLJLWDO´ORTXHLQGLFDHOH[FHOHQWHSRVLFLRQDPLHQWRGH
Motorola como resultado de la campaña de comunicación. El Ranking Motorola de Ciudades Digitales también fue un éxito en sí mismo. Además de la participación de 150 municipios provenientes de 15 países de América Latina que se inscribieron voluntariamente hay, desde la finalización del estudio, consultas permanentes de nuevos municipios mostrando la intención de inscribirse a una posible segunda edición del ranking. Además, a través de la encuesta telefónica anónima se puede cuantificar la relevancia del estudio: 82% de los encuestados declaró conocer el Ranking Motorola de Ciudades Digitales. Esta cifra es la misma que logró un estudio similar del principal competidor de Motorola (el Barómetro Cisco). El 82% de los consultados dicen conocerlo, con la diferencia de que el Barómetro lleva más de cinco años de publicación. Esta comparación muestra también la eficiencia de la campaña de comunicación. En conclusión, la campaña de comunicación de Ciudades Digitales logró cumplir con los dos principales objetivos impuestos. El primer desafío era lograr un buen posicionamiento y reconocimiento de marca frente al público clave de la campaña: las municipalidades. Y en este sentido la campaña le permitió a Motorola obtener una alta visibilidad en los medios de toda la región y posicionarse en el sector de municipalidades con su amplio portafolio de productos, logrando alcanzar la misma posición ya lograda entre gobiernos nacionales y provinciales. Es mucho más meritorio el número de publicaciones obtenidas si se tiene en cuenta que la temática no corresponde a un producto, área o industria de consumo masivo. Por otra parte, el segundo desafío era lograr un buen posicionamiento de la marca en el segmento de productos de comunicación y movilidad para gobiernos y seguridad pública. La cantidad de inscriptos en el ranking y el acercamiento proactivo de municipios de América Latina hacia Motorola demuestra la concreción en la práctica del desafío que imperaba. A su vez, la búsqueda en Google del concepto ³5DQNLQJ GH &LXGDGHV 'LJLWDOHV´ DUURMD PLO UHVSXHVWDV PLHQWUDV TXH HQ <DKRR VH DFHUFD D ORV millones. Por otra parte, a WUDYpVGHHVWHSODQGHFRPXQLFDFLyQ0RWRURODORJUyWDPELpQ³DSURSLDUVH´GHOFRQFHSWRGH
Ciudades Digitales, logrando que el público clave de la compañía relacione el término con Motorola y su SRUWDIROLRGHSURGXFWRV(OFRQFHSWR³FLXGDGGLJLWDO´ORJUyLPSonerse e implantarse en los medios gracias a HVWDDFFLyQGHVSOD]DQGRDRWURVFRQFHSWRVVLPLODUHVTXHHVWDEDQHQGDQ]DSUHYLDPHQWHFRPRVHU³FLXGDG
LQWHOLJHQWH´ ³FLXGDG WHFQROyJLFD´ R ³WHFQySROLV´ 2WUDV HPSUHVDV FRPSHWLGRUDV KDQ DGRSWDGR HVWH
concepto o JHQHUDGRDOWHUQDWLYDVUHDFWLYDVFRPRFLXGDGHV³LQWHOLJHQWHV´RVLPLODUHV Finalmente, el Ranking Motorola de Ciudades Digitales se convirtió en un estudio referente del segmento de tecnología a nivel regional, siendo reconocido por los medios, los periodistas, el público target de la compañía y sus potenciales clientes. PREMIOS EIKON 2010 Categoría: Comunicación en Situación de Crisis Caso: Plan de Comunicación para la Respuesta a la Emergencia en Haití. Empresa: UNICEF Integrantes: Por UNICEF: Matias Bohoslavsky, Asistente de comunicación;; Jennie Renstrom, Pasante de comunicación;; María José Ravalli, Responsable del área de comunicación;; Martín Giménez Rébora, Responsable de Movilización de Recursos Introducción 1. Información Institucional UNICEF trabaja en Argentina desde 1985, brindando asistencia técnica y financiera al Estado y la sociedad de Argentina en diversas áreas relacionadas con el bienestar de los niños, niñas y adolescentes en el país. Conforme a los principios de la Convención sobre los Derechos del Niño (CDN), la Convención sobre la Eliminación de todas las formas de Discriminación contra la Mujer (CEDAW), todos los tratados sobre derechos humanos ratificados por la Argentina y los Objetivos de Desarrollo del Milenio (ODM), UNICEF trabaja para promover la protección de los derechos de los niños, niñas y adolescentes, la satisfacción de sus necesidades y el aumento de las oportunidades de las que disponen, a fin de apoyar el pleno desarrollo de sus capacidades. 2. Identificación del problema El 12 de enero de 2010, un terremoto de 7.0 grados de magnitud devastó la isla de Haití, una de las naciones más pobres del hemisferio occidental, causando más de 220.000 muertos y más de 300.000 personas heridas. El terremoto en Haití afectó a casi 1,5 millones de niños y niñas de entre 1 a 18 años de HGDGSRUHQGHFRQVWLWX\y³XQGHVDVWUHSDUDODLQIDQFLD´ El terremoto en Haití fue una de las mayores catástrofes a nivel global. Esta situación afectó directamente a Naciones Unidas ya que cientos de sus empleados murieron durante la tragedia, su instalaciones quedaron devastadas y las comunicaciones interrumpidas (anexo 1). Inmediatamente después del terremoto, comenzaron a llegar decenas de llamados a UNICEF Argentina para recibir información y explorar como se podía colaborar. Para atender esta situación, se estableció un plan para informar a la población acerca de la situación en Haití y canalizar la participación social. A continuación se describe las acciones enmarcadas dentro del plan de comunicación y se detallan brevemente algunos aspectos del plan de movilización de recursos. 3. Objetivos Los objetivos para el plan fueron: ‡ Aumentar la concientización de la sociedad argentina sobre las necesidades y derechos de los niños, niñas y adolescentes en Haití. ‡ Fortalecer la relación con líderes de opinión y periodistas claves y brindar información actualizada acerca de la situación de los niños, niñas y adolescentes en Haití. ‡ Convertirse en un canal de participación social ‡ Canalizar la solidaridad argentina individual y empresarial, en función de las necesidades de UNICEF (ayuda monetaria ± prioridades definidas en terreno) en dos etapas (reactiva y proactiva). 4. Público objetivo El público objetivo fueron los medios de comunicación líderes;; el público general;; donantes y empresas del sector privado. 5. Mensajes Clave Durante la primera semana, los mensajes clave se orientaron a evidenciar la situación de los niños : ‡ Esta es una emergencia con rostro infantil;; casi el 40 por ciento de los haitianos tiene menos de 14 años de edad. Son muchos los niños y niñas que están en riesgo. ‡ Los niños, niñas y adolescentes son nuestra prioridad número uno. Es necesario que se los encuentre, se los alimente, se los mantenga a salvo y con vida. ‡ UNICEF está llegando a los niños, niñas y adolescentes en Haití con apoyo vital. ‡ El terremoto en Haití es un desastre doble ± reconstruir mejorando lo anterior es un desafío humanitario. La segunda semana, cuando la cobertura se centró en el tema de adopciones, los mensajes claves estuvieron orientados a informar nuestro posicionamiento basado en la experiencia en situaciones de emergencia: ‡ Ante la angustia que producen las imágenes de niños heridos o abandonados es inevitable pensar en otro tipo de alternativas, como la guarda o la adopción. Sin embargo, en los más de 60 años de experiencia de UNICEF constatamos que alejar a los niños de su entorno en este momento no los favorece, y puede aumentar aún más su aflicción, obstaculizando la recuperación. Muchos de esos niños tienen padres, madres u otros familiares que pueden hacerse cargo de ellos en un entorno más cercano que los comprenda. Por HVR OD JXDUGD R OD DGRSFLyQ IRUPDQ SDUWH GH ORV GHQRPLQDGRV ³FXLGDGRV DOWHUQDWLYRV´ GHVWLQados a aquellos niños que no tienen ninguna posibilidad de reencontrarse con sus familiares. Esos procesos deben garantizar siempre el interés superior del niño y respetar los controles y estándares internacionales. Los casos que se iniciaron previamente al terremoto requieren un tratamiento particular que permita acelerar el proceso, sin dejar de cumplir con las normas legales. Ejecución 6. Estrategia: Pasos y Procesos El primer paso fue organizar y establecer prioridades para el contacto con los medios. El segundo, fue realizar dos entrevistas en TV en TN y Telenoche (anexo2) y una entrevista en radio (Continental), para instalar la situación de la infancia en la emergencia y posicionar nuestro mensaje. Estas entrevistas contribuyeron a posicionar a UNICEF como una institución vocera de la situación en Haití. El resultado fue una respuesta masiva de diversos canales de TV, radios, agencias, diarios y revistas, etc. Los canales de TV y las radios de todo el país llamaban para obtener más información acerca de la crisis. En forma constante se realizaban entrevistas en profundidad, en vivo y grabadas para la TV. El tercer paso fue difundir a los medios actualizaciones diarias y evitar la repetición. El rol de UNICEF era destacar la situación de los niños, niñas y adolescentes en Haití y posteriormente informar acerca del trabajo qué estaba realizando en terreno. También se generaron entrevistas con personal de UNICEF en terreno. Una de las primeras personas en ser enviadas a Haití, fue una especialista en comunicación argentina, esta situación permitió generar numerosas entrevistas telefónicas contadas desde la perspectiva de una compatriota. Aproximadamente a un mes de la catástrofe los medios argentinos redujeron su interés en el tema, para revertir esta situación se proveyó acceso a información de actualidad, historias de vida, voceros en terreno y material audiovisual, entre otros. Para julio de 2010, está previsto realizar una visita con una figura reconocida a nivel internacional y acompañarla con medios argentinos. En relación a las acciones de fundraising (recaudación de fondos), se estableció una estrategia en 2 etapas reactiva y proactiva. En la primera, se prepararon mecanismos eficientes para recibir solicitudes espontaneas de donación (adaptación del centro de atención telefónica, adaptación de mecanismos administrativos (cuenta bancaria, etc.), análisis de propuestas y apoyo para la realización de eventos solidarios. En la proactiva, se hizo uso de mecanismos ágiles y económicos de comunicación (uso de medios masivos para difusión de teléfonos, prensa, emailings y llamados a donantes, acciones de marketing digital) para obtener donaciones de individuos y empresas del sector privado. 7. Ajustes durante la implementación El 22 de enero, se llevó a cabo una conferencia de prensa en el Palais de Nation en Suiza, donde un miembro de UNICEF declaró que 15 niños habían sido raptados en Haití. Esta declaración puso de manifiesto la vulnerabilidad de los niños, niñas y adolescentes en Haití y transformó radicalmente la cobertura. El tráfico de bebés y las adopciones internacionales se convirtieron en temas recurrentes en los medios de comunicación. UNICEF proactivamente contactó a los medios argentinos para comunicar su posicionamiento al respecto. Este posicionamiento (es necesario esperar para iniciar nuevos procesos de adopciones) se basa en años de experiencia y en los potenciales riesgos a los cuales se expone a los niños al impulsar procesos de adopción internacionales indiscriminadamente, los cuales son aprovechados por las redes de tráfico de personas. UNICEF Argentina, buscó informar a periodistas claves y transmitir esta información a la opinión pública, ya que es central que la sociedad esté informada y no exista una demanda. Al mismo tiempo se contactó con la Cancillería y se emitió un comunicado conjunto respecto de las leyes argentinas en torno a las adopciones internacionales. (anexo 3) UNICEF respondió vía email, teléfono, call center y personalmente las preguntas del público en relación a las adopciones. Asimismo recibió a padres cuyos trámites de adopción estaban en curso e informó públicamente su apoyo para acelerar los procesos de las adopciones oficiales en curso. 8. Acciones realizadas Medios de comunicación Entrevistas en radio: Víctor Hugo Morales, Magdalena Ruiz Guiñazú, Marcelo Zlotogwiazda, Virginia +DQJOLQ /XtV 0DMXO &KLFKH *HOEOXQJ 0DUtD 2¶'RQHOO 0RQD 0RQFDOYLOOR *RQ]iOHV 2UR 0yQLFD \ &pVDU
Alfredo Leuco y Eduardo Anguita, entre otros . Entrevistas en TV: TN, Canal 13, C5N, Canal 7, Canal 26, Crónica y América TV. Programas de TV: UNICEF también participó en programas vespertinos de TV para informar y abarcar un público más amplio. Viviana Canosa, Puro Show, El Diario de la Tarde, Infama, entre otros. Medios gráficos: UNICEF brindó a los medios gráficos información actualizada en forma constante. Medios globales emitidos en Argentina: se realizaron varias entrevistas con CNN (Larry King, Anderson Cooper, Cristiane Amanpour, entre otros), CNN en español, ANSA, entre otros. Teletón por TV: Como resultado de una negociación con el canal local C5N, el público argentino pudo ver y SDUWLFLSDUHQ ODJDODGH UHFDXGDFLyQ GH IRQGRVLQWHUQDFLRQDO³+RSHIRU+DLWL´8QDHVSHUDQ]DSDUD+DLWt
C5N emitió el teletón y colocó en su pantalla los números locales de teléfono para colaborar. (anexo 4) Web e Internet Sitio Web de UNICEF: se actualizó todos los días con información, fotos y videos de historias in situ. (anexo 5) Banners: UNICEF adaptó una propuesta creativa donada por una pequeña agencia de diseño para crear XQDFDPSDxDGHGRQDFLyQDWUDYpVGHEDQQHUVFRQHOPHQVDMH³¢TXH+$,GH7,"´DQH[R Redes sociales: A través de las diversas redes sociales en la que participa UNICEF, se actualizó la información sobre la emergencia. Los Hermanos de MDQ grabaron un spot en video que fue difundido por internet, e-­mail y publicado en su página de Facebook, la cual tienen 200000 miembros. Además, publicaron actualizaciones diarias acerca de la situación en Haití lo que generó una gran retroalimentación. Manu Ginobili, Julieta Venegas, Ricardo Montaner actualizaron sus twitter difundiendo información sobre la situación de la infancia en Haití. (anexo 7) Celebridades Spots: Los Embajadores regionales de UNICEF, Julieta Vanegas y Diego Torres participaron en un Anuncio de Interés Público (PSA) hablando acerca de la situación de los niños, niñas y adolescentes en Haití y solicitando donaciones. (anexo 8) Mensaje en audio: El Embajador de UNICEF y jugador de la NBA, Manu Ginóbili, realizó grabó un mensaje en audio con su iphone desde Estados Unidos solicitando donaciones para Haití. Este mensaje se envió a los contestadores automáticos de los teléfonos en colaboración con Telefónica y se pautó en distintas radios. El también incentivó las donaciones desde su facebook personal. Eventos de recaudación de fondos Opera Pampa: Se realizaron 2 funciones especiales de Opera Pampa a beneficio de UNICEF. Previo al inicio del evento, se realizaron entrevistas con América Televisión para continuar reforzando el posicionamiento de UNICEF Argentina sobre la situación en Haití. (anexo 9) Té: El Four Seasons Hotel organizó un té a beneficio de UNICEF. El evento contó con la participación de numerosas celebridades, entre ellas Griselda Siciliani y Carla Peterson, quienes realizaron una presentación, Nacha Guevara que leyó una carta desde Haití, Juan Darthes, Betiana Blum, Karina Mazzoco, Maby Wells, Rosella Della Giovampaola, quienes ayudaron con los sorteos. (anexo 10) Partido Boca-­River: Durante el clásico Boca-­River en enero, UNICEF ubicó carteles en el estadio para alentar al público a donar dinero para responder a la emergencia en Haití. Fox Sports también emitió una entrevista de 10 minutos en vivo con el representante de país, Andrés Franco, que fue vista por 2 millones de personas. Evaluación 9. Resultados Como resultado de la puesta en marcha de un plan de comunicación podemos aseverar que UNICEF pudo constituirse como un vocero de la situación de los niños y las niñas en Haití, y posicionar su mensaje respecto del tráfico y adopción internacional de niños. Teniendo en cuenta la demanda de información y voluntad de participación, UNICEF pudo establecer un canal de participación para la población argentina interesada en ayudar a la población haitiana, a través de las donaciones y la información. El plan de comunicación permitió establecer relaciones nuevas y más fluidas con diversos medios y líderes de opinión. También fortalecer relaciones existentes. La diversidad de medios que cubrieron el tema (anexo 11), desde noticieros de la noche a programas de la tarde, desde periódicos de gran penetración hasta radios locales, permitió tener una llegada directa a la opinión pública. Entre los principales resultados se observa que la cobertura de los medios aumentó un 4495% en enero de 2010 en comparación con el enero de 2009 (Anexo 12, cuadro 1). Durante enero, febrero y marzo de 2010 se mencionó a UNICEF y sus mensajes en 454 notas en radio, tv, gráfica y agencias. El valor estimado de los espacios generados fue: AR$6.740.596 (US$1.741.081) (Anexo 12, cuadro 2). Solo durante el mes de enero se generaron 80 para medios gráficos, 90 notas para radio y 46 notas para televisión (Anexo 12, cuadro 3, 4 y 5 respectivamente). El sitio web de UNICEF Argentina constituyó una de las principales herramientas para informar a la población. Durante enero de 2010 las visitas al sitio aumentaron un 600% en comparación con enero de 2009 . Las palabras clave por las cuales llegaron a nuestro sitio web también ayudan a entender el posicionamiento de UNICEF respecto de la situación de Haití. Aquellas personas que colocaban en un EXVFDGRUHOWpUPLQR³+DLWt´³7HUUHPRWRHQ+DLWt´³&RPRD\XGDUD+DLWt´³$\XGDD+DLWt´HQPiVGH
oportunidades eligieron a UNICEF para informarse sobre este tema (Anexo 12, cuadro 6). El pico de visitas en el sitio es el 22 de enero y se corresponde con la declaración respecto de los niños secuestrados en Haití (Anexo 12, cuadro 7). Todas estas estadísticas contribuyen a evaluar el rol de UNICEF como una fuente de información durante la emergencia. El sector de movilización de recursos de UNICEF recaudó ARS$4.350.080 , el 72% de esa recaudación corresponde a personas individuales. Este resultado da cuenta del rol de UNICEF como un canal de participación solidaria. A partir de estos resultados podemos observar los que objetivos establecidos en el plan de comunicación para la emergencia en Haití se alcanzaron. ANEXOS Anexo 1. Oficinas de UNICEF en Haití luego del terremoto. Anexo 2. Imágenes correspondientes a la primera nota de UNICEF en TN el día posterior al terremoto. Anexo 3. Comunicado conjunto entre UNICEF y el Ministerio de Relaciones Exteriores de la Nación. Anexo 4. Imágenes correspondientes a la transmisión del teletón realizada por C5N con mención a UNICEF Argentina. Anexo 5. Imágenes correspondientes al sitio web de UNICEF Argentina durante la emergencia. $QH[R&DPSDxDGH%DQQHU³4XH+$,GH7Ë"´ Anexo 7. Imagen del Facebook de MDQ y su referencia a la situación de la Infancia en Haití. Anexo 8. Imágenes de los spots de Diego Torres (http://www.unicef.org/argentina/spanish/media_16894.htm ) y Julieta Venegas (http://www.youtube.com/watch?v=0BZVtOQ_er0) Anexo 9. Programa de la Función Especial de Opera Pampa a beneficio de UNICEF. Anexo 10. Imágenes correspondientes al té a beneficio de UNICEF organizado por el Hotel Four Seasons. Anexo 11. Clipping de la cobertura de UNICEF Argentina durante la emergencia en Haití. Anexo 12. Análisis de la cobertura de UNICEF Argentina durante la emergencia en Haití. PREMIOS EIKON 2010 Categoría: Comunicación en Situación de Crisis Caso: Subtes: creación de un nuevo sindicato Empresa: Metrovías Agencia: Burson-­Marsteller Integrantes: Por Metrovías: Lucila Maldonado Por Burson-­Marsteller: Silvina Oberti, Mariano Gibaut, Guido Fita. Introducción A. La organización Metrovías S.A. es desde el 1° de enero de 1994 la empresa concesionaria de las Líneas del Subte de la Ciudad de Buenos Aires, el Premetro y la Línea Ferroviaria Urquiza, que en conjunto transportan anualmente más de 300 millones de pasajeros, el doble de lo que se transportaba en el inicio de la concesión. Más del 90% de las acciones de Metrovías son propiedad de Roggio SA. Metrovías lleva a cabo un importante plan de inversiones con fondos propios y del Estado Nacional que permiten una sensible mejora en la prestación del servicio a los pasajeros y en las condiciones laborales de sus empleados. Metrovías en números: ‡ 6 líneas de Subte, dos ramales de Premetro y 1 ramal de ferrocarril ‡ 1.500.000 de pasajeros por día ‡ 79,5 KM de extensión de red en toda la concesión ‡ 116 de estaciones distribuidas en su gran mayoría en la Ciudad de Buenos Aires ‡ 3.000 trenes despachados por día ‡ 40 millones de km recorridos por año ‡ 4.500 empleados ‡ 5 gremios: UTA (1948) y APSESBA (1969) en el Subte y Premetro;; La Fraternidad (18887), ASFE (1961) y Unión Ferroviaria (1922) en el ámbito del Ferrocarril Urquiza B. El problema por el cual se implementó eOSODQ³&UHDFLyQGHXQQXHYRVLQGLFDWRHQHO6XEWH´ El conflicto que se dirimió en el Subte entre septiembre y noviembre del 2009, fue un conflicto intra VLQGLFDO TXH WLHQH FRPR DFWRUHV SULQFLSDOHV D OD 8QLyQ 7UDQYLDULD $XWRPRWRU 87$ \ D XQ JUXSR GH ³ex GHOHJDGRV´GHODHQWLGDG&DEHGHVWDFDUTXHD~QHOWHPDQRIXHUHVXHOWR El conflicto surge a raíz de una situación originada por la escisión de una fracción de trabajadores que formaban parte de la UTA, único gremio representativo de los trabajadores del Subte y Premetro. El quiebre se produce a partir de la intención de conformar un nuevo sindicato, por parte de este grupo de ex delegados, denominado Asociación Gremial de Trabajadores del Subte y el Premetro (AGTSyP) -­aún no reconocido oficialmente-­. El conflicto se arrastra desde el año 2000, y alcanza en el 2009 su máxima escalada llegando a originar 54 situaciones conflictivas en el año (1 por semana), teniendo su punto álgido entre el 8 de septiembre y el 10 de noviembre, con 12 medidas de fuerza efectuadas en el lapso de 8 semanas. De esta manera, al sostener las situaciones conflictivas el grupo de ex delegados utiliza al Subte como escenario de exposición mediática para posicionar el reconocimiento de la AGTSyP (Asociación Gremial de Trabajadores del Subte y Premetro) como nueva entidad gremial. A través los siguientes argumentos: ‡ Aumento salarial ‡ Desacuerdos con promociones y cursos de capacitación a empleados pertenecientes a UTA ‡ Desacuerdo con suspensiones disciplinarias a empleados ‡ Agresiones a la familia de Néstor Segovia (allanamiento por desalojo) Bajo este contexto Metrovias no solo vio amenazada su reputación corporativa, sino también la posibilidad de brindar un servicio de transporte indispensable para el buen funcionamiento de la Ciudad. En consecuencia, durante la medidas de fuerza, asumió el compromiso con sus usuarios de prestar el servicio bajo un cronograma de emergencia con personal capacitado y con licencia habilitante, garantizando las máximas condiciones de seguridad. De esta manera, Metrovías acompañó el proceso con una permanente comunicación con sus usuarios acerca del estado del servicio y las causas de este conflicto. C. Objetivos Los objetivos planteados para llevar a cabo el plan de comunicación de crisis fueron: ‡ Minimizar el impacto de la situación conflictiva en la reputación de la empresa ‡ Evitar la escalada del conflicto ‡ Sostener el compromiso y responsabilidad con sus clientes: la prestación del servicio público de transporte subterráneo ‡ Repetir en todos los medios de comunicación las causas del conflicto intra sindical Bajo esta situación de crisis, la compañía asume como gran desafío acompañar desde la comunicación un conflicto que se desata en el seno del sindicato de la UTA. Conflicto que no puede resolver por no ser de su competencia, pero que la involucra al desarrollarse en el ámbito del Subte, afectando no solo al 1.500.000 de pasajeros diarios sino también al movimiento de la Ciudad. D. Públicos y mensajes La comunicación de crisis encarada por Metrovías estuvo dirigida a: ‡ Empleados ‡ Medios de comunicación ‡ Líderes de opinión ‡ Usuarios del subte ‡ Opinión Pública Cabe aclarar, que tanto las autoridades concedentes y regulatorias, así como los actores del conflicto gremial (UTA y ex delegados), fueron públicos indirectos abordados por la comunicación de la compañía. La estrategia de comunicación de Metrovías, se llevó adelante siguiendo los siguientes mensajes clave: ‡ ³6H XWLOL]D DO 6XEWH FRPR PHGLR SDUD UHVROYHU XQ FRQIOicto intra-­sindical, que consiste en la FUHDFLyQGHXQQXHYRVLQGLFDWR´ ‡ ³1XHVWUDPLVLyQHVWUDQVSRUWDUSDVDMHURV\UHDOL]DPRVWRGRVORVHVIXHU]RVSRVLEOHVSDUDORJUDUOR´ ‡ ³0HWURYtDVODPHQWDORVLQFRQYHQLHQWHVTXHVXIUHQORVSDVDMHURVSRUHVWDVPHGLGDV´ ‡ ³6H XWLOL]DDO 6XEWH SDUDGLULPLU XQ FRQIOLFWRJUHPLDOVLHQGRORVSDVDMHURVUHKHQHVGHXQDLQWHUQD
VLQGLFDO´ E. Canales de comunicación utilizados El manejo de la situación de crisis se sustentó en un plan de comunicación integral basado en los siguientes canales: Externos ‡ Medios de Comunicación: agencias de noticias, diarios nacionales, radios, TV y sitios digitales más visitados. En primera instancia, se llevó a cabo una estrategia de comunicación uno a uno dirigida a líderes de opinión y periodistas clave a fin de generar opinión bien informada sobre las causas y consecuencias del conflicto. En segunda instancia, ante cada medida de fuerza realizada, se redactó y envió un comunicado de prensa específico con la postura de la compañía frente a la problemática, la situación gremial, el estado del servicio y los respectivos cronogramas de emergencia . Paralelo a esto, a medida que el conflicto fue escalando protagonismo en los medios se gestionaron de manera proactiva entrevistas radiales y televisivas (priorizando los programas de TV y radio de mayor rating) con el objetivo de aclarar las situaciones sobre el desarrollo del conflicto y consolidar los objetivos planteados en el plan de crisis. En tal sentido, con el propósito de medir el cumplimiento del objetivo principal de comunicación, Metrovías encargó a Poliarquía Consultores dos estudios de opinión pública: el primero dirigido a sus pasajeros;; y el segundo al público general. De acuerdo a los resultados arrojados tanto los pasajeros como la opinión pública en general, entendieron que el origen y destino del conflicto era ajeno a la empresa, tratándose de una disputa por un espacio de poder en post de crear un nuevo sindicato. A fin de brindar información actualizada, cuanticualitativa de la problemática, Metrovías solicitó a Poliarquía un resumen del sondeo de opinión y lo envió a los medios. Por otro lado, ante el desarrollo de medidas de fuerza violentas, como la interrupción del servicio a través de personas arrojadas a las vías. Se aUPy \ HQYLy HQ ³RII´ D ORV SULQFLSDOHV PHGLRV GH FRPXQLFDFLyQ
gráficos, televisivos y digitales, un KIT de prensa conformado por videos in situ del conflicto, para evidenciar la modalidad con que se llevaban a cabo las medidas. Cabe destacar, que a fin de recibir una continua evaluación de la cobertura que los medios estaban otorgándole al tema, Metrovías solicitó a la consultora Ejes de Comunicación un análisis cuanticualitativo constante de la problemática. Por último, para posicionar de manera institucional la postura de la empresa, se publicaron 4 solicitadas en los principales diarios nacionales (Clarín, La Nación, Buenos Aires Económico, Ámbito Financiero, El Cronista, Crítica y Página 12), comprendiendo el periodo del 23 de septiembre al 11 de noviembre . ‡ Central de Tránsito Para proveer de información a los segmentos de tránsito de radios y televisión que se difunden cada media hora, se incrementó la frecuencia de comunicación con estos periodistas a través de la vía telefónica y el mensaje de texto. De esta manera se aprovechó el espacio para posicionar en la opinión pública la causa de afectación del servicio producida por el conflicto gremial. Propios Dado que el Subte es un medio de comunicación en sí mismo, en el marco de la crisis, se brindó a los pasajeros la información sobre el estado de servicio en forma permanente a través de los siguientes canales: ‡ Cartelería del Subte en andenes, pasillos y vestíbulos ‡ Sistema de audio en la línea afectada ‡ Carteles electrónicos en los accesos al Subte ‡ Placas con información de servicio en tiempo real en SubTV (circuito cerrado de TV) ‡ Línea 0800 del CAP (Centro de Atención al Pasajero) ‡ Sitio web institucional, mediante una actualización permanente e inmediata acerca del estado del servicio y refuerzo de difusión de comunicados de la situación ‡ Carteleras y comunicaciones internas a todos los empleados sobre el desarrollo del conflicto ‡ Línea abierta 24 horas Ejecución del Plan A. Descripción de los pasos y procesos Se trabajó en tres instancias: 1. Preparación para manejo de crisis La estrategia fue llevada adelante a través de las siguientes acciones: ‡ Monitoreo del issue: por medio de la información interna y el seguimiento de lo publicado en medios digitales y tradicionales, ‡ Definición de estrategias y mensajes clave, ‡ Planificación y anticipación de escenarios con distintos niveles de conflictividad y planes de acción, ‡ Mapeo de actores y relacionamiento con aquellos considerados clave, ‡ Entrenamiento en manejo de medios y situaciones críticas para todo el equipo, ‡ División de tareas y soporte de consultoras especializadas a la Gerencia de Relaciones Institucionales: ‡ PR y asuntos públicos: Burson-­Marsteller ‡ Monitoreo y análisis de medios tradicionales: Management Press + Ejes de Comunicación ‡ Monitoreo de medios digitales: Tercer Click ‡ Monitoreo legislativo: BLAPP ‡ Encuestas y estudios de Opinión Pública: Ipsos Mora y Araujo + Poliarquía Consultores 2. Manejo de la situación de crisis En cada uno de los casos de medidas de fuerza gremial que se enfrentaron, se pusieron en marcha estrategias orientadas a alcanzar el objetivo: a. Alinear la comunicación con los objetivos de negocios (no potenciar el conflicto) b. Informar sobre la naturaleza del conflicto y estado del servicio de modo permanente. A través de: I. Comunicados cada 30 minutos con el estado del servicio y el cronograma de emergencia. II. Información de prensa para explicar la naturaleza y el estado del conflicto. III. Publicación del estado de servicio actualizado en el sitio web corporativo, circuito cerrado de televisores del Subte (SubTV) y carteles electrónicos de acceso. IV. Contacto permanente con reporteros de transito de radios y TV. c. Comunicación proactiva in situ, cuando se vio afectado el servicio, a través de voceros especialmente seleccionados (Cristian Pérez y Marcelo Grazziano, jefes de Recursos Humanos). d. Puesta en evidencia de los motivos por las cuales no se pudo prestar el cronograma de emergencia. Se trata de videos y fotos de personas cortando vías y realizando actos de vandalismo sobre formaciones e instalaciones. 3. Día Después En cada jornada se efectuó un análisis y evaluación de los resultados alcanzados con el objetivo de corregir acciones y estrategias para afrontar la próxima situación de crisis sin desviar el objetivo. B. Ajustes que se introdujeron durante su implementación Dada la escalada mediática que alcanzó el conflicto, a raíz de las medidas de fuerza cada vez más violentas adoptadas por el grupo de ex delegados, Metrovías se vio obligada a adaptar su estrategia de comunicación hacia el cumplimiento de los objetivos planteados mediante: ‡ La exposición de distintos voceros de Metrovías y la intervención del grupo Roggio de acuerdo a la necesidad de cada situación. ‡ La decisión de dar visibilidad en medios a las obstrucciones de vías que se estaban realizando. ‡ Posicionar el desacuerdo de la mayoría de los empleados en contra de las medidas de fuerza, destacando que más del 60% de los empleados se presentó a sus puestos de trabajo durante el momento de conflicto. C. Dificultades encontradas y solución ‡ Uso del Subte como escenario para dirimir un conflicto, ajeno a la empresa, de origen intra sindical y no por un reclamo laboral. ‡ Amplísima exposición y cobertura de la Asociación Gremial de Trabajadores del Subte y Premetro (AGTSyP) con diversos ejes de discursos, incluyendo la responsabilidad de la empresa respecto de situaciones generadas por ellos, como la imposibilidad de prestar un cronograma de emergencia. ‡ Exposición de múltiples voceros por parte de AGTSyP. ‡ Acusación por parte de los ex delegados sobre la imposibilidad de prestar los cronogramas de emergencia establecidos, con la intención de afectar la imagen y reputación de la empresa. ‡ Demostrar que el Subte es un medio de transporte vulnerable ya que no se requiere montar una estructura compleja para afectar el servicio. Para abordar esta situación, sin potenciar el conflicto, se decidió mantener el foco en la comunicación de los mensajes clave, incorporando nuevos voceros desde la empresa y cuidando una innecesaria sobreexposición;; siempre apuntando a medios y programas clave para llegar a la opinión pública. Se decidió además, poner en evidencia que los sindicalistas impedían la operación del cronograma de emergencia con obstrucción de vías, y amenazas a los empleados que habían decidido trabajar. Evaluación A. Identificación, análisis y cuantificación de los resultados Logramos alcanzar los objetivos planteados en el manejo de la comunicación de crisis al posicionar en la opinión pública el concepto de que el conflicto dirimido en el Subte respondía a un disputa intra sindical ajeno a la empresa, en reclamo de la inscripción gremial para formar un sindicato nuevo en el Subte. En ese sentido, se identificaron claramente los actores intervinientes en la crisis: el gremio de la UTA y la Asociación Gremial de Trabajadores del Subte y Premetro (AGTSyP), quedando Metrovías como un actor ajeno a la problemática pese a que la crisis se desataba en el ámbito de la empresa. La estrategia de comunicación permitió llegar con nuestros mensajes clave a los públicos identificados, sin convertirnos en un actor que escalara el conflicto. Ésto fue posible porque tanto en los comunicados como a través de los voceros seleccionados, logramos mantenernos en el marco de los mensajes clave definidos, posicionando la postura de la empresa en lugares prioritarios pero sin pretender igualar la amplia exposición estratégica elegida por los actores del conflicto. De esta manera se logró producir el sensible equilibrio entre comunicar y posicionar el tema sin dimensionar la problemática. Esto último queda reflejado en el análisis realizado por Ejes de Comunicación, que evidencia: ‡ Del total de notas producidas en medios durante el conflicto, sólo el 14% de las entrevistas tuvo como protagonistas a voceros de Metrovías, ‡ Entre los dos gremios en conflicto sumaron más de un 84% (representantes de la ASTSyP realizaron un 74% de las notas y UTA un 8,5%) ‡ El porcentaje de las notas publicadas sobre el conflicto en las que no se mencionó a Metrovías fue de un 30%. B. Beneficios producidos por la puesta en marcha del plan comunicacional El plan de comunicación de crisis implementado permitió, a través de la imposición de mensajes clave en medios de comunicación y otros canales de información, resguardar a la empresa del impacto negativo que subyace en un conflicto intra sindical de gran exposición mediática, que colapsa el sistema de transporte en la Ciudad afectando la vida cotidiana de los ciudadanos. Esto se vio claramente reflejado en la percepción de la opinión pública respecto de las razones que motivan el conflicto. En ese sentido, los estudios de opinión que Metrovías encargó a Poliarquía Consultores en el mes de octubre y noviembre de 2009, arrojaron las siguientes conclusiones: ‡ El 70% de los ciudadanos afirma que el motivo de las interrupciones en el subte responden a paros y protestas gremiales. ‡ GH FDGD HQWUHYLVWDGRV FRQVLGHUD TXH OD ³FUHDFLyQ GH XQ QXHYR VLQGLFDWR´ HV OD UD]yQ SRU OD
cual se produce el conflicto en el Subte. ‡ El 58% cree que la representatividad de empleados en conflicto corresponde sólo a un grupo. ‡ El 80% está poco o nada de acuerdo con los métodos de protesta utilizados. PREMIOS EIKON 2010 Categoría: Comunicación de Identidad Corporativa Caso: Campaña de comunicación sobre la Misión, la Visión y los Valores de la compañía Empresa: Arcos Dorados Agencia: Grupo Oxean Integrantes: Por Arcos Dorados: Andrea Repetto, Alejandra Fehrmann, Directora de Comunicaciones Internas para América Latina y Caribe. A ± Introducción Acerca de la compañía: Arcos Dorados es el mayor operador de locales de América Latina y la mayor franquicia de la marca 0F'RQDOG¶V HQ HO PXQGR (V XQD HPSUHVD ODWLQRDPHUicana que opera más de 3.200 puntos de venta 0F'RQDOG¶VHQ$PpULFD/DWLQDFRQORFDOHVFHQWURVGHSRVWUH\0F&DIpGLVWULEXLGRVHQ
países y territorios (operando directamente en Argentina, Aruba, Brasil, Chile, Colombia, Costa Rica, Curazao, Ecuador, Guadalupe, Guayana Francesa, Martinica, México, Panamá, Perú, Puerto Rico, Saint Thomas, Saint Croix, Uruguay y Venezuela, e indirectamente, prestando consultoría a licenciados de la marca, en Bahamas, El Salvador, Guatemala, Honduras, Nicaragua, Paraguay, República Dominicana, San Martin, Saint Croix y Surinam). Con más de 100 mil empleados, sirve a más de 3,5 millones de clientes al día. Además de ser una de las cinco empleadoras más grandes de la región, Arcos Dorados es reconocida como una de las mejores empresas para trabajar en América Latina y una de las principales empleadoras de jóvenes en su primer empleo. La compañía también opera en el sector de logística por medio de Axis, presente con 7 centros de distribución en la Argentina, Chile, Venezuela y México, con 600 empleados y más de 100 clientes. Identificación de la problemática a resolver: 'HVGHTXH$UFRV'RUDGRVVHKLFLHUDDFUHHGRUDGHODPiVWHUIUDQTXLFLDGH0F'RQDOG¶VSDUD$PpULFD/DWLQD
y el Caribe (en agosto del 2007) la compañía experimentó un rápido proceso de expansión y regionalización. Surge entonces la necesidad de definir y comunicar una única identidad corporativa y la filosofía de la organización, que involucre y represente a todos. En síntesis, saber quiénes somos y quiénes queremos ser. Esto permitiría generar una fuerte identificación de las personas con Arcos Dorados y, a través de ésta, lograr que todos estén alineados detrás de los mismos objetivos. Cuando se comenzó a trabajar en la construcción y comunicación de la identidad se buscó representar lo mismo que genera la compañía en las regiones donde tiene presencia: regionalidad, a pesar de las distintas culturas e idiomas;; y localidad, aún cuando se maneja un negocio que no deja decisiones libradas al azar. Objetivos y lapsos: Desde la Argentina se planteó el objetivo inicial: definir la Misión, la Visión y los Valores de la compañía teniendo en cuenta que dicha información debía representar a todas las personas que conforman Arcos Dorados en América Latina. Una vez obtenida y definida esta información, comenzaría un nuevo desafío: comunicarla de forma tal que llegue en tiempo y forma a todo el personal de los distintos países y niveles de la compañía, logrando que la internalicen, la apliquen y a su vez la transmitan. Posteriormente, y como última y más importante acción comunicacional, se generaría un plan de comunicación integral que realizaría la bajada de esta información corporativa al mercado de Argentina. Los tiempos previstos para este proyecto fueron los siguientes: ‡ Octubre 2008-­ Marzo 2009: se realizó un trabajo de investigación y definición de la Misión, la Visión y los Valores con representantes de cada sector. ‡ Julio 2009: lanzamiento de la Misión, la Visión y los Valores a través del Webcast: un medio de comunicación con formato video en el cual el Presidente y CEO de Arcos Dorados, Woods Staton, presentó la nueva identidad corporativa. ‡ Julio-­ Diciembre 2009: implementación de la campaña de comunicación en la Argentina y preparado de una metodología para que el resto de los países siga el mismo curso. ‡ Enero-­ Diciembre 2010: lanzamiento de la segunda fase de la campaña. Etapa de internalización y profundización de la Misión, Visión y Valores. Públicos involucrados: Se trabajó con la totalidad del público interno de Arcos Dorados en todos sus niveles (etarios y jerárquicos) y sectores geográficos. Arcos Dorados tiene presencia en las provincias de Buenos Aires, Corrientes, Entre Ríos, Mendoza, Neuquén, Salta, San Juan, Santa Fe y Tucumán, tanto con locales propios como con franquiciados. Su público es muy disímil, diferenciándose especialmente el personal de los 188 locales y el staff de oficinas. La información debía surgir y llegar a todos los estratos de la compañía. Por eso, el proyecto implicó la elaboración de mensajes simples, directos y comprensibles para todos, además de ejemplos claros que cada empleado pudiera vivir en su día a día. Se desarrolló entonces una comunicación multi-­segmentada en función del público al que iba dirigida: -­ Crew (personal de locales) -­ Gerentes de local -­ Administrativos/Staff (Oficinas) -­ Niveles jerárquicos -­ Corporativos -­ Management Board B ± Ejecución del plan El plan de comunicación se llevó a cabo en 2 etapas: 1) Investigación, análisis de datos y definición de contenidos: Misión, Visión y Valores. 2) Aplicación del plan de comunicación en todo el país. Primera etapa: definición de Misión Visión y Valores Para obtener la información que daría forma a estos conceptos, se inició una Encuesta de Cultura Corporativa: investigación sobre la empresa y lo que la gente conocía y percibía sobre ella, realizando un intenso trabajo de casi un año basado en distintas técnicas de relevamiento de datos. Las mismas fueron implementadas en dos etapas en todos los países donde Arcos Dorados tiene presencia en la región: -­ Auditoría de la cultura corporativa con participación de Crew, Gerentes y Staff (cuestionario escrito) -­ Focus Groups con mandos medios de diferentes disciplinas/áreas (presencial/telefónico) -­ Workshops con las cuatro divisiones de Arcos Dorados: SLAD (Argentina, Chile, Colombia, Ecuador, Perú, Uruguay, Venezuela);; Brasil;; NOLAD (Costa Rica, México, Panamá);; Caribe (Aruba, Curaçao, Guyana Francesa, Guadalupe, Martinica, Puerto Rico, Saint Croix, Saint Thomas) y con el equipo corporativo. (presenciales) Se buscó definir la Misión, Visión y Valores de Arcos Dorados como parte fundamental y unificadora de su identidad corporativa, obteniendo dicha información a partir de la experiencia de los propios empleados, utilizando el feedback de la gente que forma parte de la empresa como herramienta de investigación. A partir de la información obtenida, se definieron los siguientes conceptos constituyentes de lo que es hoy la identidad corporativa de Arcos Dorados: Misión: Servir comida de calidad proporcionando siempre una experiencia extraordinaria. Visión: Duplicar el valor de la compañía ampliando el liderazgo en cada uno de los mercados (para el año 2014). Valores: -­ Brindamos calidad, servicio y limpieza a nuestros clientes. -­ Promovemos el espíritu emprendedor. -­ Tenemos un fuerte compromiso hacia nuestra gente. -­ Maximizamos la rentabilidad de nuestras operaciones. -­ Operamos el negocio en un marco ético y responsable. -­ Contribuimos con el desarrollo de las comunidades en las que operamos. Segunda etapa: aplicación del plan de comunicación en todo el país Una vez extraídos los conceptos del trabajo con representantes de toda la región llegó el momento de transmitirlos a todos los que forman parte de Arcos Dorados. ¿Cuáles fueron los objetivos de partida? ‡ Comunicar y difundir proactivamente la identidad de Arcos Dorados como una compañía que se define a través de su Misión, Visión y Valores. ‡ Alinear los límites que definen su actividad, para que cada uno de sus miembros pueda fácilmente validar sus decisiones y estrategias en el día a día del trabajo. ¿Cómo se comunicó? Se definió un marco (a manera de cuadro) como elemento conceptual de toda la campaña, asociado a su carácter contenedor que encuadra o enmarca. Un marco es una pieza que rodea, limita o protege. Representa también los límites en los que se encuadra una cuestión. Definir la Misión, Visión y Valores de una compañía brinda un marco en el que entran todos los que forman parte de ella. Este marco es el que une a las personas de una forma particular, pues define quiénes son como organización, hacia dónde van y cómo se quiere vivir el negocio. Los "marcos" contienen a las personas como organización, dan los lineamientos para integrarse y los límites para moverse hacia una única misión a cumplir. Ahora bien, la Misión, la Visión y los Valores son conceptos abstractos. El desafío estuvo en transformarlos en algo palpable por todos, de modo tal de poder verlos cada uno en las cosas más sencillas del día a día. Por esta razón no sólo se comunicó la Misión, Visión y Valores sino que también estos conceptos interactuaron en las diferentes actividades que realiza el personal en su trabajo cotidiano. A su vez transmitir conceptos, con la calidad y el alcance necesario, ameritaba un proceso de coordinación y organización sin precedentes en la organización. Por ello se prepararon una serie de instructivos (14 en total) para que en cada rincón del país existiera un impacto con características bien definidas. ¿Cómo se organizó la comunicación? El kick-­off fue el evento de lanzamiento en Argentina. El mismo implicó que un día definido, se intervino la oficina administrativa de Arcos Dorados Argentina con un marco corpóreo: ‡ En el ingreso a las oficinas: enmarcaba el ingreso y egreso de las oficinas administrativas y FRQWHQtDHOVLJXLHQWHPHQVDMH³1RORVYHVSHURORVYLYtVDFDGDSDVR´³8QFDPLQRSDUDYLYLUDFDGDSDVR
Desde hoy avanzamos juntos por el camino que nos marcaQQXHVWUD0LVLyQ9LVLyQ\QXHVWURV9DORUHV´ ‡ En carteleras: se trató de un marco superpuesto a la cartelera que enmarcaba toda la información FRQWHQLGDHQ HOOD \ FRQWHQtD HO VLJXLHQWH PHQVDMH³'HVGH KR\ DYDQ]DPRV MXQWRV SRU HO FDPLQR TXH QRV
marcan nueVWUD0LVLyQQXHVWUD9LVLyQ\QXHVWURV9DORUHV´ ‡ En los espejos de los baños. Para este evento de lanzamiento se convocó a todo el personal administrativo a una hora determinada a reunirse en un espacio común para ver un video de Woods Staton, Presidente y CEO de Arcos Dorados en Latinoamérica, quien presentó los conceptos. Luego del lanzamiento se siguió trabajando en la estética de la campaña. Había que encontrar una imagen que representara a cada valor. El plan de comunicación incluyó también: ‡ Cartas de Wood Staton dirigidas a Crew y Gerentes: Explicación y fundamentación de los contenidos y motivación a que los incorporen y los transmitan. Se redactó una carta personal para hacer al mensaje directo y personal (comunicación cara a cara). En esta carta se explicó la importancia de contar con una identidad propia como empresa y se presentaron la Misión, la Visión y los Valores de la compañía. ‡ Cuadernillos y DVDs para gerentes con explicación y fundamentación de los contenidos e instrucciones para implementarlos y comunicarlos a su personal a cargo. Se motivó a los gerentes para que transmitan y comuniquen los conceptos haciendo uso de las siguientes herramientas: o Reuniones grupales con equipos de trabajo. o Presentación del DVD con palabras del Presidente y CEO de Arcos Dorados y también del MD local, José Valledor Rojo, presentando los conceptos. ‡ Individuales para las bandejas de los breaks de los Crew. ‡ Pósters para cartelera del Crew Room (espacio de descanso dentro del local para los empleados). ‡ Impresiones en el dorso de los recibos de sueldo para Crew y Gerentes de locales. ‡ Comunicación en McLand (Intranet). ‡ Comunicaciones para la cartelera del Crew Room. ¿Cómo se replicó esta campaña en los locales? Como punto de partida, los Gerentes de los locales recibieron un kit de implementación de la Misión, Visión y Valores con herramientas para transmitir los contenidos y generar las dinámicas necesarias. A su vez se les entregó una carta firmada por Woods Staton hablando de la importancia de tener nuestra identidad. Los Gerentes de los locales recibieron también un e-­mail previo de lanzamiento explicando la Misión, la Visión & los Valores. Este contenía la descripción y el racional de la campaña a desarrollar. Ese material fue utilizado para hacer ese mismo día una bajada a todo el Crew. Cada Gerente realizó reuniones de 10 minutos con cinco empleados para cubrir la máxima cantidad de turnos y transmitir estos mensajes. También recibieron el boletín Crew para carteleras conteniendo los mismos mensajes emitidos en el Webcast de Woods Staton y un afiche con la Misión, Visión & Valores para colgar en carteleras. Bajada de los contenidos a la realidad cotidiana La Misión, la Visión y los Valores de una compañía son casi siempre conceptos abstractos. Esto hace que pueda ser fácil memorizarlos pero no así experimentarlos y percibirlos en el día a día de nuestras vidas. Por esta razón se hizo hincapié justamente en acciones para hacer que lo abstracto se vuelva concreto e identificable en nuestro trabajo. (Q ORV ORFDOHV OD SULPHUD DFFLyQ SDUD FRQFUHWL]DU ORV FRQFHSWRV IXH OD GH VHOHFFLRQDU D VX ³HPEDMDGRU´
quién sería el que desarrolle hacia adelante todas las iniciativas alineadas a esta campaña. Esta acción fue muy significativa pues conllevó la justificación de por qué esta persona era la más representativa de la Misión, Visión y Valores de la compañía. Para ser seleccionada debía contar con ciertas características destacables por todos. En segundo lugar, se realizó un juego de roles en todos los locales a partir del cual se buscaba identificar a las personas con un valor justificando a la vez con características o actitudes de esa persona qué es lo que lo hacía merecedor del mismo. Por último, como una filosofía que atraviesa transversalmente todo el accionar de la organización, se comenzó a implementar una identificación de cada una de las acciones y comunicaciones de la compañía con una cucarda en la cual se registra qué valor está asociado a dicha acción/comunicación. Y esto se puede ver en todo lo realizado durante 2010 en todo el país. De este modo se visualiza fácilmente cómo el accionar diario se relaciona con los conceptos que hacen a la filosofía de la organización. C ± Evaluación, comprobación y pruebas En primer lugar, la implementación de la campaña fue todo un éxito pues se realizó tal como estaba planeada, en tiempo y forma, en todo el país involucrando a más de 12.000 personas. Todo el personal administrativo se reunió para ver el Webcast del lanzamiento junto al Managing Director, intervino su oficina con el desarrollo de piezas gráficas y también de contenido y realizó las actividades previamente pautadas. En segundo lugar, existió un abordaje concreto de los conceptos de Misión, Visión y Valores en distintas actividades del trabajo cotidiano de modo tal que todos los empleados pudieron experimentar esta filosofía. Además, en mayo de 2010 se realizó una encuesta a 11.000 empleados del área de Operaciones (personal que trabaja en locales) para comprobar qué cantidad de gente conocía la Misión, Visión y Valores de la compañía con un resultado positivo del 95%. Se trató de una encuesta escrita con sistema multiple choice. Por último, si bien aún no se cuenta con más datos duros del impacto de la iniciativa, la compañía le asignó a esta campaña una importancia de gran magnitud pues ameritó un cambio en la encuesta de clima que se realiza tradicionalmente. A partir de ahora se incluirán preguntas que indaguen específicamente sobre el impacto de la Misión, Visión y Valores de la organización. PREMIOS EIKON 2010 Categoría: Comunicación de Identidad Corporativa Caso: Madre Empresa: AMIA Agencia: BasevichCrea Integrantes: Por AMIA: Daniel Pomerantz, Director Ejecutivo AMIA;; Gabriel Scherman, Director de Comunicación AMIA. Por BasevichCrea: Javier Basevich. Introducción Contexto Luego de 4 años de una exitosa primera etapa de reposicionamiento AMIA decide realizar un cambio conceptual, de acuerdo al crecimiento que la imagen de la organización ha experimentado en los últimos años. Desde hace más de 115 años, AMIA desarrolla acciones de gran impacto en toda la sociedad siendo reconocida como una de las principales ONGs de la Argentina. De acuerdo a eso, los principales medios de comunicación del país reconocen la acción desarrollada por AMIA cediendo espacios gratuitos;; gracias a eso es posible que AMIA presente su campaña institucional buscando estar cerca de la sociedad. $SDUWLUGHVX%UDQG&KDUDFWHU$0,$6($3523,$\GHVDUUROODHOFRQFHSWRGH³0DGUH´\PXHVWUDVXDFción través de una serie de consignas: Cuida. Protege. Alimenta. Abriga. Educa. Acompaña. Con el mismo cariño, cuidado y dedicación que una madre cuida a un hijo;; AMIA trabaja para construir una sociedad mejor. A partir de esta campaña desarrollada por BasevichCrea, este concepto ha sido volcado de manera exitosa a toda la imagen y comunicación institucional de AMIA, con una articulación a través de una serie de viñetas, imágenes y una nueva estética. Acerca de la organización Históricamente AMIA ha sido el referente de la Comunidad Judía de la Argentina y es conocida como la ³LQVWLWXFLyQPDGUH´ Es una organización sin fines de lucro y sus actividades se orientan a dar una amplia contención y espacio a los más necesitados, construyendo un nexo de apertura e integración con toda la sociedad argentina. AMIA cumplió 115 años a lo largo de los cuales ha construido sólidas estructuras de trabajo en protección social, cultura, empleo, educación, salud, atención a la tercera edad, integración de discapacitados, y muchos otros campos que han proporcionado calor humano y ayuda. Por su trabajo con la Comunidad Judía y frente a toda la sociedad general, y por el impacto de sus acciones, AMIA se ha constituido en una de las principales ONGs del país. Objetivo general: -­ Desarrollar un plan de comunicación que sirva de eje y guía para la eficiente administración de la imagen y comunicación institucional. -­ Poner en línea los objetivos institucionales estratégicos con las acciones y conceptos de comunicación. -­ Sostener la unidad conceptual de las acciones de comunicación de la organización. Objetivos de comunicación: -­ Consolidar el posicionamiento de AMIA como entidad principal de la Comunidad Judía. -­ Posicionarse como una de las principales ONGs del país. ReIRU]DUHOSRVLFLRQDPLHQWRFRPRXQDRUJDQL]DFLyQ³TXHKDFHSRU\SDUDWRGRVORVDUJHQWLQRV´ -­ Seguir mostrándose como una organización de acción, con hechos concretos todos los días. -­ Manejar con elasticidad el concepto de comunicación institucional frente a las diversas instancias de comunicación. -­ Mostrar atributos que la presenten como una de los principales destinos de donaciones y acciones de Responsabilidad Social Empresaria. -­ Asociar AMIA de manera sintética a sus valores Estamos frente a: -­ Una AMIA saludable. -­ Una AMIA viva. -­ Una AMIA con una imagen sólida y en crecimiento. -­ Una AMIA que volvió a ocupar el lugar central de la Comunidad Judía. -­ Una AMIA con trascendencia social. -­ Una AMIA dinámica y con acción. -­ Una acción que se percibe. Lineamientos / Ejes conceptuales: Comunidad Judía Juntos Acción Construcción de una sociedad mejor Atributos de la marca: Vida Acción Tradición Pertenencia Apertura / Integración Valores judíos Transparencia Modernidad Frescura Slogan: ³(ORUJXOORGHVHUSDUWH³ (Es parte indivisible de la marca AMIA) Imagen previa al nuevo concepto -­ Campaña de bajo impacto. -­ Comunicación exclusivamente orientada a la Comunidad Judía -­ Presencia destacada de Áreas de trabajo de AMIA -­ Falta de un concepto -­ Estética antigua y poco publicitaria La base estratégica Objetivos generales: -­ Renovar la propuesta. Refrescar la campaña institucional. -­ Dar un paso adelante conceptualmente. AMIA ya partió desde cero en su comunicación y hoy está en condiciones de afrontar una campaña con nuevo concepto. -­ Comunicar como una marca grande. Confiar en el peso específico de la marca AMIA Mostrar una acción global. No enfocarse en áreas en particular. -­ Llegar a toda la sociedad Para ser posicionada y reconocida como una de las principales ONGs del país Qué queremos transmitir? AMIA está. Todos los días. AMIA no es una organización que hace acciones esporádicamente. Todos los días. Cada día, estamos haciendo cosas. Llegando a la gente con acciones concretas. Trabajamos con valores. Los valores judíos son la guía de nuestro trabajo. Valores que se convierten en PRECEPTOS;; porque AMIA toma cada compromiso como un mandato a cumplir. Posicionamiento aspirado AMIA es la comunidad judía. AMIA es una de las principales ONGs de Argentina y trabaja para toda la sociedad. Es una institución que hace un montón de cosas y ayuda tanto a los judíos como a todo el país. Es como una madre. El posicionamiento esperado para los segmentos más alejados (sociedad general, empresas, judíos no institucionalizados) sería: ³$0,$HVODFRPXQLGDGMXGtD±o los judíos-­ que hacen muchas cosas para ellos PLVPRV\WDPELpQSDUDWRGDODVRFLHGDG´ Los valores de AMIA Vida. Memoria. Solidaridad. Justicia. Respeto. Tradición y continuidad. Igualdad. Estos valores están directa y estrechamente vinculados con la consigna de campaña. Estos valores de AMIA son los que permiten llevar adelante toda su acción con convicción y compromiso. Estos son valores judíos. Valores que AMIA se apropia y los hace suyos. Brand Character (la identidad de marca AMIA) Una madre. Adulta mayor, de unos 60 años. Con una gran vivencia y mucha experiencia. A la vez es moderna y abierta. Le gusta compartir e incluir. Es pluralista. Tiene valores. Es idealista, pero a la vez es práctica. Va al frente y hace. Algunas veces de mejor manera, otras veces no tan bien, pero hace, no se queda en las palabras. Madre y también abuela. Madraza. Muy protectora, y orgullosa de lo suyo. Una idishe mame, cuando de las tradiciones se trata, buscando cuidarlas y mantenerlas. Tiene una gran familia y goza de ver a toda su familia sentada en la mesa. La propuesta conceptual-­Concepto de campaña Madre. AMIA se humaniza al máximo. Toda su acción se traspasa a la imagen de una madre. Una madre es el icono mayor del cuidado y del amor. De alguien que está atenta a ver qué es lo que necesitan sus hijos y la gente que la rodea. Una madre es calidez. Es cuidado. Es símbolo del hogar. El amor de madre es indiscutido. Una abuela también es una madre. AMIA es la entidad MADRE de la Comunidad Judía, pero a partir de esta campaña supera estos límites, posicionándose en el ámbito social desde todo lo que significa ser una Madre. Consigna / Valores Cuida. Protege. Alimenta. Abriga. Educa. Acompaña. Desarrollamos 6 conceptos centrales como eje de la campaña. 6 conceptos que simbolizan los VALORES de AMIA. Acciones que son valores. El objetivo es que cada valor se vea como ambiguo y general. Esto es un ASPECTO CLAVE para darle amplitud y apertura a cada uno de estos conceptos a lo largo de la campaña. Consigna / Valores Cuida. Protege. Alimenta. Abriga. Educa. Acompaña. Cada uno de estos valores se puede contextualizar desde las diversas áreas de trabajo de AMIA: Empleo / Acción Social / Tercera Edad / Educación / Cultura / Tradición Judía / Discapacidad / Rabinato / Serv. Comunitarios (Sepelios) / Juventud En la bajada estética a cada uno de los conceptos se le asignó un color de la paleta cromática desarrollada institucionalmente para AMIA Slogan de campaña INSTITUCIONAL El orgullo de ser parte. Mantener este concepto. Sigue siendo central y se está transformando en parte indivisible de la marca. AMIA debe seguir transmitiendo esa sensación de sentirse orgulloso por lo que AMIA es y hace Slogan de campaña hacia la SOCIEDAD GENERAL Toda una Comunidad, construyendo una sociedad mejor. Una propuesta que busca la inclusión total. Tocar a todos y hacer que todos se sientan tocados. (VWDSURSXHVWDWHUPLQDUiGHSRVLFLRQDUD$0,$FRPR³/$&RPXQLGDG-XGLD´IUHnte a la sociedad toda.Esta propuesta muestra una AMIA cuya acción llega e impacta a toda la sociedad. Consigna / Valores Cuida. Protege. Alimenta. Abriga. Educa. Acompaña. Se Cuida desde la Acción Social y también desde la Educación Se Protege desde la Acción Social y también desde los Cementerios Se Alimenta desde la Acción Social y también desde la Cultura Se Abriga desde la Acción Social y también desde la Tercera Edad y Discapacidad Se Educa desde Educación y también desde la Acción Social Se Acompaña desde Acción Social y también desde la Tradición Judía Este concepto es tan global y propio a la vez que puede incluir temas tan diversos como el Atentado a la AMIA. Cuida y Educa para que no vuelva a suceder Protege y Alimenta la memoria Abriga y Acompaña, cuidando y conteniendo a los amigos y familiares Tono de campaña Cálido Positivo Planteamos una campaña MUY POSITIVA. Una campaña QUE CONTAGIE. Que muestre una AMIA cercana a la gente y muy activa. Esta debe ser una campaña muy optimista. Una campaña que muestre que vamos hacia adelante. Que creemos firmemente en la idea que construir una sociedad mejor es posible. Que es una convicción y trabajamos por ello. Estrategia >> Aplicación del concepto en TODA la imagen y comunicación institucional Estos 6 conceptos fueron articulándose y atravesando a TODAS las piezas de imagen y comunicación;; incluso incorporados en los discursos de sus principales dirigentes. Para facilitar y promover esta incorporación se desarrolló una viñeta la cual se aplica de manera muy versátil sobre diferentes formatos, generando una unidad. >> Renovación de toda la imagen y NORMATIZACION de su aplicación e implementación A partir de este concepto se desarrolló una nueva imagen, y para su implementación se realizó un manual de normas, a partir del cual se realizó una auditoria permanente en la implementación Estrategia >> División de la campaña en 2 canales -­ Comunidad judía -­ Sociedad general El mismo mensaje se articuló de manera específica para cada uno de estos dos públicos, considerando MENSAJES CLAVES para cada caso. Esto es un ASPECTO CLAVE del éxito de esta nueva campaña, el haber desarrollado copys de texto e imágenes específicas dentro del mismo paraguas de campaña. >> Desgloce de los conceptos de acuerdo a temática tratada En cada pieza de comunicación se aplica el concepto específico de acuerdo a la temática abordada. Estrategia >> Articulación del concepto para TODAS las ocasiones Otras piezas no tan directamente ligadas con la campaña ha sido alineadas conceptualmente, como ser: salutaciones hacia otras ONGs, fechas claves y festividades, etc >> Orden de conceptos Respetar siempre el orden de aparición de los conceptos/valores. Esto permite sistematizar y trabajar sobre la memorización de estos conceptos facilitando el posicionamiento >> Imágenes contundentes y de alto impácto Desarrollo de paquete de imágenes propio que transmitan los diversos conceptos y aplicación en campaña de manera destacada y protagonista Aplicación de concepto en la bajada estética Viñeta El concepto de campaña será desarrollado en forma de viñetas Las que serán aplicadas como marca de campaña.Para ello se desarrolló todo el sistema completo de estas viñetas. &DPSDxDS~EOLFR³6RFLHGDGJHQHUDO´ Ejes conceptuales Toda una Comunidad, construyendo una sociedad mejor. Trabajamos con valores, que son preceptos para nuestro accionar. AMIA como una de las principales ONGs de la Argentina. AMIA afirmando y mostrando su compromiso con toda la sociedad. AMIA diciendo a toda la sociedad, con orgullo, que es LA comunidad judía. Lo que mandan son los RESULTADOS Principales logros > AMIA completó un exitoso proceso de reposicionamiento, iniciado en 2004, en la etapa previa de esta campaña. > Recambio de imagen en tiempo record. En menos de 150 días se logró la implementación de esta nueva imagen en más de un 80% de las aplicaciones institucionales. > Normatización de todos los elementos de la imagen corporativa bajo esta nuevo concepto. > Hoy día, la institución cuenta con una línea clara y contundente de comunicación, con un tono propio y diferencial. > Se ha logrado transformar una imagen poco profesional en una imagen potente, con fuerte personalidad y con un sólido SUSTENTO CONCEPTUAL. > Muy buena aceptación e incorporación de los 6 conceptos propuestos desde AMIA. > Aplicación de la campaña y nuevo concepto en todo el circuito de comunicación institucional > Se consiguieron espacios en medios masivos para pautar la campaña a costo cero > Se ha logrado consolidar una línea de imagen corporativa que la identifica y diferencia. Una imagen clara, limpia, moderna y positiva. > Se ha logrado que todos los empleados de la organización sean parte activa de este proceso de incorporación del nuevo concepto. > Se ha consolidado un estilo propio con claro potencial y perdurabilidad a largo plazo. > Hoy AMIA puede acercarse y comunicarse con un público de un rango menor de edad. > Hoy AMIA tiene lo que decir y sabe cómo decirlo. > Más de 8.000 nuevos socios en poco más de 22 meses de campaña son el aval de este proceso en el que la comunicación e imagen es uno de los sustentos. Antes de comenzar esta etapa el promedio de socios nuevos que ingresaba por año era de 1200. > Más de 4.500 socios incrementaron, por su propia voluntad, el valor de su cuota social. > Acercamiento de empresas y organizaciones sociales, educativas, culturales, confesionales, entre otras para la realización de alianzas estrategicas en la concreción de actividades conjuntas. > Personas en situación de soledad familiar eligieron a AMIA como la destinataria de sus legados personales (dinero o propiedades), como producto de haber conocido el accionar de la institución. Conclusiones principales > AMIA logró por completo instalar el nuevo concepto y consolidar su posicionamiento como una de las principales ONGs del país. > Empresas y Organizaciones sociales, han dado cuenta de este nuevo concepto y hacen referencia a ellos cuando se refieren a AMIA. Un ejemplo interesante es el discurso de una de las principales autoridades de UCA durante la apertura del ž&RORTXLR³'HUHFKRV6RFLDOHVSDUD7RGRV´DOKDFHUUHIHUHQFLDD$0,$FRPR³XQDLQVWLWXFLyQTXH&XLGD
HGXFDSURWHJH«´ > La imagen de AMIA dio un vuelco de 180º, habiendo sido claramente percibida esta nueva etapa > Todos los proyectos de AMIA se encuentran unificados bajo el paraguas de imagen y concepto de AMIA lo que hace que el accionar de AMIA pueda ser percibido desde una totalidad. > AMIA hoy transmite: -­ Transparencia -­ Dinámica -­ Amigabilidad -­ Renovación -­ Liderazgo -­ Solidez-­ Valores > El DESGLOCE de cada uno de los seis conceptos para piezas específicas de comunicación han rendido de manera excelente y han optimizado los beneficios de cada pieza de comunicación. > Hay un exitoso desarrollo conceptual y estético de la nueva imagen y comunicación y mucho más que eso: -­ Se optimizaron los procesos de trabajo, en todos los casos adaptándolos a las particularidades de las áreas de donde surge la necesidad. -­ Cada pieza de comunicación es sometida a un riguroso chequeo y corrección minimizando al máximo errores de cualquier tipo (ortografía, redacción, desactualización de información, etc.). -­ Existe una auditoría permanente de la marca y de sus aplicaciones. -­ Se ha unificado la calidad de producción de los elementos de comunicación. -­ Se ha impuesto un estandar mínimo de calidad en la producción. > Se ha logrado un desarrollo conceptual lo suficientemente potente, versátil y amplio como para centralizar toda la comunicación PREMIOS EIKON 2010 Categoría: Comunicación de Identidad Corporativa (PYME) Caso: Identidad Electromak Empresa: Electromak Agencia: Mirela Hidalgo Integrantes: Por Electromak: José Nicodemo Mirela Hidalgo, asesor externo Acerca de la Organización Electromak surge en 2008 ante la exigente demanda, expresada por el mercado industrial y usuarios finales, de contar con un servicio técnico especializado en máquinas y herramientas eléctricas que ofrezca calidad y eficiencia. En sus comienzos, la empresa garantizaba productos fabricados por una sola marca. Sin embargo, el mercado se encontraba en auge y no existían en la ciudad servicios que brinden variedad en marcas. Por ello, sus directivos se contactan con distintos agentes de marcas, a fin de conformar un servicio técnico donde el cliente pueda encontrar todas sus garantías en un mismo lugar: Un sólo lugar. Gracias al esfuerzo continuo, estos logros pudieron realizarse, y hoy, emerge Electromak como el servicio técnico oficial de diez importantes marcas de la industria global de máquinas y herramientas eléctricas. Quiénes forman parte de la empresa comparten una filosofía sustentada en: servicios de calidad a través de tecnología, recursos materiales, y recursos humanos especializados;; transparencia y cumplimiento de compromisos asumidos;; acceso comprensible a la información demanda por los agentes, clientes, recursos humanos, y público en general. Ésta es la cultura que la empresa ha construido. Su carta de presentación. Situación Cuando la empresa abrió sus puertas se denominaba Electromecánica J&N, siendo representante de una sóla marca del sector. En ese momento, sólo existía una pieza gráfica, un volante, desarrollado en diversos colores, sin ningún tipo de línea estética ni coherencia comunicativa. Al mismo tiempo, en la ciudad de Rosario, ninguno de los servicios técnicos existentes brindada variedad en garantías de marca. Por ello, los directivos se contactan con distintos agentes de marcas, a fin de conformar un servicio técnico donde el cliente pueda encontrar todas sus garantías en un mismo lugar: Un sólo lugar. Obtenido el éxito en la incorporación de distintas marcas, se decide cambiar el nombre Electromecánica J&N por Electromak. Sin embargo, dicha decisión no fue acompañada por ninguna estrategia comunicativa. Meses después, la empresa comienza ha notar que la falta de comunicación está debilitando su imagen. Momento en el cual, interviene un profesional de Relaciones Públicas, quién determina las siguientes falencias organizativas: 1. No existe un logotipo que represente a la empresa. Por lo tanto, tampoco posee un eje comunicacional estructurado, sin unidad conceptual-­gráfica. 2. Conserva un desorden importante en la exposición de la comunicación. La pieza gráfica dada a los clientes es un volante que mantiene la denominación anterior. Asimismo, existen carteles, proporcionados por los agentes, que exhiben sus propias marcas. 3. No cuenta con un área de atención al cliente. Este servicio es dado por los mismos técnicos con amplios desatinos de eficiencia. 4. Con la incorporación de diversas marcas, los clientes comenzaron a denominar a la empresa como HO VHUYLFLR WpFQLFR RILFLDO ³GH´ 3RU HMHPSOR $O EULQGDU DWHQFLyQ YtD WHOHIyQLFD VXUJtDQ SUHJXQWDV FRPR
³¢+DEORFRQHOVHUYLFHGH%7$"´'LFKDVLWXDFLyQPDUFDEDXQDFODUDIDOWDGHSRVLFLRQDPLHQWRHLQVWDODFLyQ
GHOQRPEUH³(OHFWURPDN´ 5. El personal no se encontraba comprometido con la empresa. A pesar de ello, existía una fuerte vocación de servicio y profesionalismo en la tarea. Por lo cual, se identificó como una fortaleza. De allí, la comunicación debía basarse en el servicio. Culminada esta etapa, la construcción de la identidad -­como el elemento básico y aspecto unificador de toda la comunicación-­ era el punto de partida de un proceso de renovación. Objetivos ‡ Construir y desarrollar un sistema de identidad, dotándolo de unidad conceptual. ‡ Instalar los valores de la identidad en la mente de los públicos. ‡ Acompañar con la identidad la cultura de una empresa joven. ‡ Desplegar distintas piezas de comunicación, respetando los nuevos lineamientos gráficos y conceptuales. ‡ Incrementar el grado de presencia y exposición de la identidad ante los públicos de interés. Premisa: La efectiva comunicación de la identidad generará la imagen deseada por la empresa. Públicos Como parte de este proceso, ha sido necesario determinar los públicos que se interrelacionan con la empresa. Público Externo Clientes Actuales y Potenciales. Agentes de Marcas. Comunidad Vecinal. Sociedad en General. Público Interno Personal de Electromak El Plan Dados los objetivos principales, la campaña de identidad se proyectó en dos etapas: 1. Diseño del Sistema de Identificación (Octubre 2008 -­ Diciembre 2008);; 2. Implementación (Marzo 2009 -­ En ejecución). Ambas etapas fueron centralizadas en el profesional de Relaciones Públicas, garantizando un seguimiento y control de la campaña. Es conveniente aclarar que el proceso se realiza de forma progresiva, debido a que efectuar un lanzamiento masivo de la identidad implicaba una inversión injustificada desde los obejetivos propuestos. Ejecución del Plan Definición de la Misión y Visión Si Electromak deseaba posicionarse en el sector, resultaba indispensable definir, primeramente, su esencia. De esta manera, se evitaba cualquier desfasaje estructural en la comunicación. Por ello, durante el mes de octubre de 2008, y tras diversas reuniones directivas, la empresa precisó su misión y visión dentro del mercado. La Misión: ³(OHFWURPDNHVHOVHUYLFLRWpFQLFRespecializado que provee servicios de garantía en la industria global de máquinas y herramientas eléctricas, asumiendo el compromiso de representar a importantes marcas internacionales en la ciudad de Rosario, y garantizando la calidad en el servicio brindDGRDFDGDFOLHQWH´ La Visión: ³4XHUHPRV FRQYHUWLUQRV HQ ORV SUy[LPRV DxRV HQ HO 6HUYLFLR 7pFQLFR 0RGHOR GH OD LQGXVWULD JOREDO GH
PiTXLQDV\KHUUDPLHQWDVHOpFWULFDV´ Enmarcando este proceso, se elaboró un Dossier Institucional, donde se despliega la filosofía empresarial de Electromak. Documento: Adjunto I-­Dossier Institucional Diseño del Logotipo Dentro del proyecto de una identidad, se ha diseñado el logotipo que representará a la empresa institucionalmente. El mismo se encuentra constituído por: ‡ La Palabra Electromak. ‡ Una Herramienta Eléctrica, específicamente un Martillo Demoledor que deviene, de derecha a izquierda, como subrayando la palabra. El signo logra, en primer lugar, que la empresa se identifique a partir de la versión visual de su nombre. En segundo lugar, el martillo demoledor, además de representar una herramienta eléctrica, evoca por su IXQFLyQHQODYLGDVRFLDOXQVHQWLPLHQWRGHSRWHQFLD\IXHU]DWUDGXFLpQGRVHHQ³/D)XHU]DGH(OHFWURPDN´ Sabemos que los colores actuán como una herramienta de reconocimiento. Por esa razón, la definición de una paleta que identifique y denote los atributos de la empresa fue esencial. En la composición del nombre se optó por utilizar el color gris, ya que funciona como centro por su transición entre el blanco y el negro. La denotación de los atributos de innovación y tecnología refleja la cultura de Electromak. De la misma forma, las propiedades de modernidad y sofisticación reunidas en la tipografía Harlow Solid Italic se complementan ampliamente. Para el martillo demoledor, se aplicó una combinación de los colores verdes y azul. En tanto, el color azul es fresco y tranquilizante representando continuidad y estabilidad;; el color verde evoca un sentimiento de confort y relajación, generando armonía y crecimiento. En ambos casos, la paleta ha sido elaborada en el modo RGB, conciliando su reproducción en CMYK. De esta manera, no sólo se eliminan las posibles desviaciones, sino se controlan los pigmentos en distintos programas. El signo creado, de alta calidad gráfica y pertinencia semántica, se destaca con absoluta claridad de otras marcas de servicios del sector. Dicho diseño cumple con las características de simplicidad y reproducción, permitiendo así su aplicación en diversos soportes. Documento: Adjunto II-­Logo Institucional Modos Presentación de la Nueva Identidad Coorporativa al Público Interno Antes de implementar la campaña hacia los públicos externos, la empresa determinó las siguientes acciones: ‡ Desayuno Institucional: El 8 de Febrero de 2009 se efectuó con el personal un desayuno, donde se comunicó la estrategia del proyecto, transmitiendo el concepto de que cada uno de ellos es una parte fundamental de la empresa y de este posicionamiento institucional. En el mismo se presentó el nuevo logotipo, obteniendo diversas sugerencias en cuánto a su aplicación. Al finalizar, cada uno recibió un dossier institucional, generando un sentido de pertenencia. ‡ Incorporación de Carteleras: Se desarrollaron dos piezas gráficas con el nuevo logotipo que contenían la misión y la visión de la empresa. Ambas se colocaron en la instalación, a fin de que los empleados divisen el compromiso asumido por la empresa. Anexo II -­ Cartelera Diseño e Implementación de Canales de Comunicación La nueva identidad se desarrolló con un lineamiento estético y gráfico bajo el cual se alojaron todas las piezas de comunicación. De esta manera, se logró darle unidad y coherencia al sistema. 1. Carteles en la fachada de la instalación: Se elaboraron dos carteles: El primero, con dimensiones de 2,5 mts de alto por 2,5 mts de ancho, cuenta con una vista excepcional porque se encuentra ubicado en la cima del galpón a una altura de 5,5 mts;; el mismo, se divisa desde la intersección de dos importantes avenidas del norte de la ciudad. El segundo, con dimensiones de 0,70 mts de alto por 5 mts de ancho, se colocó en la pared frontal del galpón. Ambos respetan el nuevo sistema de identidad. 2. Indumentaria: Se diseñó una indumentaria para el personal interno. Por lado, las remeras y los buzos del personal técnico se confeccionaron en fondo negro, debido a que su función cotidiana implica la utilización de elementos altamente grasos. En tanto, las chombas y las camisas para el personal administrativo y jerárquico se fabricaron en fondo blanco. 3. Newsletter Electrónico: Se produjo una pieza con formato de Newsletter, con periodicidad mensual, donde se informan diversos aspectos de la empresa. La misma guarda coherencia gráfica y textual. 4. Material de Soporte Gráfico: Tanto la papelería comercial como la institucional se originó con el nuevo logotipo en sus colores plenos y una tipografía simple y clara. Cada una de las piezas detalladas se diseñó y produjo durante los meses de Enero y Febrero de 2009. Sin embargo, su implementación se efectuó en el mes de Marzo de 2009, a fin de plasmar al mismo tiempo toda la simbología. Anexo III -­ Indumentaria / Anexo IV -­ Soportes Gráficos Diseño del Sitio Web En la actualidad, Internet es la herramienta de comunicación más moderna y ágil. Infaltable en la mayoría de las empresas. Por ello, Electromak define ampliar su comunicación a través de la creación de un sitio web. Desde Agosto hasta Octubre de 2009, se elaboraron distintos bocetos que fueron presentados a los directivos de Electromak para su aprobación. Una vez elegido el boceto final -­tanto estética como estructuralmente-­ se desarrolló el contenido conceptual del website. La puesta en línea se efectuó en Enero de 2010, luego de evaluar su correcto funcionamiento y navegabilidad. Surgió así un sitio que combina una estructura funcional con un diseño gráficamente atractivo. De navegación sencilla y con un contenido que se actualiza permanentemente, ofrece información institucional y detalla los servicios que presta. Anexo V -­ Sitio Web Elaboración de Pieza Exclusiva Con la llegada del mundial y concientes del fervor argentino por el fútbol, la empresa amplificó su comunicación con una pieza exclusiva para la ocasión: Fixture Mundial. Su elección respondió a lograr un acercamiento de una manera más calida con los clientes, que en su mayoría responden al segmento masculino. Dicha pieza se efectuó durante el mes de Diciembre de 2009, implementandose apartir de Febrero de 2010. Anexo VI -­ Fixture Mundial Incorporación del área de Atención al Cliente Como premisa indiscutible, Electromak posee como política estar cerca de sus clientes, escucharlos y darles respuestas. Por ello, y ante la carencia, la empresa creó un área de Atención al Cliente, dependiente de recursos humanos calificados. De esta forma, agiliza la atención, brindando comodidad, calidez y eficiencia. Con la ampliación de las instalaciones, el área comenzó a funcionar a partir de Marzo 2009. La misma se encuentra separada del galpón donde el personal técnico lleva adelante su labor. Anexo VII -­ Calificación del área de Atención al Cliente Apoyo a los Clubes Barriales Respondiendo a los principios de la cultura Electromak, y con el objetivo de generar un acercamiento con la comunidad vecinal que la vio nacer, la empresa estableció, desde Noviembre de 2009, un apoyo, al deporte desarrollado en dos clubes de Barrio delimitados dentro de su zona: Club Amigos Unidos y Club Social y Deportivo Edison. Anexo VIII -­ Revista Rondeau (Club Amigos Unidos / Club Social y Deportivo Edison) Resultados Obtenidos 1. Se comprobó que la creación de un logotipo ha sido el primer paso de todo un completo y complejo proceso de renovación. 2. Se logró consolidar una identidad corporativa que identifica y diferencia a la empresa. 3. Se instauró una concientización interna respecto al cuidado de la identidad, percibiendo los beneficios del proyecto y una mejora en la gestión. 4. Existe un control permanente del nuevo logotipo y sus aplicaciones. 5. Se afirmó la imagen institucional, convirtiendose -­dentro del sector-­, en verdaderos referentes en la construcción de identidad corporativa. En cuatro meses, el sitio web ha mostrado un importante aumento en la cantidad de visitas, quintuplicándose la cifra inicial. Este crecimiento se tradujo también en la cantidad de consultas recibidas a través de la sección Contacto del sitio. (Anexo IX -­ Evaluación del Sitio Web). PREMIOS EIKON 2010 Categoría: Comunicación Interna Caso: Embalados 2009 Empresa: Unilever Integrantes: Por Unilever: Daniel Posse, Guillermo Manassero, Florencia Pérez Berbain, Paula Bledel A) Introducción Naturaleza de la compañía Unilever es una empresa líder en el sector de consumo masivo. Hace más de 80 años que está en la Argentina, y cuenta con dos grandes unidades de negocio: Cuidado Personal/ Limpieza del Hogar y Alimentos. En la Argentina emplea a más de 4.500 personas, tiene 8 plantas productivas y un centro de distribución, garantizando su presencia en todos los hogares del país. Unilever cree firmemente que la excelencia en el desarrollo del negocio requiere niveles ejemplares de comportamiento con su gente, proveedores, accionistas, consumidores, el medio ambiente y la comunidad en la cual se inserta. (VWD FRQYLFFLyQ VH YH UHIOHMDGD HQ VX PLVLyQ ³WUDEDMDPRV FDGD GtD SDUD FUHDU XQ IXWXUR PHMRU´ XQ
concepto integrador que atraviesa todas las acciones de la empresa, desde el manejo de materias primas, recorriendo toda su cadena de valor, hasta en el uso que los consumidores hacen de sus productos terminados. Todo esto apalancado por la capacidad de la compañía de alcanzar con sus productos, servicios y mensajes a más de 2000 millones de consumidores a nivel global. Identificación del problema No hay mudanza sin stress. O no hay cambios sin stress. Algunos lo toman como algo natural, otros tienden al rechazo o adoptan una actitud defensiva. En definitiva no hay una persona que no sienta incertidumbre al momento de una mudanza. Las cajas, el orden, los camiones, la limpieza, todo representa un gran quiebre en la rutina diaria. Ahora imaginen eso multiplicado por casi mil personas, provenientes de cuatro oficinas diferentes: un poco más de stress, y no sólo para los encargados de la mudanza. El insight era claro. Había que trabajar en bajar esa incertidumbre, miedo y stress. Y como sabemos, la información es poder, poder para hacer. El buen clima laboral, uno de los valores más preciados de la compañía, estaba en juego. Hoy conviven en nuestras nuevas oficinas centrales más de 900 empleados que antes trabajaban separados en las oficinas de Bouchard, Tucumán y 25 de Mayo en la ciudad de Buenos Aires y en las oficinas de Planta Tortuguitas. Pero para lograr esta unidad hubo una cuidadosa selección de los mensajes a transmitir y un riguroso cumplimiento del Plan de Comunicación para reducir al mínimo la incertidumbre. Objetivos de la campaña EMBALADOS 2009 Desarrollar una plataforma que nos permita mantener un nivel adecuado de información, en tono positivo, que refleje la novedad y los beneficios del cambio manteniendo continuamente informados a los empleados a través de los canales más relevantes. Principios de Comunicación: 1. Continua 2. Positiva 3. Orientada a las personas 4. Innovadora 5. Real y verídica en función de las definiciones. (Se comunica lo que se sabe) 6. En función de reducir incertidumbre y flexibilizar la resistencia al cambio. 7. Orquestada (diversidad de medios según diversidad de consumo de información. Aprovechar el Boca a Boca). La gestión de la información sobre la mudanza tiene sus comienzos en enero de 2008 cuando se concretó la firma del acuerdo inmobiliario. Pero la campaña de comunicación oficial estuvo vigente desde su lanzamiento en agosto hasta noviembre de 2009 y se dividió en las etapas explicadas en el apartado B) Ejecución del Plan. IMPORTANTE: Para ver un resumen de 4 minutos de los principales hitos de la campaña Embalados 2009 pueden ver el siguiente video: http://www.videotronics.com.ar/Mudanza_2009.wmv Públicos y mensajes Públicos Si bien el público evidente fueron los empleados de la compañía, la complejidad se daba entre quienes efectivamente se mudaban y quienes no, con los condimentos de pertenecer a una organización multi-­
local con infinidad de relaciones intra-­compañía. Entonces el público interno estaba conformado por todos los empleados de Unilever Cono Sur, con mensajes segmentados para: -­ Empleados de las oficinas de Bouchard, Tucumán, 25 de Mayo y Tortuguitas que participarían de la mudanza. -­ Empleados de las 8 Plantas y el Centro de Distribución en Argentina. -­ Empleados de la subregión Cono Sur (Bolivia, Chile, Paraguay, Perú y Uruguay) para comunicar el traslado de sus operaciones centrales. -­ El resto del mundo Unilever. En un segundo nivel, estaba el público externo a la compañía conformado por el mundo empresario y de negocios, proveedores, clientes, organismos gubernamentales, asociaciones, contactos institucionales, prensa, ONGs, etc. En cualquier compañía ±por lo menos las más tradicionales y de mayor trayectoria± conviven diferentes generaciones, con distintos niveles de resistencia al cambio y diferentes inquietudes respecto a la mudanza. Pueden tener la forma de la Generación X, y la tan comentada Generación Y. Pero no olvidamos TXHKXERRWUDVJHQHUDFLRQHVDQWHVTXHHVWDVGRVOHWUDV«/RTXHUHVXOWDFODYHa la hora de elegir distintos canales de comunicación interna. Mensajes ¿Cuáles eran las principales preocupaciones? ¿Qué quería saber la gente? En el relevamiento dentro de los grupos se definieron los principales temas y sus prioridades. Básicamente, la gran pregunta era: ¿Dónde es y en qué voy? Pero hacía falta darle un marco, un concepto. Se buscó comunicar la mudanza como un acontecimiento puramente positivo, explicando en qué modo beneficiaba tanto a la compañía como a los empleados el hecho de WHQHUXQD³&DVD3URSLD´QXHYDPiVFHUFDQD\FRQPD\RUHVFRPRGLGDGHV En todo momento priorizamos la sinceridad de comunicar lo que sabíamos apenas se conocían definiciones y asumimos que sí o sí, existe un costo personal en todo cambio. Además, cabe la pena destacar que no eran iguales las rutinas de los empleados provenientes de cada una de las cuatro oficinas que se unificaron en el nuevo edificio. Cada grupo gozaba de políticas de beneficios diferentes. Asimismo, tuvimos que considerar a los empleados de Unilever que no se mudarían al nuevo edificio. Canales de comunicación y acciones realizadas Comunicación Interna El 360° de comunicación tuvo en cuenta las etapas en las que se llevó a cabo la ejecución del plan: ETAPA 1: Convivir con el rumor -­ Desayunos con pequeños grupos para dar información de primera mano, recoger ideas, sugerencias, dudas y para levantar puntos de interés para realimentar la comunicación, aprovechando el ³ERFDDERFD´QDWXUDOTXHVHLQWHQVLILFDHQVLWXDFLRQHVGHFDPELR -­ VisLWDVDOHGLILFLRHQFRQVWUXFFLyQSDUDDOLPHQWDUHO³ERFDDERFD´\EDMDUDQVLHGDGHV ETAPA 2: Preparándonos para el cambio -­ Video viral de kick off con mensaje del Chairman de Unilever Cono Sur (hito que marcó el lanzamiento de la campaña). -­ Blog desarrollado Ad hoc (www.embalados2009.com.ar) -­ Novedades semanales: o Mailings desde la casilla de e-­mail de Comunicaciones Internas. ([email protected]) o Afiches en Carteleras de las oficinas. Se marcó un rincón específico para información de la mudanza. o Cartelería en los baños de las oficinas involucradas con la mudanza. -­ Revista Ui (revista interna que se distribuye a todos los empleados de Unilever Argentina) (7$3$(O³'tD'´ -­ Evento de bienvenida para la recepción en el nuevo edificio. -­ Carteleras digitales con información referente al nuevo edificio. -­ Marketing directo interno: Kit de bienvenida con productos de cuidado personal, taza e información. -­ Pocket guide (guía con información relevante acerca del nuevo barrio. Un mapa de la zona con paradas de colectivos, estacionamientos, restaurantes, supermercados, shoppings, farmacias, bancos y demás datos de interés). -­ Manual de Convivencia con indicaciones básicas de seguridad. Comunicación Externa Si bien el público principal del plan de comunicación fue el interno, se realizaron algunas acciones puntuales personalizadas de bajo perfil y con targets específicos, a nivel externo. Más allá de la prensa realizada por Banco Francés ±agente financiero± y FSA ±desarrolladora inmobiliaria± que incluyó información y testimonios de UL, sólo se buscó comunicar puntualmente el cambio de domicilio. Se definieron lineamientos en conjunto con ambos socios para alinear la comunicación externa. La intención de la compañía fue manejar el cambio con mínima repercusión externa, por razones corporativas. Por ello, la atención a la prensa fue pasiva y reactiva ante consultas puntuales. En paralelo a la notificación legal del cambio de domicilio (que se informó mediante carta formal), se realizó una acción de marketing directo, dirigida a los contactos institucionales clave, del mundo empresario y de negocios, proveedores, clientes, organismos gubernamentales, asociaciones, contactos institucionales, prensa, ONGs, etc. Se desarrolló una pieza de comXQLFDFLyQ WDUMHWyQ WUtSWLFR ³, ORYH
%RXFKDUG´ILUPDGDSRUHOHTXLSRGH$VXQWRV3~EOLFRV\&RPXQLFDFLRQHVGLULJLGRHQIRUPDSHUVRQDOL]DGDD
los contactos institucionales. Complementariamente, se realizaron comunicaciones similares por medios electrónicos y se estandarizaron las firmas de los mails de todos los empleados, en las que figuraba el cambio de domicilio. El concepto de la acción externa se centró en el hecho de mudarnos de la calle Bouchard en el centro y la homónima calle en Vicente López, mediante un juego de palabras. Cambiamos de edificio, mantuvimos la calle. B) Ejecución del plan Descripción de los pasos y procesos ‡ Se desarrollaron reuniones de avance entre el área de Asuntos Públicos y Comunicaciones, Recursos Humanos y la agencia de diseño Estudio Marcas donde se planteó la necesidad de comenzar a comunicar definiciones acerca de la mudanza dada la cercanía de la misma y que la compañía ya contaba FRQLQIRUPDFLyQSUHFLVDSDUDSRGHULQIRUPDU6HGHVDUUROOyHOFRQFHSWR³(PEDODGRV´TXHUHVXPtDOD
intención de comunicar con tono positivo el cambio hacia oficinas propias. Además se desarrolló un logo y paleta cromática para aplicar en toda la campaña y que resultara positiva, dinámica y de fácil recordación para todos los empleados. ‡ Definición de los objetivos específicos a comunicar a través de los medios de comunicación interna de la compañía. ‡ Brainstorming respecto de las herramientas a utilizar (definición de medios y canales para potenciar la información). ‡ Etapas diferenciadas de la campaña. El plan de comunicación se llevó a cabo en tres etapas: ETAPA 1: Convivir con el rumor Unilever ocupaba desde 2004 la mitad de un edificio en la Calle Bouchard en el centro de la Ciudad de Buenos Aires. En 2006 la compañía comenzó a buscar terreno para su sede corporativa. Ese año el peso del rumor se hizo patente. En un primer momento no hubo comunicación formal al respecto por cuestiones legales y de oportunidad. La búsqueda culminó en 2007. A principios de 2008 luego de la firma del primer contrato el rumor dejó de serlo. Nos mudamos en 2009. Ese mes se emitió un comunicado firmado por el Directorio que confirmaba el contrato de leasing para la construcción de las nuevas oficinas de Unilever de Argentina. La falta de detalles más allá de lugar ±un terreno baldío-­ , las modalidades o el detalle logístico para el proceso de la mudanza y la enorme incertidumbre con respecto a esto nos hizo unificar criterios para comunicar a medida que surgían definiciones. La piedra empezaba a rRGDU« ‡ Boca a boca o Reuniones ad hoc: a partir de este momento los HR BPs cumplen un rol fundamental en la canalización de las dudas y consultas de las distintas áreas de la compañía. Ellos fueron asignados para dar respuesta a las incertidumbres que surgieron durante esta etapa. o Grupos: se armaron grupos conformados por personas de todas las áreas de la compañía para poder conocer cuáles eran los principales obstáculos e inquietudes que la gente veía asociada a la mudanza para poder armar los mensajes y encarar la comunicación desde ese lugar. o Visitas al edificio en construcción: estos grupos visitaron el edificio para conocerlo y poder brindar información acerca del paso a paso de la construcción del edificio a sus propios equipos. ETAPA 2: Preparándonos para el cambio Gracias al avance del edificio en construcción y el inminente traslado en el mes de octubre, se definieron los primeros mensajes oficiales de la compañía para preparar a los empleados para la mudanza. Esta etapa comenzó en el mes de agosto de 2009 y la comunicación se llevó a cabo de la siguiente manera: ‡ Actividades kick off para el lanzamiento de la campaña. o Carta del Directorio: se envió por e-­mail y se colocó en carteleras el primer comunicado oficial a través del cual el directorio informaba acerca de la mudanza. En este comunicado ya se daban datos más precisos como la zona en la que se encontrarían las nuevas oficinas, el mes de la mudanza y las oficinas que serían trasladadas. o Video del Presidente de la compañía: se envió por e-­mail y se colocó en la Intranet un video de Miguel Kozuszok dirigido a los empleados que participarían en la mudanza con el mensaje clave y las especificaciones acerca de este nuevo espacio (todos bajo un mismo techo, finalmente tendríamos una casa propia). o Inauguración espacio en cartelera: se asignó un espacio específico con el diseño de la campaña Embalados 2009 en las carteleras de las oficinas afectadas. Este espacio se actualizó semanalmente con afiches, fotos y mensajes clave. ‡ Novedades semanales: actualizando los medios desarrollados ad hoc. o Carteleras: actualización semanal de la sección especial diseñada para la mudanza. o Cartelería en baños: actualización semanal/quincenal de los marcos con novedades en los baños. ‡ Digital o HTML: envío semanal/quincenal de e-­mails desarrollados con información específica acerca del paso a paso de la mudanza. o Blog: diariamente se actualizó el Blog de la Mudanza con contenido más elaborado que en carteleras. Su fácil implementación permitió subir videos, mapas interactivos, fotos y notas con mayor FRQWHQLGR7RGRVORV+70/PDLOLQJVUHPLWtDQDO%ORJGRQGHVH³SRVWHDEDQ´ODVQRYHGDGHV ‡ Revista UI o Ui #13 (pre-­PXGDQ]DHQODHGLFLyQGHMXOLRGHVHSXEOLFyODQRWD³7LHPSRVGHFDPELR´Hn la que se adelantaron definiciones, fotos del edificio en construcción, renders de cómo quedarían las oficinas, las etapas de la mudanza y todos los beneficios que tendrían las nuevas oficinas de Unilever Cono Sur, no sólo por las nuevas comodidades edilicias, sino también por cómo impactaría en el trabajo cotidiano de los empleados. o Ui #14 (post-­PXGDQ]DHQODHGLFLyQGHGLFLHPEUHGHVHSXEOLFyODLQIRJUDItD³%LHQYHQLGRVD
QXHVWUD FDVD´ GRQGH VH PRVWUDURQ ODV QXHYDV RILFLQDV D WUDYpV GH IRWRV $Gemás se aprovechó para difundir imágenes de todas las oficinas administrativas en los países que conforman la subregión de Cono Sur (Chile, Uruguay, Paraguay, Bolivia y Perú). ‡ Housekeeping: la preparación de los escritorios y todo el material que debía ser embalado para llevar al nuevo edificio. o Awareness I: comunicaciones vía e-­mail, carteleras y afiches en baños anunciando la fecha del primer día de Housekeeping en el que los empleados debían descartar todas aquellas cosas innecesarias que no serían trasladadas al nuevo edificio. o Awareness II: segunda comunicación vía e-­mail, carteleras y afiches en baños preparando a los empleados para guardar en cajas de archivo toda la documentación que podía ser enviada a un archivo externo por tratarse de materiales que no son de utilización diaria. o En caja: finalmente se realizó una comunicación por e-­mail y en carteleras con la fecha final y la explicación de cómo debían colocarse los rótulos para que todas las cajas y computadoras pudieran ser trasladadas en orden al nuevo edifico. (7$3$(O³'tD'´ ‡ Pocket Guide: se desarrolló una guía ad hoc que se entregó a todos los empleados la semana previa a la mudanza para que pudieran conocer de antemano el nuevo barrio. La guía incluyó una columna de bienvenida firmada por Pablo Maison, director de Recursos Humanos, y un detallado mapa de la zona de la nueva oficina con negocios, restaurantes y puntos de interés, las calles principales, cómo llegar al edificio, en qué pisos se encontraban todas las áreas de la compañía, etc. ‡ Evento de Bienvenida una vez que nos encontramos en el nuevo edificio. o Cartelería: todas las carteleras fueron preparadas con los colores del nuevo edificio y durante la primera semana se colocó un cartel de bienvenida. o Desayuno en el nuevo comedor: el primer día de trabajo en Vicente López se realizó un desayuno para todos los empleados en el comedor del nuevo edificio. Tanto el Presidente de la compañía como el Director de Recursos Humanos agradecieron a todos los empleados por el esfuerzo realizado y por el éxito de la mudanza. o Kit de Bienvenida: al llegar a su nuevo escritorio cada empleado encontró: una pequeña cartelera metálica con su nombre y su nueva tarjeta de acceso al edificio, un necessaire con productos de Unilever (de hombre o mujer dependiendo del caso) con el logo de la campaña de Embalados 2009 y una taza. o Carteleras digitales: el nuevo espacio de comunicación en el nuevo edificio ya estaba en pleno funcionamiento desde el primer día con información relevante con los horarios y menúes del comedor, datos de la proveeduría (mercadito interno para la venta de productos de Unilever al costo), las áreas de la compañía por piso y fotos del paso a paso de la construcción del edificio. o Manual de convivencia: se colocó en Intranet el nuevo Manual de Convivencia diseñado específicamente para el nuevo edificio con información básica de seguridad, para que todos los empleados lo conocieran y pudieran recurrir a él cuando lo necesitaran. Ajustes, dificultades y soluciones encontradas ‡ Experiencia previa: La anterior mudanza había resultado un buen ejemplo a seguir. Una de las cosas que se destacaban de entonces fueron el buen nivel de información junto con la posibilidad de ir conociendo de a poco la nueva oficina. En ese sentido la vara estaba muy alta esta vez, y estábamos seguros que necesariamente iban a haber comparaciones, obligándonos a montar una estrategia más robusta y abarcativa con respecto a la de 2004, donde el cambio real no era tan significativo. ‡ Gente implicada: Casi 1000 personas de cuatro oficinas distintas, con expectativas y entornos diferentes resultaban un desafío. Además de sumar perfiles muy distintos de empleados, desde aquellos con 40 años de carrera, como aquellos jóvenes con menor resistencia al cambio y mayores demandas en el entorno laboral. ‡ &RVWRV /D HFXDFLyQ ³PHQRU FRVWR-­PD\RU LPSDFWR´ IXH VHJXLGD DO SLH GH OD OHWUD SULYLOHJLDQGR
acciones de bajo costo y mayor relevancia tanto simbólica como en cuanto a efectividad de la comunicación. La inversión en comunicación formaba parte del presupuesto total de la mudanza por tanto continuamente se iban viendo ajustes en función a necesidades ajenas a la comunicación. La campaña se basó en medios existentes ±contamos con buena cobertura-­, y se desarrolló ad hoc un blog para mejorar nuestro alcance y periodicidad, que nos permitió actualizar diariamente el contenido, subir fotos, videos y novedades desde nuestra oficina y sin los costos adicionales de mantenimiento de una agencia. El uso del ³ERFDDERFD´UHVXOWyXQDKHUUDPLHQWDWDQHIHFWLYDFRPRFXDOTXLHULQYHUVLyQDGKRF ‡ La movida 2.0: Dos ideas de muy bajo costo y alto impacto que surgieron fueron la creación de un grupo en Facebook y de una cuenta en Twitter. El grupo de Facebook fue armado, pero luego de una serie de testeos fue discontinuado ya que era clave mantener cierto nivel de confidencialidad. La idea de crear una cuenta en Twitter también prometía buenas posibilidades por su costo cero, pero al mes de septiembre de 2009 no había más de 60 empleados con cuenta en esta red social. Por estos motivos decidimos crear un blog ya que nos permitía comunicarnos con todos los empleados de forma instantánea (a través de RSS feeds y e-­mails) y que además nos permitía tener más control de quiénes podían acceder y desde dónde lo hacían, cumpliendo con las políticas de Seguridad de la Información de Unilever. ‡ Ansiedades: Durante la primera etapa de comunicación fue muy importante la red que establecimos tanto a través de los grupos de empleados que brindaron sus inputs acerca de lo que pensaban, y el trabajo de los HR BPs (Partners personales de RRHH) que permitieron controlar la información incorrecta y brindar, dentro de lo posible, toda la información que sí estaba confirmada y a disposición. Hay que tener en cuenta que se trataba de más de 900 empleados, por tanto una división por áreas de la compañía (que ya tienen nuestros HR BPs asignados) facilitó la tarea. ‡ Mudanza de Tortuguitas: la mudanza hacia las nuevas oficinas se realizó en dos etapas. Primero, el 13 de octubre de 2009 se mudaron las oficinas de Bouchard, Tucumán y 25 de Mayo. En una segunda etapa, en el mes de noviembre, se mudaron los empleados de Tortuguitas. Para que la segunda etapa fuera exitosa se repitió la ejecución del plan de comunicación, adaptando todas sus etapas al cronograma de la mudanza en noviembre. Esto permitió que los empleados de Tortuguitas recibieran la información en tiempo y forma para cuando estuvieran listos a mudarse. C) Evaluación/ Pruebas Identificación, análisis y cuantificación de los resultados. Caso ganador del Programa Goles de Unilever La campaña fue un éxito dentro de la compañía y fue uno de los casos ganadores dentro del Programa Goles del 4º cuatrimestre del 2009 en Cono Sur. Al cierre del año, el caso resultó ganador por su gran repercusión en el negocio en Cono Sur. El área de Asuntos Públicos y Comunicaciones fue destacado por lograr una potente, proactiva y clara estrategia de Comunicación Interna a todos los niveles para lograr un mayor involucramiento de todos los empleados. Además el Programa Goles destacó aquellas cosas que se hicieron distinto para poder lograr los objetivos. En particular distinguieron que: operamos un proyecto de gran envergadura con todas las áreas on-­board, en forma verdaderamente plural e instalamos una estrategia múltiple de comunicación para asegurar alineamiento, compromiso y anticipación frente a cada acción que encarábamos. Los comportamientos destacados fueron: ‡ Pasión por alcanzar el logro y pleno compromiso con los objetivos originalmente acordados. ‡ Claridad y Velocidad en la ejecución, que permitió cumplir con los compromisos en tiempo y forma, haciendo propio el sentido de urgencia en lograr los ahorros y la meta. ‡ Fuerte trabajo interdependiente y en equipo entre todas las áreas y personas involucradas, que posibilitó instalar una dinámica de empowerment y alineamiento a los objetivos planteados. ‡ Decisivo interés por conocer cuáles eran las expectativas de los usuarios finales de las oficinas (los clientes internos), que motivó la realización de una encuesta al Directorio en la etapa inicial y la conformación de 6 equipos adicionales de trabajo, en marzo de 2009, para que ajustaran todos los diseños y le dieran un toque final que incluyera lo que el resto de la compañía esperaba del proyecto. La opinión de nuestra gente ‡ ³/R TXH PH SRQH FRQWHQWD HV TXH HV XQ HGLILFLR QXHYR PH GLMHURQ TXH ODV RILFLQDV HVWiQ
buenísimas. Vamos a tener teléfonos más modernos, un piso lleno de salas de reunión. Además voy a OOHJDUPiVUiSLGRDODRILFLQD´&DUROLQD*DOOHJR0DUNHWLQJ5HJLRQDO ‡ ³0H GLMHURQ TXH HV PX\ OLQGR 9DPRV D YROYHU D WHQHU XQ FRPHGRU SURSLR GRQGH SRGpV MXQWDUWH
FRQODJHQWHYHUOD«´6LOYLD%ODQFR)LQDQ]DV ‡ ³0HGDQPXFKDVJDQDVGHDUUDQFDUHQXQDQXHYDFDVD´)HUQDQGR*LJOLRWWL$XGLWRUtD ‡ ³/D YHUGDG HV TXH HV XQ FDPELR TXH HVWDED HVSHUDQGR KDFH PXFKR WLHPSR´ $OHMDQGUR &KDLQ
Marketing local). ‡ ³9DPRVDHVWDUPiVFRQHFWDGRVFRQORVGLVWLQWRVGHSDUWDPHQWRVHVPX\ buena la idea. En mi caso YR\ D HYLWDUHO HPEXGR GH OD GH 0D\R DGHPiV WHQHPRV OD IDFLOLGDG GH ORV FKDUWHUV´ 0DULDQR /XQD
Legales). ‡ ³+DQWHQLGRHQFXHQWDWRGDVQXHVWUDVQHFHVLGDGHV&UHRTXHHVWHQXHYRHGLILFLRYDDVHUXQOXJDU
de gran camaradería porque vamos a estar juntos otra vez. Realmente es un gran esfuerzo de toda la gente que estuvo involucrada en este tema. (Miguel Cona Pons, Seguridad de la Información). ‡ ³/DPXGDQ]DPHJHQHUDEDPXFKDLQFHUWLGXPEUHSRUHOWHPDGHOWUDVSRUWHSHURWXYLPos la suerte de organizar un pool. No sólo no hubo problemas sino que fue mejor que incluso cuando estábamos en el YLHMR%RXFKDUG)XLPRVPX\ELHQUHFLELGRV´/XFLDQD6DQWLV5HJXODWRU\ A diciembre de 2009, una vez finalizadas todas las etapas de la mudanza, cuando ya fueron mudadas las cuatro oficinas y los casi 900 empleados involucrados, una sola persona decidió retirarse de la compañía por no estar conforme con la mudanza. PREMIOS EIKON 2010 Categoría: Comunicación Interna Caso: Yo visité la planta de Kraft Foods en Pacheco Empresa: Kraft Foods Agencia Foro 21 Integrantes: Por Kraft Foods: Margarita Casalins, Asuntos Corporativos Por Foro 21: Silvio Gruber, Director;; Diego Manusovich, Director Introducción Acerca de Kraft Foods Kraft Foods Argentina se especializa en la elaboración de bebidas en polvo, galletitas, chocolates, premezclas, pastas y quesos. Estas seis categorías de productos conforman el core business de la empresa. La compañía cuenta con más de 3.500 empleados y con tres plantas industriales, dos de ellas en la provincia de Buenos Aires, en Pacheco y en Tres Arroyos, y la tercera en Villa Mercedes, provincia de San Luis. Actualmente en Argentina, Kraft Foods participa en el mercado local con cerca de 400 productos, distribuidos entre las diferentes categorías. Kraft Foods Inc. es una de las compañías de alimentos y bebidas más grandes del mundo. La empresa cuenta con 230 años de antigüedad, 159 plantas, más de 90.000 empleados, durante el 2007 obtuvo una facturación de 37.000 millones de dólares y 40 de sus marcas tienen más de 100 años de existencia. Millones de veces en un día, en más de 150 países, los consumidores eligen sus marcas favoritas de Kraft Foods. El éxito de Kraft Foods es el resultado de una tradición de calidad y sabor, fruto de una vasta experiencia en la cuidadosa elaboración de los mejores productos. Su pasado cuenta con imaginativos pioneros que dieron origen a marcas como Suchard, Jacobs, Milka, Royal, Philadelphia, Tang, Oreo, Ritz, Club Social y Chips Ahoy, entre otras. Muchas de las marcas que comercializa Kraft Foods son líderes mundiales. Siete de ellas -­ Tang, Clight, Oreo, Club Social, Philadelphia, Milka y Toblerone -­ superan los 1.000 millones de dólares de facturación anual y más de 50 de sus marcas facturan anualmente 100 millones de dólares. Relación con la comunidad Para Kraft Foods, la Responsabilidad Social Corporativa es un compromiso a largo plazo unido inseparablemente a su objetivo de éxito en el negocio. Por esa razón, es esencial el respeto por sus empleados, clientes y consumidores, como así también su preocupación por el medio ambiente y las comunidades en las que tiene presencia. Kraft Foods impulsa la capacitación de su personal en forma integral, tanto desde el punto de vista profesional y técnico como en la promoción de una vida saludable. También financia programas de educación nutricional y actividad física, cuya misión es promover conductas saludables en las comunidades de bajos recursos y trabaja a lo largo de todo el país con organizaciones no gubernamentales para el alivio del hambre y la desnutrición. Problemática y Fundamentación del plan Kraft Foods decide reiniciar el programa de visitas a la planta de Pacheco (después de dos años de suspensión de las mismas), con el objetivo de acercar a la familia de sus empleados y compartir una jornada distendida, de juego y aprendizaje. Generando posterior a los conflictos vividos en el año 2009, un clima de cordialidad e interacción entre los invitados. Los objetivos propuestos para esta Jornada fueron: ‡*HQHUDUXQFOLPDSDUWLFLSDWLYR\GHDSUHQGL]DMHSDUDORVIDPLOLDUHVGHORVHPSOHDGRV ‡ 3RWHQFLDU HO HQFXHQWUR GH OD IDPLOLD HQ HO PDUFR GRQGH FDGD XQRGHORVHPSOHDGRV GHVDUUROOD VX WDUHD
cotidiana, conociendo sus tareas y la fábrica en su proceso. Ejecución Planificación y gestión de la visita La visita involucró la participación de diversos actores: familiares invitados, empleados de los diferentes sectores de la planta, equipo FORO 21 y equipo profesionales de Kraft Foods. Inscripción y difusión Para la inscripción de los familiares a las visitas se distribuyeron fichas de inscripción y se confirmó la fecha por vía telefónica. La difusión interna estuvo a cargo de Kraft, quien diseñó los formularios que fueron colocadas en espacios comunes de información en la planta Pacheco (comedores, vestuarios, salida y entrada a la planta). (Se adjuntan en el anexo los formularios) Descripción Las visitas se realizaron en las siguientes fechas y turnos: o Lunes 25, miércoles 27 y viernes 29 de Enero o Lunes 8 al viernes 12 de Febrero o Lunes 15 al viernes 19 de Febrero Los turnos, fueron : o 1er turno: 10.00 a 12.45 hs o 2do turno: 14.15 a 17.00 hs La acción tuvo una duración de 2 horas y media y se realizó en el quincho de la planta de Kraft con un máximo de 60 participantes. Desarrollo Se recibía a los invitados en la puerta junto al personal de seguridad, se les colocaba un Stiker identificatorio y se los guíaba hasta el quincho, donde los profesores los esperaban con algunos juegos mientras iba llegando la totalidad del grupo. (Se adjuntan en el anexo imágenes de los distintos momentos de la visita) Juegos Rompehielos El equipo docente de FORO 21 coordinaba los juegos rompehielos con la intención de generar un clima ameno y de diversión entre los participantes, estimulando además a que interactúen a través de los mismos. o Historia de Kraft Foods: Cada participante recibía el nombre de una marca o de algún personaje de la Historia. En la medida que se relataba el cuento y se iba nombrando a los personajes, los mismos se GHEtDQ FDPELDUGHOXJDUSHUR FXDQGR VH QRPEUDED³.UDIW)RRGV´WRGRVORVSDUWLFLSDQWHVGHEtDQPRYHUVH
por el centro de la ronda. o Para dividirse en 4 grupos de 15 personas (que serían luego los grupos para la visita), se realizaba el juego de la Molécula, considerando que los lazos familiares se mantengan en cada uno de los grupos. Una vez que estuvieran divididos en 4 grupos, se realizaba el juego de las consignas. Ejemplo: formarse de menor a mayor, etc. De esta manera cada grupo iba ganando sus guardapolvos, cofias y protectores. Charla de Seguridad: Antes de salir a recorrer la planta, se realizaba una charla sobre las normas de seguridad para ingresar a la misma. En el anexo se encuentra adjuntado el punteo de la charla de seguridad. Regreso al quincho Luego de la visita, todo el grupo se volvía a reunir en el quincho, para comenzar con la última parte de la actividad, dejar su recuerdo en la planta. Un dibujo para el familiar que trabaja en Kraft y dejar registro GHO SDVDMH SRU OD SODQWD SODVPDQGR ODV PDQRV GH ORV FKLFRV FRQ WHPSHUD HQ HO PXUDO ³+DFp WX GtD
GHOLFLRVR.UDIWIRRGV´(QFDGDSODFDVHDJUHJDED una receta realizada por los participantes como forma de compartir una pequeña evaluación de la visita. Cierre Los grupos presentaban el Ostinato rítmico-­melódico aprendido a la vuelta del recorrido. 9R]³+DFHTXHQXHVWURGtDVHDGHOLFLRVR´ 9R]³$OLPHQWDUVHELHQ\YLYLUPHMRU´ 9R]³&DOLGDG\VDERUDOPXQGR´ 9R]³.UDIW)RRGV´ Para cerrar, se sacaba una foto general con todos los participantes. Se les entregaba un pin, un diploma agradeciendo la participación de cada uno y la bolsa obsequio. Evaluación Impactos-­ Cantidad de participantes: 1. La cantidad de niños participantes fueron: 782 2. La cantidad de adultos participantes fueron: 326 3. Total de participantes de las visitas: 1108 En relación a la Visita: 1. Tuvieron un clima festivo. La gente se mostró feliz de ver a sus familiares, conocer su ámbito de trabajo, sus compañeros y los empleados estaban entusiasmados al verlos pasar. 2. Los participantes se sintieron a gusto con las diferentes propuestas realizadas y se iban distendiendo en la medida que avanzaba la jornada. 3. Con el paso de los días el clima de colaboración y participación en la Planta fue creciendo. Al ver llegar a los grupos, los empleados saludaban, abrían el paso, ofrecían agua, etc. 4. Al entusiasmarse con la visita, los empleados de cada uno de los sectores de la planta se interesaban en dar su propio aporte. Al llegar al sector de amasado, esperaban con la masa para poder volcarla, en el sector de chocolate se encontraban pendientes de la llegada, etc. 5. Al pasar por el sector de las galletitas Express o de Rodhesia, los familiares observaban cómo levantaban la gran cantidad de productos sin que se caiga ninguno, lo que generaba muchas veces que los participantes de la visita brindaban un cálido aplauso al personal. Este es un claro ejemplo del clima agradable como producto de la llegada de los grupos a la planta. 6. Fue continuo y constante el agradecimiento de la gente, en relación a la oportunidad de conocer el lugar de trabajo de sus familiares. Hubo un clima contagioso desde los empleados de poder hacer la presentación de sus familiares. 7. A lo largo de las visitas hubo un clima de energía, alegría y agradecimiento. 8. En relación a la organización, el equipo de FORO 21 contó con todos los materiales necesarios y ante cualquier pedido se tuvo respuesta inmediata. Hubo mucho soporte por parte del equipo de Kraft Foods, que permitió que FORO 21 se sintiera muy a gusto. Algunos Comentarios expresados por las visitas: Al recibir los llamados telefónicos, en todas las ocasiones, se mostraron muy agradecidos. Una SHUVRQDGLMR´GHVSXpVGHODxRTXHSDVDPRVHVWRHVFRPRXQDFDULFLD´ &RQRUJXOORHVFXFKDPRVDOJXQRVQLxRVGLFLHQGR³FXDQGR\RVHDJUDQGHTXLHURWUDEDMDUDTXtFRPR
PLWtR´\RWURFRPHQWDQGR³\RWDPELpQ´ $O SHGLUOHV TXH VXHxHQ XQ GtD GHOLFLRVR DOJXQRV QLxRV FRPHQWDURQ ³0H LPDJLQp OOXYLD GH
FKRFRODWH´³XQODJRGHFKRFRODWHDOTXH\RSRGtDHQWUDUDEDxDUPH´HWF Los comentarios fueron muy positivos y quedaron plasmados en las recetas que cada uno de los JUXSRV UHDOL]y GH OD YLVLWDV D PRGR GH HMHPSOR ³IXH PX\ LQVWUXFWLYR \ PXFKR SDUD DSUHQGHU´ ³KD\ XQ
SHUIXPHGHOLFLRVR´³VHQRWDTXHVRQFUHDWLYRV´³ODYLVLWDIXHPX\FDOXURVD´ Uno de los momentos más esperados por los grupos es al finalizar cuando se les entrega la bolsa con los productos el pin y el diploma. La cara de los niños al ver lo que contienen las bolsas es de total DVRPEUR³1RVDEHVWRGRORTXHKD\DGHQWUR«´ Resaltamos la frase que una nena escribió en el dibujo que hizo para su mami³0DPLHVWHGLEXMR
WHORGHMRSDUDYRVDKRUD\DVpORTXHHVWXWUDEDMR´ Los invitados se mostraron muy agradecidos por la actividad y los recuerdos que se llevaron de la misma (pin, diploma, bolsa con productos), manifestando haber disfrutado de la visita y de haber aprendido en clima de cordialidad. PREMIOS EIKON 2010 Categoría: Comunicación Interna Caso: Abrí los ojos Empresa: Edesur Integrantes: Gerencia de Comunicación Edesur Introducción: Edesur es una empresa privada que presta el servicio público de distribución de energía eléctrica a más de 2,1 millones de clientes (6 millones de habitantes) en 2/3 partes de la Ciudad Autónoma de Buenos Aires y en 12 partidos de la provincia de Buenos Aires. La empresa abastece un área de concesión de 3.300 km2 donde se consume más del 20% de la demanda eléctrica de todo el país. Edesur inició su concesión en septiembre de 1992 y a través de un plan de inversiones que superó los mil millones de dólares, ha logrado importantes mejoras en los indicadores de calidad de servicio. Los trabajos que se realizan a diario para que el servicio se preste de la forma más eficiente deben hacerse de una manera segura para preservar la vida de los trabajadores, que por estar expuestos a la electricidad y a la altura, están constantemente en riesgo. Para evitar cualquier tipo de accidentes EDESUR decidió realizar una campaña interna de prevención ODERUDOEDMRHOVORJDQ³$EUtORVRMRV´FRQHOILUPHREMHWLYRGHFRQFLHQWL]DUDORVWUDEDMDGRUHVDFHUFDGHTXH
un trabajo seguro es un trabajo bien hecho. Bajo esta simple pero contundente premisa, la agencia publicitaria Ogilvy & Mather bajo la dirección de la Gerencia de Comunicación y la Dirección de Recursos Humanos de EDESUR ha desarrollado la campaña que apuntó a promover la seguridad laboral en la empresa. El plan de comunicación interna estuvo dirigido a los trabajadores de EDESUR en general y particularmente a aquellos que por su actividad están expuestos a los riesgos que implican la electricidad y la altura. En EDESUR pensamos que la seguridad es un compromiso de todos, es por esto que nos pareció importante que la campaña llegase a la totalidad de los empleados y no únicamente a los trabajadores con mayor exposición al riesgo. Sabemos que muchas veces los empleados no leen los folletos ni reparan en las carteleras, es por esto que decidimos afrontar este inconveniente desarrollando una campaña que tuviese un alto impacto visual y que despertase la incertidumbre de todo aquel que la vea. Estuvo dividida en dos etapas: teaser, en la que se planteó una incógnita y develación, donde se reveló el interrogante planteado en una primera instancia. Se llevaron a cabo dejando un intervalo de quince días entre una instancia y la otra. Los soportes que utilizamos para llevar a cabo nuestro plan fueron: posters colgados en los edificios de la empresa y en las subestaciones;; stickers colocados en camionetas y postes;; y folletos entregados a los empleados a través del recibo de sueldo. Ejecución del plan: Una vez planteada, por la Dirección de Recursos Humanos, la necesidad de desarrollar una campaña de comunicación interna destinada a evitar accidentes laborales, la Gerencia de Prevención de Riesgos en conjunto con la Gerencia de Comunicación trabajó para poner en ejecución un plan de comunicación efectivo para abordar esta problemática. Después de un análisis exhaustivo de los accidentes laborales ocurridos en la compañía, se notó que el exceso de confianza fue uno de los factores fundamentales en cada uno de ellos. En función a este descubrimiento, se tomó la decisión de elaborar una campaña de comunicación que apuntase directamente a evitar que el exceso de confianza generase que los empleados no tomasen las precauciones pertinentes. Para lograrlo, en EDESUR pensamos en la agencia publicitaria O´Gilvy & Mather, que tiene un basta experiencia en el desarrollo de campañas de comunicación interna. Es así como se le GLR YLGD DO SUR\HFWR ³$EUt ORV RMRV´ FRQ HO REMHWLYR GH GHVWHUUDU OD LGHD LQVWDODGD HQ PXFKRV GH ORV
empleDGRV GH OD HPSUHVD GH TXH ³QR OHV SRGtD SDVDU QDGD SRUTXH HO WUDEDMR OR KDFtDQ KDFH DxRV´ ³QR
QHFHVLWDEDQFXPSOLUODVUHJODVGHRURGHODVHJXULGDGSRUTXHHVRHUDSDUDQRYDWRV´ En este sentido nuestra estrategia fue desterrar la idea de que a un trabajador experimentado no le puede ocurrir ningún accidente y que por este motivo no necesita utilizar todos los elementos de seguridad necesarios para realizar un trabajo seguro. Nuestra táctica para desarrollar esta idea fue destacar que incluso en las actividades que realizamos a diario es necesario mantener los ojos bien abiertos y que no se nos ocurriría manejar con los ojos vendados, ni cruzar la calle sin mirar. El tono de comunicación fue informal, con el fin de que nuestro target se sintiese identificado con las situaciones a las que hicimos referencia. Por el público al que nos dirigimos, y por la estrategia misma, consideramos que la mejor forma de llegar a ellos era utilizando lenguaje e imágenes coloquiales, corrientes, desestructuradas y distendidas. La campaña se dividió en dos etapas: > TEASER: destinada a captar la atención de nuestros empleados a través de posters que plantearon una pregunta concientizadora con el propósito de promover la reflexión de nuestros empleados: ¿Cruzarías la calle con los ojos vendados? ¿Manejarías con los ojos vendados? Estas frases fueron acompañadas por imágenes en las que se estaban llevando a cabo estas acciones con una venda en los ojos. > DEVELACIÓN: destinada a revelar la incógnita planteada en la etapa anterior. Se utilizaron nuevos SRVWHUV EDMR HO VORJDQ ³$EUt ORV RMRV´ KDFLHQGR SULQFLSDO IRFR HQ ODV FLQFR UHJODV GH RUR TXH KD\ TXH
cumplir para realizar un trabajo seguro: 1-­ Cortar en forma efectiva todas las fuentes de tensión 2-­ Bloquear en posición de apertura los elementos de corte 3-­ Verificar la ausencia de tensión 4-­ Poner a tierra y en cortocicuito 5-­ Delimitar y señalizar la zona de trabajo Para asegurarnos que la campaña tuviese una llegada real a cada uno de los trabajadores, con el recibo de sueldo se les envío una carta firmada por el Gerente General, en la cual se planteaba el compromiso que adoptó la empresa hace años con respecto a la seguridad. Acompañando esta carta se les envío un folleto con la imagen de un hombre con los ojos cuELHUWRVSRUXQDYHQGDFRQODIUDVH³$EUtORVRMRV´TXH
al correrla se podía apreciar una mirada descubierta y se accedía a una serie de recomendaciones sobre HVWH WHPD $GHPiV WDPELpQ VH HQWUHJDURQ OODYHURV FRQ OD LQVLJQLD ³/D VHJXULGDG HV XQ FRPSURPLVR de WRGRV´ Como complemento de esta campaña, EDESUR desarrolló una jornada de seguridad laboral en la que se presentaron diferentes trabajos con riesgo eléctrico y de altura, que los empleados de las empresas contratistas debían ejecutar. Los inspectores designados controlaron que las tareas se realizaran de acuerdo a los procedimientos establecidos y utilizando los elementos de protección específicos, puntuando a cada grupo de trabajo. Al final de la jornada se otorgaron premios a los equipos con un mejor desempeño en instalaciones áereas y Subterráneas. )LQDOPHQWH VH UHDOL]y XQ ³7RXU GH OD 6HJXULGDG´ TXH VH FDUDFWHUL]y SRU HO GHVDUUROOR GH GLVWLQWDV
actividades de concientización en los principales edificios de la Compañía. Se le planteó al personal operativo una serie de ejercicios simples que se debían realizar con los ojos vendados o representando alguna otra incapacidad, con el fin de demostrar que por más cotidianas que puedan ser las actividades no es fácil realizarlas de esta manera. Conclusiones: Con el lanzamiento de la primera etapa y los primeros posters colocados en los lugares más concurridos de todos los edificios de la empresa, comenzó la incertidumbre. En los pasillos y en los ascensores los trabajadores no dejaban de preguntarse unos a otros si sabían algo sobre el significado de los afiches. Con la puesta en marcha de la segunda etapa los comentarios no tardaron en llegar: ³(VDOJRQRYHGRVRRULJLQDOPHOODPyODDWHQFLyQ´5LFDUGR3HUFLFK*HUHQWHGH'HVDUUROOR\0DQWHQLPLHQWR
MT/BT ± Capital ³(V DOJR TXH QXQFD VH KDEtD KHFKR PH SDUHFLy PX\ RULJLQDO \ FUHDWLYR´ 5XEpQ &DUQHYDOL *HUHQWH GH
Sucursal Ribera Sur ³/DFDPSDxDVHGHVWDFyYLVXDOPHQWH´/HRQDUGR%DYDVWURGH6HUYLFLRGH$WHQFLyQGH(PHUJHQFLDV ³/DV SULPHUDV IRWRV VLQ TXH todavía se supiese de que se trataba la campaña, llamaban mucho la DWHQFLyQ´&ODXGLR&HVDUHWWL6XSHUYLVRUGHREUDV07%7 Estamos muy conformes con las repercusiones de la campaña ya que logramos uno de nuestros principales objetivos, captar la atención de los empleados para invitarlos a la reflexión. En materia de seguridad los resultados no se pueden medir de manera inmediata, pero estamos en condiciones de decir que el mensaje que se buscó transmitir llegó de la manera esperada a nuestros trabajadores. Sabemos que la seguridad es un compromiso que debemos asumir a diario y estamos dispuestos a aceptar esa responsabilidad, porque confiamos en que la información es la mejor herramienta para evitar accidentes. PREMIOS EIKON 2010 Categoría: Comunicación Interna (Regional) Caso: Comunica 2.0 Empresa: Telefónica de Latinoamérica Integrantes: Por Telefónica: Pablo Fuentes Sodupe, Gerente de Comunicación Interna de Telefónica Latinoamérica Por Llorente & Cuenca: Adolfo Corujo, Director Senior de Comunicación Online de LLORENTE & CUENCA 1. Introducción ³&2081,&$ ´ HV XQ SUR\HFWR SXHVWR HQ PDUFKD SRU HO iUHD GH FRPXQLFDFLyQ LQWHUQD GH 7HOHIyQLFD
Latinoamérica, con la misión de dotar a los profesionales de compañía de las herramientas de comunicación interna necesarias para construir un entorno más participativo. Un modelo que permite aprovechar el potencial de una red de 60.000 empleados en 13 países de la región, que contribuye a identificar y orientar el talento, generar conocimiento y consolidar el sentimiento de pertenencia. Es decir, Comunica 2.0 se marcó el objetivo de añadir a las herramientas y contenidos que ya ofrece la Intranet, otras que el empleado está acostumbrado a utilizar en su casa pero de las que sin embargo no se puede beneficiar en su trabajo diario. ¿De qué herramientas hablamos? De una wiki interna, un ecosistema de blogs, y una red social. Cuando Telefónica, un proveedor mundial de soluciones de comunicaciones, información y entretenimiento (con más de 250 millones de clientes) se puso en contacto con LLORENTE & CUENCA para que le SURSXVLHUDVROXFLRQHVDVXVSUREOHPDVGHFRPXQLFDFLyQLQWHUQDQRVLPDJLQDPRVTXHOD³FRQH[LyQ´GHEtD
ser la clave. La empresa se enfrenta a desafíos constantes en los procesos y el flujo de comunicación interna: diferentes países e idiomas diferentes, pero un propósito único. LLORENTE & CUENCA propuso un cambio en su modelo de comunicación interna de un sistema estático, unidireccional (Web 1.0) al modelo dinámico inherente a la Web 2.0. El proyecto supuso la implementación a nivel masivo de herramientas de comunicación 2.0 en un entorno corporativo multicultural con la participación de muchos países, materializando las posibilidades que ofrece la evolución de la comunicación interna en el día de la empresa y su consecuente beneficio en el buen funcionamiento de una empresa internacional. Acerca de Telefónica Latinoamérica La principal actividad de Telefónica Latinoamérica es la explotación de servicios de telefonía fija, móvil y banda ancha en América Latina, alcanzando presencia en todos los mercados clave de Latinoamérica: Argentina, Brasil, Chile, Colombia, Ecuador, El Salvador, Estados Unidos, Guatemala, México, Nicaragua, Panamá, Perú, Puerto Rico, Uruguay y Venezuela. Adicionalmente gestiona la oficina de Telefónica en China y la alianza con China Netcom. Punto de Partida Telefónica se enfrentaba la necesidad de eliminar las barreras culturales entre los países (Brasil, Argentina, Chile, Perú, Colombia, Ecuador, El Salvador, Guatemala, México, Nicaragua, Panamá, España, Uruguay y Venezuela) y normalizar los canales de comunicación entre los empleados en América Latina y España. El objetivo Los desafíos en el punto de partida no carecían de peso: Transformar a Telefónica en una empresa más participativa, innovadora y flexible. Superar las barreras culturales en la organización. Mejorar el sentimiento de pertenencia y el reconocimiento de sus empleados. De forma gradual, las pautas de colaboración se integrarán en la forma en que trabajan la empresa. La clave reside en la manera de difundir la iniciativa entre los equipos de trabajo. Los riesgos aumentan si el análisis previo de las necesidades de cada caso en concreto es superficial. Este tipo de iniciativas pueden mejorar la productividad a través de una mayor colaboración y mayor retención del conocimiento. La estrategia de trabajo Dado que Telefónica Latinoamérica es una empresa multicultural con diversos canales de comunicación, la estrategia propuesta por LLORENTE & CUENCA a Telefónica fue dar un primer paso mediante el desarrollo de una plataforma Wiki interna a la que pudieran tener acceso a todos los empleados, lo que les permitiría realizar consultas y crear su propio contenido. Los puntos clave de esta estrategia fueron los siguientes: Proporcionar a Telefónica una herramienta de generación de contenido. Estimular la colaboración entre los empleados. Aprovechar el potencial de sus empleados por completo. 2. Ejecución del plan El primer paso fue llevar a cabo una minuciosa labor de benchmarking para conocer mejores prácticas en ³(QWHUSULVH´\GHWHUPLQDUIDFWRUHVGHp[LWR A partir de ahí, se comenzó a trabajar intensamente con todos los equipos de comunicación interna de la región en una fase piloto para poner en marcha el primer gran reto, la Wiki T-­Latam. Desde el inicio se involucró también a áreas clave para el éxito del proyecto, como Recursos Humanos y Secretaría General de TISA, así como Sistemas de Información Global y Seguridad Corporativa. En total, un equipo de trabajo de más de 40 personas. Durante la fase piloto de la Wiki T-­/DWDP XQ DVSHFWR IXQGDPHQWDO IXH LGHQWLILFDU D ³ZLNLJXtDV´ HQ OD
región, empleados de distintas áreas con perfil de earlyadopters que han jugado un papel clave a la hora de generar contenidos y contribuir a la correcta evolución de la herramienta. En apenas tres meses, el proyecto contaba ya con cerca de 400 Wikiguías de todos los países, que posteriormente han ayudado a prescribir y promocionar la Wiki T-­Latam entre sus compañeros. Concluida la fase piloto, el proyecto se presentó en el Comité de Dirección de Telefónica Latinoamérica, donde se acordó el lanzamiento masivo de la Wiki T-­Latam en noviembre de 2009. Éste vino acompañado de una fuerte campaña de promoción en los canales online, así como de merchandising y cartelería. En paralelo, recientemente se ha lanzado el Blog El Semanal, que permite sinergias de contenido con la Wiki y que es un primer paso hacia un ecosistema de blogs en el que las áreas y cualquier empleado puedan interactuar con el resto de la organización. Comunica 2.0 seguirá evolucionando con la experiencia y colaboración colectiva. Además, siempre en línea con el objetivo de aprovechar mejores prácticas y sinergias dentro de la compañía, los resultados del proyecto permitirán evaluar más en detalle los beneficios de una comunicación interna basada en un entorno 2.0, y valorar su implementación para todo el Grupo. El concepto Wiki La Wiki T-­Latam es una enciclopedia interna en la que cualquier empleado puede consultar o editar un WpUPLQR (O WpUPLQR ³ZLNL´ VLJQLILFD ³UiSLGR´ HQ KDZDLDQR \ HV XQ VLWLR ZHE TXH SHUPLWH D ORV XVXDULRV
crear y modificar contenido de sus páginas de forma rápida y sencilla. Por eso, la Wiki es una herramienta muy efectiva para la escritura colaborativa. En la evolución de la Wiki T-­Latam, la formación a los usuarios es esencial. Además de los tutoriales en la portada de la Wiki, se está impulsando un plan de formación. Por ejemplo, en Venezuela las áreas de Comunicación Interna y Desarrollo Organizacional van a ofrecer al 25% de la plantilla un programa específico de entrenamiento en los nuevos medios de comunicación 2.0 en 2010. En Colombia, durante el lanzamiento de la Wiki T-­Latam, se habilitaron puntos de información a la entrada de las oficinas. Primeros pasos Presentación del proyecto con un vídeo explicativo para su aprobación por parte de la Dirección General y departamentos clave como Seguridad, Asesoramiento Legal, Recursos Humanos y Tecnología. Sesiones de trabajo con la participación de grupos de comunicación locales en Buenos Aires, Bogotá y Lima. Divulgación de la importancia de la diversidad cultural mediante la inclusión de plataformas en dos idiomas diferentes: español y portugués. Desarrollo del proyecto por fases específicas. 10 claves para el éxito de la Wiki El impacto comunicativo de un proyecto de estas características implica la descripción de una serie de puntos clave que hay que tener en cuenta para asegurar el éxito del proyecto y que se han tenido en cuenta desde el primer momento de desarrollo del mismo. La involucración de los líderes. La implicación de la Dirección es un factor decisivo para el éxito del proyecto. Un trabajo en equipo. Un proyecto de esta naturaleza involucra a muchas áreas de una compañía: Legal, RRHH, Riesgos, Seguridad, etc. La canalización de todas sus aportaciones a través de un pequeño Comité aportan valor y conocimiento desde el arranque. Una cabeza visible. Es básico identificar con claridad al inicio cuál es el departamento líder del proyecto, qué recursos va a destinar a su desarrollo y quiénes van a ser las personas que desempeñen la función de super administradores de la estructura, delimitando claramente su listado de funciones. Imprescindibles: Wikichampion y WikiGardener. La figura del Wikichampion es esencial para el éxito, ya que se es capaz de generar comunidad, despertar interés en el proyecto y animar a otros a que colaboren activamente. El WikiGardener es una persona que se ocupa de reestructurar y sintetizar contenidos de forma que sean más sencillos de consumir, ya que la mayoría de los usuarios prefieren escribir artículos a estructurar y ordenar la información. /DMHUDUTXL]DFLyQGHXVXDULRV3RGHPRVFODVLILFDUORVXVXDULRVHQWUHVJUDQGHVJUXSRVORV³HDUO\DGRSWHUV´ personas especialmente interesadas en la innovación y el uso de nuevas tecnologías;; el usuario, y los usuarios escépticos. Avanzar sin prisa pero sin pausa. Para tener mayor control sobre el proceso y gestionar de manera satisfactoria las expectativas de los usuarios es recomendable que se vayan incorporando a la utilización de la herramienta en distintas fases. Nos conocemos. En un entorno corporativo tiene más sentido en la mayoría de las aplicaciones con tecnología wiki promuevan el reconocimiento de los usuarios para fortalecer el espíritu de equipo y ponerse cara. Las reglas del juego. Definir un propósito para la aplicación wiki, así como unas reglas básicas de uso y comportamiento ante la aplicación y su contenido. La política de contenidos. El uso de una aplicación wiki no implica la misma visibilidad y permisos de acceso para todos los participantes. Existirán determinados contenidos que necesariamente deberán modificar o incluir ciertos departamentos. El soporte y la formación. La formación a los usuarios con carácter formal en forma de seminarios o cursos breves, y el soporte por parte de miembros del equipo es muy favorable. Las tres fases de ejecución El desarrollo de la Wiki se ejecutó en tres fases: Piloto: creación de contenidos en coordinación con el Departamento de Comunicación Interna. Se formó a los usuarios con cursos de formación específicos. Beta: los principales departamentos implicados comenzaron a participar y se identificó a los evangelizadores con el fin de agregar nuevos usuarios a la Wiki. Producción: se comunicó al resto de los empleados y se identificó a los Campeones de la Wiki que motivaron a otros usuarios a continuar agregando contenido en la Wiki de Comunica 2.0. Implantación En la fase de producción, se creó un plan de comunicación interna con el fin de garantizar que el lanzamiento de la Comunica 2.0 Wiki fuera un éxito. Se segmentó el público y el contenido de comunicación dirigido a cada uno de ellos. Las acciones se centraron en tres audiencias principales: Los líderes. Gerentes de Área en los diferentes países que conforman el equipo de Telefónica Latinoamérica. Wikiguides. Un grupo de 6-­10 empleados de cada país, cuya misión era la de motivar a sus compañeros a suscribirse a la Wiki. Se llevó generó una campaña teaser antes del nombramiento de Wikiguides. Earlyadopters. Los primeros usuarios invitados por los Wikiguides. Fueron los encargados de generar contenido y de difundir la existencia de la Wiki entre el resto de empleados de la compañía. Desarrollo del ecosistema de Blogs El desarrollo del ecosistema de blogs en tres etapas: Piloto: creación de blogs privados por departamentos y conversión de los newsletter internos en blogs. Beta: posibilidad de crear blogs temáticos. Producción: comunicación a todos los empleados y colaboración de los empleados en la creación de contenidos dentro del ecosistema de blogs posibilidad de creación de blogs por parte del personal. Esta fase del proyecto está actualmente en desarrollo. El siguiente paso, cuando el ecosistema de blogs esté en producción, se implementará una red social para empelados de Telefónica Latinoamérica. 3. Evaluación Del trabajo en equipo realizado durante estos meses podemos obtener cifras, pero sobre todo comentarios del propio personal de la empresa manifestando su satisfacción con el proyecto Comunica 2.0. Testimonios de empleados: &pVDU$XJXVWR)XHQWHV:LNLJXtDGH&RORPELD³OD:LNL7-­Latam viene a suplir una necesidad que teníamos en el área, ya que manejamos terminología técnica que muchas personas no conocen y a través de la Wiki YDQ D WHQHU OD LQIRUPDFLyQ GH SULPHUD PDQR´ &pVDU DxDGH TXH ³VHU :LNLJXtD KD VLGR XQD H[SHULHQFLD
innovadora. Además, algunos países de la región me han escrito para recibir más información de las notas publicDGDVHQOD:LNL´ Carlos Prince, Líder de Equipo y primer empleado de Telefónica Venezuela que publicó información, señala TXH pVWD³HVXQDH[FHOHQWH KHUUDPLHQWDTXHQRVSHUPLWHREWHQHULQIRUPDFLyQGHWHUPLQRORJtDSURFHVRV
proyectos y departamentos;; además, brinda la posibilidad de dar a conocer, de forma sencilla, qué cosas KDFHPRV\FyPRODVKDFHPRVIRPHQWDUODFRQWULEXFLyQGHLGHDVPHMRUDVGLVFXVLRQHVHWF´ Datos de satisfacción de la encuesta realizada por LLORENTE & CUENCA en mayo de 2010: El 91% de los empleados encuestados están muy satisfechos con los canales de comunicación internos de Telefónica. La Wiki cuenta ya con más de 2.870 páginas. 2.724 usuarios registrados, de los cuales más del 60% se registraron inmediatamente después de su lanzamiento. 4.485 artículos creados por los usuarios. 247.091 visitas totales. Dado el éxito del proyecto, se ha iniciado el desarrollo de otros canales;; el ecosistema de blogs y la posterior implantación de una red social. PREMIOS EIKON 2010 Categoría: Issues Management Caso: La Rural te cuida Empresa: La Rural Agencia de PR: SRA Integrantes: Por La Rural: Juan Pablo Maglier, Director de Relaciones Institucionales;; Leticia Guolo, Jefa de Relaciones Institucionales;; Jorgelina Guandalini, Jefa de Prensa. Por SRA: Roberto Fernández Speroni, Director de Prensa;; Sebastián Dates, Jefe de Prensa. Introducción Historia y naturaleza de la compañía Creada en 1866, la Sociedad Rural Argentina (SRA) es una organización que agrupa a productores agropecuarios de la Argentina y que tiene por objetivo fundacional fomentar el desarrollo del país y promover el mejoramiento de la vida rural en todos sus aspectos, así como el de sus industrias complementarias y derivadas, asumiendo la más eficaz defensa de los intereses agropecuarios. En 1878 la SRA comienza a celebrar la Exposición Nacional de Ganadería en su predio de Palermo, inaugurando allí el recinto ferial La Rural. Con el correr del siglo, la tradicional feria ganadera se convirtió en un clásico de cada año y fue, desde sus comienzos, punto de encuentro de los grupos más diversos de la sociedad local y de la dirigencia nacional. Hacia fines del siglo XXI, se remodelan las oficinas y pabellones de La Rural y se convierte en un complejo con una infraestructura de tecnología e inmobiliaria de última generación. Más tarde, en el año 2002, el Grupo de Narváez asume el gerenciamiento del predio, genera un replanteo de negocio y un reposicionamiento de La Rural como compañía, con un modelo de gestión dinámico y diversificado. Desde ese entonces, La Rural S.A. divide su paquete accionario en partes iguales entre la Sociedad Rural Argentina y el Grupo de Narváez. Así es como hoy La Rural, Predio Ferial de Buenos Aires es el recinto ferial más importante del país y de Latinoamérica. En 2009, albergó 40 ferias y exposiciones, 57 congresos y convenciones, más de 60 eventos empresariales y cerca de 30 eventos sociales, que recibieron a casi 4 millones de visitantes. Y se calcula que sólo en ese año, gracias a su actividad, La Rural generó directa e indirectamente más de 50.000 oportunidades de empleo. Entre las ferias y eventos más destacados, en 2009 La Rural fue escenario de arteBA, Feria del Libro, Feria Puro Diseño, el Congreso Forestal Mundial y el 24º Congreso Mundial del Gas. Además, La Rural participó en la organización del espacio Village Dakar del Rally Dakar Argentina-­Chile, BAFWEEK, ExpoNieve, Vinos y Bodegas, Nuestros Caballos y la tradicional Exposición Rural, entre otras exposiciones. A su vez, por primera vez La Rural se ubicó primera en el ranking anual de complejos del país que albergaron la mayor cantidad de congresos durante el último año que revela anualmente el medio especializado del sector. En los últimos años, La Rural fue evolucionando paulatinamente de su carácter de espacio físico al de compañía integral con misión, visión y valores, y perfil institucional, afianzada en sus productos y servicios. Por esta razón y como ícono de la Ciudad de Buenos Aires, centro receptor de múltiples eventos y negocios y punto de encuentro de millones de visitantes, La Rural tiene, siente y cree en el compromiso de contribuir con la sustentabilidad medioambiental y el desarrollo humano de su entorno. De este modo, La Rural cuenta con un plan de Responsabilidad Social Empresaria que incorpora permanentemente nuevas iniciativas y proyectos. Causas por la cual se implementó el plan El virus de la influenza A (H1N1) (también llamado virus de la gripe porcina) arribó a la Argentina a fines de abril del 2009. De esta manera, la Argentina se convirtió en el octavo país en reportar casos de gripe A en el continente americano. El tema se instaló muy fuertemente en la opinión pública a través de los medios. Las campañas oficiales iniciales no alcanzaron a generar la tranquilidad necesaria en la población y, muy pronto, la alarma e inquietud generalizada de la población pusieron al sistema sanitario público y privado al borde del colapso operativo. En la Ciudad de Buenos Aires la suspensión total en algunos sectores como la educación y administración pública ya era un hecho;; en tanto que el miedo al contagio provocó una fuerte caída en la actividad turística y de entretenimiento y la merma en el transporte y comercio. Los teatros cerraron;; los cines se encontraban vacíos, la gastronomía y los hoteles, fueron algunos de los rubros más afectados. Se decretó la emergencia sanitaria en la Ciudad y se hablaba cada vez más del posible cierre de acontecimientos que impliquen aglomeraciones masivas de personas o directamente de la suspensión total de todo tipo de actividades, tal como había se implementado previamente en México. En este escenario, La Rural S.A. y la SRA ultimaban los últimos preparativos para llevar adelante la tradicional Exposición Rural, la mayor muestra agroindustrial del mundo con un promedio de concurrencia anual cercano al millón de visitantes, que abriría sus puertas desde el 24 de julio al 4 de agosto. Objetivos del Plan La Rural se preparó para enfrentar esta contingencia inédita y generó un plan con los siguientes objetivos: -­ Evitar que se la Exposición Rural sea percibida como un foco de contagio y minimizar el impacto de la pandemia en la taquilla del evento -­ Transmitir seguridad sobre la realización de la muestra a los expositores que habían invertido en su participación y estaban culminando sus preparativos -­ Resguardar la imagen de la compañía ante la decisión de llevar adelante una muestra masiva bajo este contexto -­ Apoyar la continuidad de la industria ferial y de eventos, demostrando que era posible llevar adelante exitosamente eventos masivos y que no era necesaria la suspensión de actividades Públicos a los que apuntó la campaña -­ Público interno: empleados propios y eventuales, contratados para la exposición -­ Público externo: expositores de la Exposición Rural;; público general y visitantes, Gobierno y Prensa. Ejecución La estrategia de comunicación se basó en el discurso emanado por las autoridades sanitarias del ámbito público y privado en el sentido de que si se adoptaban las medidas de prevención e higiene necesarias era posible continuar desarrollando las actividades cotidianas y realizar una vida normal, sin la necesidad de impedir la realización de eventos masivos. El Plan se articuló bajo dos consignas claras: 1. concientización e incentivo a la profilaxis propia 2. comunicación de las acciones preventivas implementadas en el predio Acciones Definición de postura institucional Se creó una postura institucional clara y definida que se transmitió a toda la organización y hacia el exterior. Se fue actualizando 6HFUHyXQ³&DOO&HQWHU´SDUDUHFHSFLyQGHLQTXLHWXGHV\WUDQVPLVLyQGHOPHQVDMH Legitimación externa Se apeló a la legitimación externa que aportara credibilidad y apoyo a las medidas implementadas por la compañía. La campaña de concientización, medidas de prevención y sintomatología remitió al Ministerio de Salud de La Ciudad, con cuyo ministro se mantuvo una reunión. Asimismo, se buscó el aval profesional, asesoramiento sanitario y médico del Instituto Stamboulian y la Asociación Civil Gestión en Salud. Se brindaron talleres informativos al personal, se sumaron sus testimonios a la campaña de prensa y se gestionó la presencia de equipos médicos que recorrieron la muestra para monitoreo y detección de eventuales casos de influenza entre el personal y minimizar así los riegos de contagio. Al mismo tiempo se recurrió al aval del sector ferial. A través de AOCA (Asociación Argentina de Organizadores y Proveedores de Exposiciones y Congresos) se promovió la gestión de prensa sobre medidas implementadas por el sector para el desarrollo normal de la actividad. Ante las decisiones individuales de otros organizadores de postergar sus eventos, se propuso la confección de una gacetilla sugerida para que al comunicar la postergación el mensaje trasmita claramente que se trataba de una decisión particular y evitar generar pánico sobre la actividad en su conjunto. Se apeló a AFIDA (Asociación Internacional de Ferias de América) para que recurriera al aval de la OPS (Organización Panamericana de la Salud) sobre la continuidad de la realización de eventos tomando las medidas preventivas adecuadas. Profundización de medidas de higiene Se comunicaron las medidas sanitarias y de higiene del predio que se instrumentaron en el predio, de acuerdo a lo sugerido por al asesoramiento de especialistas sanitaristas: el incremento de la frecuencia del lavado con lavandina diluida en agua de superficies, la ventilación de pabellones, colocación de jabón bactericida en todos los baños, junto con su correspondiente instructivo para permitir el correcto lavado de manos, y se instalaron dispensers con alcohol en gel en puntos clave de circulación. Programa de Identidad visual Se estableció que el impacto visual tendría una gran relevancia estratégica en la percepción de los S~EOLFRV 6H JHQHUy XQ 3URJUDPD GH ,GHQWLGDG 9LVXDO \ 6HxDOpWLFD ³DG KRF´ EDMR HO VORJDQ ³/D 5XUDO WH
FXLGD´LQFOX\HQGR³/DSUHYHQFLyQHVQXHVWUDPHMRUGHIHQVD´\³&XLGDPRVHOELHQHVWDUGHQXHVWUDJHQWH\
de quienes nos visiWDQ´ (OLPSDFWRYLVXDOVHIRUWDOHFLyFRQODFRORFDFLyQGH³GLVSHQVHUV´GHDOFRKROHQJHOHQSXQWRVHVWUDWpJLFRV\
la presencia visible de personal de limpieza realizando permanentemente tareas de higiene. Herramientas y canales de comunicación interna ‡ Afiches informativos sobre medidas de prevención, sintomatología y teléfono de consultas: colocación en baños, ascensores y lugares de acceso del personal ‡ Folletos con medidas preventivas, sintomatología y teléfono para consultas: entrega junto con recibo de sueldo ‡ Charlas informativas con médicos especializados ‡ Comunicados internos a gerentes y directivos para fomentar que empleados con síntomas no acudan a trabajar y licencia a embarazadas y empleados en grupos de riesgo ‡ Envío permanente de comunicaciones internas sobre medidas implementadas, postura institucional, y mensajes de concientización de acuerdo al avance de la pandemia Herramientas y canales de comunicación externa ‡ Carta institucional con postura Gripe A para que los Gerentes de distintas áreas puedan enviar a expositores y contactos clave ‡ Banner en home del sitio web institucional www.larural.com.ar y en el sitio web de la Exposición Rural www.exporural.com.ar donde se concentró toda la informacion sobre la Gripe A: prevención, sintomatología, postura institucional, noticias publicadas, etc. ‡ Afiches y cartelería con medidas preventivas y con acciones realizadas en el predio: Se colocaron en espacios de circulación del predio, seis formatos de comunicación diferentes dirigidos a distintos públicos y, en algunos casos, con mensajes adaptados a dichos públicos ‡ Folletos con medidas de prevención, sintomatología y teléfono para consultas que se entregaron en boleterías de Expo Rural, Centros de informes, Relaciones Institucionales, Sala de Prensa y oficinas de contacto con el público y expositores ‡ Publicación de publicidad gráfica con campaña de prevención, dentro del Catalógo oficial de la Exposición Rural ‡ Video proyectado en pantallas gigantes durante la muestra Suspensión de la presencia de ejemplares porcinos Basándose en la resolución 489/2009 del SENASA que declara el estado de alerta sanitaria por presencia de Gripe A en porcinos, se decidió voluntariamente la suspensión de la presencia de porcinos en la muestra, como una medida impactante con el principal objetivo de generar la percepción en el público de que los organizadores de la muestra estaban realmente tomando los recaudos necesarios para minimizar los riesgos de contagio. Estrategia de prensa Con la prensa se concibió una estrategia controlada de comunicación, para evitar generar que se otorgue a la temática mayor relevancia de la deseada. Para ello se seleccionaron mensajes concisos vinculados a decisiones impactantes como la suspensión de la presencia de ejemplares porcinos o el respaldo brindado por el Ministerio de Salud del Gobierno de la Ciudad de Buenos Aires. También se trabajaron mensajes ligados a la importancia de la Feria como fuente de empleo directo e indirecto no sólo en la ciudad sino en todo el país. Se definieron claramente los voceros de SRA y La Rural que podrían dar declaraciones sobre la temática y quieres contaron con un completo Q&A (Preguntas y respuestas) para estar preparados ante preguntas de todo tipo y contar con mensajes unificados. Resultados Con casi 850 mil visitantes, 1.700 animales en competencia, más de 400 expositores y 1.800 periodistas acreditados, la edición 2009 de la Exposición Rural tuvo un gran éxito de convocatoria, fue el único evento masivo realizado durante el invierno en la Ciudad y no registró contingencias vinculadas a la pandemia de la Gripe A. Las medidas implementadas por La Rural fueron evaluadas por el Ministro de Salud del Gobierno de la Ciudad Autónoma de Buenos Aires, Dr. Jorge Lemus, quien soVWXYRTXHODH[SRVLFLyQIXHXQD³H[FHOHQWH
RSRUWXQLGDGSDUDGLIXQGLUORVPHFDQLVPRVGHSUHYHQFLyQHQWUHODSREODFLyQ´ En las 230 notas publicadas sobre la exposición en medios gráficos nacionales, 37.11 hs. de cobertura televisiva y 23.57 hs. de cobertura radial no se realizaron cuestionamientos a la compañía, por el contrario, muchos medios destacaron el trabajo preventivo desarrollado y el tema no tomó mayor relevancia. La situación de crisis se convirtió en una oportunidad para contribuir al posicionamiento de La Rural como una empresa socialmente responsable y de la Exposición Rural como un espacio propicio para la prevención y la concientización de la sociedad. PREMIOS EIKON 2010 Categoría: Issues Management Caso: 25 de Mayo de 2010. Una Argentina posible Empresa: Banco Galicia Integrantes: Por Banco Galicia: Diego Videla, Gerente Asuntos Institucionales Banco Galicia Introducción Acerca de Banco Galicia Fundado en 1905, Galicia es uno de los principales bancos privados de capitales nacionales del sistema financiero de la Argentina. Ocupa el 4° puesto en depósitos totales en el ranking de bancos privados del país. A través de sus canales de distribución, tradicionales y alternativos, comercializa una amplia gama de productos y servicios financieros para personas y empresas. Su objetivo es ser una de las entidades líderes en la prestación de servicios financieros integrales del país. El principal accionista del Banco es el Grupo Financiero Galicia S.A., sociedad holding de servicios financieros, que posee 94.66% del capital social del Banco. Sus clientes cuentan con acceso a servicios de banca telefónica;; e-­galicia.com -­el primer portal financiero en Internet creado en el país-­ ;; el primer servicio de pagos mediante el teléfono celular, Galicia Móvil;; y Galicia Compras, el servicio de comercio electrónico entre empresas del Banco. Tiene una cartera de 1.982.543 clientes, 5028 empleados y una fuerte presencia en todo el país a través de su red de 237 sucursales. A partir del segundo trimestre de 2008, el Banco renovó su identidad visual para proyectar una imagen más cercana, dinámica y eficiente que represente la historia de la empresa, su prestigio en el mercado financiero luego de 103 años de constancia y compromiso con sus públicos, y una mirada innovadora hacia el futuro. Situación Desde su fundación, Banco Galicia buscó tender lazos con la comunidad en la que estaba inserto, convencido como institución de que sólo en una sociedad próspera una empresa puede crecer y afianzarse. Ciento cinco años después mantiene firme ese compromiso y trabaja en diferentes áreas con el propósito de contribuir, con acciones concretas y visibles, al bienestar de la sociedad. Es que a Banco Galicia, como empresa nacional, le interesa y está comprometido con el crecimiento del país, la marcha de su economía y la prosperidad de los argentinos. Así, desde el año 2004, el Banco-­ a través de su departamento de Asuntos Institucionales-­ viene desarrollando de forma continua diversas actividades, orientadas a reforzar el vínculo con la comunidad, contribuyendo así al desarrollo de las personas y de la Nación. Estas actividades tienen como ejes la salud y el bienestar de la persona, la educación y la cultura, y el desarrollo social. De esta manera, en el marco del año del centenario del Banco se crearon tres programas de acción: Galicia Cultura, Galicia Participación Ciudadana y Galicia Deportes. En los últimos años, el Banco llevó adelante cientos de acciones que convocaron y llegaron a un público amplísimo. Algunas de ellas fueron: -­Restauraciones del Patrimonio histórico, tales como la Catedral de Mar del Plata, el Monumento a San Martín en Córdoba y el Monumento de Manuel Belgrano en Rosario. -­Actividades deportivas como el Maratón por Equipos -­Auspicios y desarrollo de actividades culturales -­Promoción de la educación -­Organización de ciclos de conferencias sobre temas filosóficos y culturales Siguiendo esta línea de trabajo, y con el compromiso de siempre, el Banco -­en ocasión del Bicentenario de la Patria-­, quiso realizar un nuevo aporte. Es así como decidió editar el libro 25 de Mayo de 2010. Una Argentina posible con el propósito de ofrecer a la sociedad argentina un material de calidad para reflexionar sobre estos 200 años de historia y delinear perspectivas futuras. 25 de Mayo de 2010. Una Argentina posible Banco Galicia buscó ser siempre un actor activo para el cambio social. Como miembro de la comunidad en la que está inserto participa en espacios de debates y reflexión que promuevan la discusión de temas claves para el desarrollo de la Argentina. Comprometido con el crecimiento del país, se involucra en diferentes tipos de actividades e incentiva así la construcción de una sociedad próspera. El Bicentenario de la Patria era un contexto propicio para realizar un aporte único. El Banco decidió, entonces, poner al alcance de todos una obra valiosa que permitiera incentivar la reflexión sobre nuestro país. De esta manera, editó-­junto con la Biblioteca Nacional-­ el libro 25 de Mayo de 2010. Una Argentina Posible que compila las reflexiones de 22 destacados intelectuales convocados por el Banco, entre 2004 y HQHO&LFOR³/D$UJHQWLQD3RVLEOH´SDUDSHQVDUQXHVWURSDtVHQYtVSHUDVDOQXHYR&HQWHQDULRGHOD
Patria. La actualidad de las miradas plasmadas en cada encuentro hace que cada palabra siga aún vigente. Este Ciclo surgió de la necesidad que detectó el Banco de incentivar la reflexión y el análisis de los sucesos argentinos. La última crisis (2001) había revelado la falta de debate de ideas y la debilidad de las instituciones. Era necesario entonces dar respuesta a una serie de interrogantes instalados en la sociedad, aportar sugerencias y proyectos para construir un país con vistas al segundo Centenario de la Revolución de Mayo. En ese marco, el Banco decidió crear un espacio propicio para el debate e intercambio de ideas a fin de repensar el país para encarar un futuro mejor. En abril de 2004, se inició el ciclo de conferencias cuyos expositores fueron destacados pensadores convocados para explicar en qué situación se encontraba la Argentina en distintas áreas, qué es lo que se había hecho-­ bien o mal-­ a lo largo de la historia, ver cuáles eran las asignaturas pendientes y qué se debería cambiar y cómo. Participaron de ese primer ciclo, que se extendió durante dos años (2004-­2006), diversos pensadores tales como: Santiago Kovadloff, Natalio Botana, Mariano Narodowski, Guillermo Jaim Etcheverry, entre otros. La riqueza de aquellas reflexiones hoy integra el libro presentado. Objetivo general A través del libro 25 de Mayo de 2010. Una Argentina Posible, se busca difundir diferentes opiniones, reflexiones y análisis sobre la Argentina para contribuir al debate de ideas, tan necesario en nuestro país, y poner al alcance del público en general un valioso material de lectura. Metas ‡ Contribuir a la difusión del pensamiento de destacados intelectuales, referentes en distintos campos, para generar un aporte a la hora de pensar y analizar la Argentina. ‡ Favorecer la generación de ideas a fin de repensar nuestro país en su segundo Centenario, delineando de este modo una mirada positiva hacia el futuro. ‡ Contribuir a la pluralidad de ideas y a la construcción de una democracia de mejor calidad. ‡ Acercar gratuitamente este material a Bibliotecas, Centros de Estudios, Academias, Dependencias gubernamentales, Universidades, Organizaciones, entre otros. ‡ Afianzar la imagen del Banco como una institución confiable comprometida con el país y su devenir. Público El libro es una obra pensada y creada para que llegue, directa o indirectamente, a toda la comunidad, en tanto busca delinear una mirada distinta sobre el devenir nacional. 2000 ejemplares fueron donados a la Biblioteca Nacional tanto para formar parte de su colección y para ser distribuidos. Desde el Banco, la distribución del libro se orientó a líderes de opinión, referentes y educadores capaces, por su rol en la sociedad, de difundir las ideas expuestas al resto de la comunidad. También se le hizo llegar a líderes de empresas, escritores e intelectuales argentinos, representantes de la cultura y el arte;; Academias, Bibliotecas, Universidades, Medios de Comunicación. Ejecución El valioso material recopilado luego de que finalizó el Ciclo ameritaba seguir trabajando en él. No tenía sentido archivarlo y dejar las reflexiones en la memoria de los asistentes. El aporte podía ser mucho mayor aún si se lograba hacerlo llegar a toda la comunidad. El Banco decidió, entonces, editar el libro 25 de mayo de 2010. Una Argentina posible para contribuir a difundir estos pensamientos a todos los argentinos y compartir los testimonios de inigualable calidad intelectual que habían resultado del ciclo de charlas. Roberto Cortés Conde, uno de los historiadores económicos más importantes de América Latina, fue el responsable de compilar el material. Se decidió, luego, trabajar junto con la Biblioteca Nacional en la edición e impresión. Así, esta institución podía acoger en su colección y distribuir en bibliotecas y librerías de todo el país los 2000 ejemplares donados por el Banco. El título del libro responde al país que los argentinos aspiran alcanzar y es el proyecto de país al que Banco Galicia quiere contribuir. El libro comienza con una introducción de Roberto Cortés Conde y luego se encuentran las 22 charlas, editadas y corregidas, en donde cada autor plasma un determinado tema. Se pidieron trabajos sobre áreas específicas para no vagar en generalizaciones y se estableció el índice de temas para lograr la concatenación de las charlas: una introducción general a la ética, los valores y las instituciones para luego seguir con un relato analítico de distintas cuestiones e ir profundizándolas. El índice temático que se desarrolló durante el Ciclo y se mantuvo en el libro, fue el siguiente: 1. Introducción general 2. Del primer al segundo Centenario: la perspectiva histórica 3. La evolución de la institución jurídica y de la política 4. La evolución de la economía global, regional y nacional 5. La educación como motor del cambio y la situación del arte argentino 6. La ética Cada uno de estos macrotemas encuentra en cada autor una bajada concreta y un profundo análisis del tema específico. La idea era poder contar con un análisis de la historia argentina, de los problemas estructurales y eventuales soluciones futuras. Se debía dar una visión plural de la compleja trama argentina del siglo XX. En este sentido, la elección de los disertantes resultó crucial: era importante que aportaran distintas ideologías y reflexiones sobre las cuestiones más relevantes y atrajeran, de este modo, distintos sectores de la comunidad. Así, el valor de las conferencias y del material compilado reside en la calidad de sus autores. Ellos son: Santiago Kovadloff, Natalio Botana, Enrique Valiente Noailles, Ezequiel Gallo, Tulio Halperín Donghi, Juan Carlos Torre, Juan Carlos Portantiero, Carlos Floria, Beatriz Nofal, Aldo Ferrer, Roberto Cortés Conde, Ricardo Arriazu, María Echart, Mariano Narodowski, Gregorio Badeni, Marcela Cristini, Guillermo Jaim Etcheverry, Marcelo Sánchez Sorondo, Alberto Bellucci, Bartolomé de Vedia, Carlos Hoevel y Ramiro Moya. No resultó fácil para una entidad financiera compilar y editar un libro de contenido analítico-­
filosófico. Sin embargo, el equipo de trabajo que se constituyó entre Roberto Cortés Conde, la editora Patricia Piccolini y la Biblioteca Nacional permitió, después de un largo trabajo, presentar la obra este año. Resultados Como forma de evaluar el interés suscitado y la calidad del libro, el Banco buscó obtener una opinión tanto por parte de quienes habían participado en él, como de algunas de las personas que recibieron el ejemplar. Entre los comentarios recibidos, merecen destacarse los siguientes conceptos: ‡ Se trata de un excelente y significativo aporte para los festejos del Bicentenario que contribuye a tomar conciencia de la tarea que como ciudadanos nos compete en la edificación de una Nación fraterna y solidaria. ‡ Resulta un libro de notable actualidad;; las exposiciones contemplan aspectos sustantivos y constantes de los procesos argentinos. ‡ Iniciativas como las llevadas a cabo por el Banco representan un aporte de calidad en una sociedad y un estado necesitados de reflexiones críticas de buena fe. ‡ La excelente calidad del contenido de la publicación refleja el exhaustivo trabajo de compaginación del pensamiento de destacadas personalidades, en el compromiso asumido de acompañar el desarrollo de nuestra Nación de cara al Bicentenario. Esta edición ya forma parte de las principales bibliotecas de la Argentina, así como también de centros universitarios, académicos y de estudio, permitiendo el acceso de toda la comunidad a este contenido, que será un testimonio acerca de cómo veían los argentinos el país en los comienzos del siglo XXI y de cómo pensaban que iban a recibir el segundo centenario de la Revolución de Mayo. Cabe destacar que estas acciones permiten reafirmar el rol social del Banco dentro de la sociedad como generador de conocimientos. El Banco sentó un precedente en esta materia y se posicionó como precursor en la organización de ciclos de filósofos e intelectuales y en la difusión de ideas. Al año siguiente, organizó otro ciclo de conferencias, esta vez dedicado a la literatura. Estas acciones son hoy ejemplo para otras empresas e institución. PREMIOS EIKON 2010 Categoría: Patrocinio o Sponsoring Cultural Caso: Parque Navideño Reciclado Tetra Pak Empresa: Tetra Pak Southern Cone Agencia de PR: PersonAllY Asesores en Comunicación Integrantes: Por Tetra Pak: Esteban Casares, Director de Marketing y Estela Reale, Gerente de Comunicaciones. Por PersonAllY: Marcelo Altuna, Socio Director y Gabriela Salice;; Ejecutiva Sr. de Cuentas. Introducción a) Breve descripción de la compañía A comienzos de la década del 50, el mayor avance en las ciencias de la alimentación llegó al mundo de la mano de Tetra Pak: un innovador sistema de envasado para leche líquida -­el proceso de larga vida-­ que combinó el tratamiento térmico UAT y el envasado aséptico modificando significativamente la forma de manipular los alimentos líquidos sensibles. Desde entonces, década a década Tetra Pak se ha transformado en uno de los principales proveedores del mundo en sistemas de envasado de leche fluida, jugos y bebidas, entre otros productos en más de 165 países. En Argentina está presente desde 1979 y cuenta con oficinas centrales en Buenos Aires, una planta de producción de material de envase en La Rioja, una estación de servicio técnico en San Fernando y otra en Mendoza. b) Nace la Fundación Tetra Pak En 2001 y ante la situación que vivía el país, Tetra Pak creó la FUNDACIÓN TETRA PAK;; asumiendo de esta forma el compromiso cívico de participación con la comunidad. La Fundación permitió canalizar dos ejes de acciones solidarias que ya venían realizándose, alineadas a la filosofía de la compañía y que tenían como objetivo contribuir al bienestar de la sociedad: las donaciones de leche larga vida y las campañas de concientización sobre el reciclado de envases. En 2002, Tetra Pak eligió extender aún más ese compromiso con la sociedad y decidió hacerlo a partir de una acción de patrocinio, con la cual pudiera contribuir a conservar y proteger un activo tan valioso como nuestra propia cultura: asume el padrinazgo de la Plaza Naciones Unidas, donde se aprecia la escultura emblema de la ciudad: La Floralis Genérica, creada y donada por el arquitecto argentino Eduardo Catalano. A partir de ese año, la Fundación Tetra Pak ha realizado 12 eventos culturales y solidarios en la Plaza de la Flor durante la época cercana a la Navidad: cantó desde Mercedes Sosa hasta el Coro de Niños del Teatro Colón;; bailó Iñaki Urlezaga y Maximiliano Guerra y se presentó desde Marino Mores, Bruno Gelber hasta la Orquesta Estable del Teatro Colón. Como resultado de la colaboración del público y donaciones de la Fundación Tetra Pak, se han entregado más de 200.000 litros de leche larga vida a comedores comunitarios de la Ciudad de Buenos a lo largo de los años. c) Causas de la campaña Por un lado, Tetra Pak buscaba renovar la apuesta cultural y artística que año tras año llevaba adelante en la Plaza de la Flor, y así sorprender a la comunidad con una propuesta diferente. Y por otro, aunque se trataban de eventos con artistas destacados y muy atractivos para el público, como los ya mencionados, que representaban un importante aporte de la empresa para acercar la cultura a la comunidad, surgía el desafío de hacerlo a través de una iniciativa que incluyera los mensajes claves y atributos de la marca. ¿Sobre qué atributo de la marca nos apalancamos en 2009? Para Tetra Pak la sustentabilidad del envase es uno de los principales pilares de comunicación sobre los que debe trabajar para posicionar a la marca como medioambientalmente responsable. Y es justamente sobre el mensaje de sustentabilidad donde nos apoyamos para desarrollar la acción cultural, anclado en ser un producto reciclable. d) Público Target ‡ Comunidad & Consumidores. e) Objetivos ‡ Generar una acción de alto impacto que acerque la cultura a la comunidad, a través de una obra popular, de temática navideña y solidaria apalancada en uno de los principales atributos de los envases de Tetra Pak: su reciclabilidad, y a un artista cercano y reconocido. ‡ Continuar posicionando a Tetra Pak como una empresa socialmente responsable y comprometida con el cuidado medioambiental. f) Mensaje clave ‡ Los envases de Tetra Pak protegen el medioambiente porque son 100% reciclables. Plan de acción: Presentamos el Primer Parque Navideño Reciclado Tetra Pak En diciembre de 2009, la Fundación Tetra Pak sorprendió a la Ciudad de Buenos Aires con la presentacion del primer Parque Navideño Reciclado Tetra Pak, hecho enteramente con envases de Tetra Pak reciclados. El parque estuvo abierto durante un mes, desde el 8 de diciembre hasta el 8 de enero del 2010, en la Plaza Naciones Unidas (comúnmente conocida como la Plaza de la Flor). La gran obra artística de Milo Lockett realizada con envases de Tetra Pak usados es la prueba más contundente de la promesa de reciclabilidad de los envases, y que se logró plasmar gracias a la colaboración de la comunidad. La campaña contó con el apoyo y aval del Gobierno de la Ciudad de Buenos Aires, ya que fue declarada de Interés Público debido al espíritu de la campaña que buscaba acercar la cultura a la comunidad, a través de una acción artística, recreativa, educativa y solidaria, con un mensaje en pos del cuidado medioambiental. a) Ejes comunicacionales Para llevar a cabo la campaña se tomaron dos ejes conceptuales fieles a la filosofía de la compañía: COMPROMISO COMUNITARIO (acción cultural & artística popular, benéfica y educativa) y SUSTENTABILIDAD (concientización sobre la reciclabilidad del envase). b) ¿Cómo lo hicimos? b.1) El artista Convocamos al artista plástico argentino Milo Lockett, por ser un reconocido pintor argentino, dueño de un perfil lúdico, colorido y moderno, y de perfil solidario. Él diseñó el parque e intervino los envases post-­
consumo que le dieron vida a la obra artística-­reciclada. b.2) Recolección de envases usados Un mes antes de la acción, montamos espacios de la campaña en cada una de las sucursales de Hipermercados Jumbo de Ciudad de Buenos Aires y Gran Buenos Aires como centro de recolección de envases necesarios para armar el Parque Navideño Reciclado Tetra Pak. De esta manera, a partir del 8 de noviembre, comunicamos la campaña a los consumidores en estos puntos de ventas y quienes acercaron envases de Tetra Pak post consumo a las urnas (enjuagados y aplanados), colaboraron en el armado del Parque Navideño Reciclado. Para difundir masivamente la etapa de recolección de envases, llevamos adelante una campaña de PNTs en Radio Diez, Radio Mitre, Continental, FM La 100 y Radio Uno. Además, Jumbo dio a conocer la iniciativa a sus clientes a través de un aviso en el newsletter que les envía mensualmente. b.3) Construimos el Parque Navideño Reciclado Tetra Pak Para el armado del Parque Navideño se construyeron 5 árboles de navidad de alrededor de 10 metros cada uno, enteramente decorados por envases de Tetra Pak;; una muralla construida por envases de más de 70 metros de largo y una gran pérgola decorada íntegramente con envases. Todo fue creado e intervenido por Milo Lockett para luego ser montado en el parque. Además, el artista pintó de 8 murales que fueron expuestos dentro del Parque Navideño Reciclado y una serie de columnas con figuras fieles a su estilo lúdico que decoraban el sendero de acceso al parque, que luego sean subastados a beneficio en el día de la inauguración. b.4) Inauguración Realizamos un evento inaugural el día 8 de diciembre, ya que por tradición es el día del armado del árbol de Navidad. Estuvieron presentes el Sr. Hernán Lombardi, Ministro de Cultura de la Ciudad de Buenos Aires;; todas las autoridades de la compañía a nivel local;; el artista Milo Lockett;; clientes y empleados de Tetra Pak, coleccionistas de arte, más de 45 periodistas y Fundación P.U.P.I. A partir de las 18hs comenzaron a llegar los primeros invitados al cocktail inaugural del Parque Navideño Reciclado Tetra Pak, entre ellos más de 50 niños de la Fundación P.U.P.I. que animadamente se divirtieron pintando envases reciclados junto al artista Milo. Luego de los discursos de Aldo Ferrer, presidente de Tetra Pak;; del artista Milo Lockett y del Sr. Hernán Lombardi, Ministro de Cultura de la Ciudad;; llegó al Parque Navideño Reciclado Tetra Pak un invitado muy esperado por los niños para sacarse fotos y entregarles los deseos navideños: Papá Noel. b.5) Subasta Solidaria Promediando el evento de inauguración, iniciamos una subasta solidaria y silenciosa de las obras de Lockett cuyos fondos recaudados fueron destinados a la construcción de la Casa Garrahan del Chaco, apadrinada por el artista, que albergará a pacientes ambulatorios sin recursos económicos. La subasta fue exitosa, más de 50 personas participaron activamente para hacerse acreedores de alguna de las 25 piezas presentadas. Personalidades de la cultura, coleccionistas, fanáticos de Milo y hasta celebrities, como Dolores Barreiro, lograron dejar la mejor oferta para obtener una de las obras. b.6) Actividades Semanales Si bien el Parque Navideño Reciclado Tetra Pak estuvo abierto durante un mes, para ser visitado en todo momento, durante los dos fines de semanas previos a la Navidad, realizamos el Taller de Arte con Envases Reciclados para Chicos dictado especialmente por Milo Lockett, de manera libre y gratuita a partir de las 16hs. Deslumbrados por los árboles y figuras presentes en los más de 200 metros cuadrados del parque, las familias lo recorrieron fascinados, apreciaron la gran obra de Milo compuesta por envases reciclados, y los más chiquitos participaron del taller donde pintaron con temperas coloridas los envases de Tetra Pak usados que fueron sumándose a las pérgolas y árboles navideños del parque. Organizados en turnos de 20 minutos, ningún niño quiso perderse la actividad recreativa donde aprendieron que un envase puede convertirse en otra cosa, en este caso, en una obra de arte. Como no podía ser de otra manera, Papá Noel también estuvo presente en el Parque durante los fines de semana. La fila para sacarse fotos con él y dejar las cartitas navideñas, en un hermoso buzón pintado por Milo, estaba siempre llena de familias. ¡No faltaron los abrazos y emoción de los niños que disfrutaron de un momento único con la figura más emblemática y mágica de la Navidad! c) Herramientas de Comunicación ‡ Espacios en los Hipermercados Jumbo de Ciudad de Buenos Aires y GBA para recolectar envases usados. ‡ PNTs en radios: Radio Diez, Radio Mitre, Continental, FM La 100 y Radio Uno. ‡ Desarrollamos un microsite del Parque Navideño Reciclado Tetra Pak con el principal objetivo de educar sobre la reciclabilidad del envase de Tetra Pak. En este site se incluyeron fotos y videos de la construcción del Parque Navideño y del evento inaugural, explicación para participar en la colecta de envases y contenidos educativos sobre cómo proteger el medioambiente a través del reciclado de envases. El dominio es www.parquetetrapak.com. ‡ Creación de cuenta en Facebook del Parque Navideño Reciclado Tetra Pak. ‡ Publicidad en vía pública. ‡ Publicidad en medios gráficos: La Nación, Clarín y La Razón. ‡ Gestión de prensa en medios target: entrevistas a Milo Lockett en suplementos y revistas de arte y cultura, y a voceros de Tetra Pak en medios de interés general y medioambiente, y la noticia estuvo en las principales secciones de agenda y novedades de medios masivos como Clarín, La Nación, La Razón y revistas de interés general y femeninas. ‡ Envío de Tarjeta Navideña de Tetra Pak a clientes, empleados, periodistas y coleccionistas de arte que incluyó un video de la campaña. Resultados de la campaña ‡ Acción declarada de Interés General por el Gobierno de la Ciudad de Buenos Aires. ‡ Más de 10.000 familias visitaron la obra y participaron de las actividades que se llevaron a cabo los fines de semana previos a la Navidad junto a Milo. ‡ Más de 200.123.000 personas se enteraron de la muestra a través de los medios de comunicación. ‡ Se obtuvieron 100 repercusiones de prensa en solo 2 semanas, y 200 repercusiones en un mes. ‡ 25 notas fueron en TV abierta y cable (Canal 13 ±en Telenoche-­, CNN, TN (Colectivo Imaginario), Canal 9 (noticiero y Tendencia), Canal 7, C5N (con más de 6 repeticiones), América 2, Canal 26 y Canal Metro. ‡ Más de 1.5 millón de pesos el valor de ahorro publicitario conseguido a través de la gestión de prensa. ‡ Más de 2.000 visitas al microsite de la campaña en 3 días, con un promedio de 2 minutos de tiempo promedio en el site. ‡ 17.000 envases de Tetra Pak usados fueron recolectados para el armado de la obra reciclada. ‡ Cerca de 250 invitados asistieron al evento inaugural. ‡ 25 piezas fueron subastadas y se recaudaron $61.000 en la subasta de las obras de Milo a beneficio de la Casa Garrahan del Chaco. ‡ Tetra Pak donó 3.000 litros de leche larga vida a comedores de la Ciudad de Buenos Aires y a los chicos de la Fundación P.U.P.I. PREMIOS EIKON 2010 Categoría: Patrocinio o Sponsoring Cultural Caso: Premio Nacional de Pintura Banco Central Empresa: Banco Central de la República Argentina Integrantes: Por Banco Central de la República Argentina: Diego Rosa, Gerencia de Relaciones con la Comunidad e Imagen Institucional Introducción El Banco Central de la República Argentina, creado en 1935, es la entidad rectora del sistema financiero nacional cuya misión primaria y fundamental es preservar el valor de la moneda. Para llevar a cabo esta misión, el Banco Central formula y ejecuta la política monetaria y financiera. Las atribuciones para el cumplimiento de su misión son la regulación de la cantidad de dinero y del crédito en la economía y el dictado de normas en materia monetaria, financiera y cambiaria conforme a la legislación vigente. Es la única entidad que tiene la facultad de emitir el dinero. Son funciones del Banco Central vigilar el buen funcionamiento del mercado financiero y aplicar la Ley de Entidades Financieras y demás normas que se dicten. La Superintendencia de Entidades Financieras y Cambiarias (SEFyC) del Banco Central es la encargada de supervisar el correcto funcionamiento del sistema financiero. El Banco Central de la República realiza anualmente desde el 2007 el Premio Nacional de Pintura Banco Central. Esta acción cultural se realiza en el marco del Programa de Fortalecimiento Institucional del Banco Central aprobado por Resolución de Directorio Nº 272/07. El objetivo del Programa es propender a una mayor apertura y a un diálogo directo del BCRA con la comunidad a partir de dos ejes básicos de acción: la educación y la cultura. Tanto la esfera cultural como la educativa fueron elegidas para trasmitir el compromiso de responsabilidad social asumido dando a conocer la misión, las funciones y los valores que tiene el BCRA como institución pública. En el ámbito cultural, específicamente, el Premio Nacional de Pintura Banco Central tiene por objetivos: ‡ Promover y difundir el arte contemporáneo argentino en la comunidad. ‡ Incentivar la participación de artistas plásticos argentinos poniendo especial énfasis en los jóvenes con un alcance federal. ‡ Enriquecer el acervo pictórico y permanente del Banco Central mediante la adquisición de obra. ‡ Mediante la muestra itinerante del Premio, que tiene por objetivo ser visita por diferentes públicos (familias, escuelas, etc.), se destaca que la misma visita destinos donde acciones de este tipo no tienen acceso. El Premio Nacional de Pintura Banco Central incorporó un jurado con miembros reconocidos del ámbito artístico y la coordinación de una Curadora designada al efecto. También estableció una organización por categorías que permite la convivencia de diferentes generaciones en las 40 obras finalistas. De acuerdo a uno de los objetivos especificados en la Estrategia de Fortalecimiento Institucional, el Banco Central incorporó nuevas audiencias de interés fuera de las estrictamente técnicas. Los públicos del Premio de Pintura son: ‡ Artistas plásticos de todo el país y en especial jóvenes artistas ‡ Instituciones artísticas y museos ‡ Secretarías de Cultura de las provincias del país ‡ Periodistas especializados en este ámbito Muestra itinerante Una característica diferencial y relevante del Premio Nacional de Pintura es su carácter federal y la convivencia que se da en este concurso de artistas de distintas generaciones. Dada la diversidad cultural que tiene nuestro país, cada edición cuenta con una muestra itinerante que implica el traslado y exposición de sus 40 obras finalistas en diferentes ciudades del interior del país. De este modo, el Banco Central de la República Argentina actúa como puente intercultural entre los creadores y la sociedad promoviendo un acceso más inclusivo mediante el fomento de la pintura argentina. Los canales de comunicación para realizar la difusión, convocatoria e informar sobre los resultados de los certámenes fueron: ‡ Avisos en diarios nacionales y del interior del país ‡ Notas en diarios y revistas especializados ‡ Comunicados de prensa ‡ Entrevistas a diferentes autoridades del BCRA, diferentes miembros del jurado, artistas finalistas, etc. ‡ Afiches en la vía pública de la Ciudad Autónoma de Buenos Aires ‡ Invitaciones a instituciones artística vía correo postal (incluía un kit de flyers, afiches y bases) ‡ Redes sociales (Facebook y Twitter) ‡ Mailing con la información del Concurso a: -­Secretarías de Cultura provinciales (que retransmitieron toda la información a sus artistas plásticos) -­Museos del país -­Galerías de arte Ejecución Descripción de las ediciones I Premio Nacional de Pintura Banco Central 2007 En el año 2007 el primer Premio Nacional de Pintura del Banco Central planteó como objetivo primario la promoción y difusión de las artes visuales contemporáneas de nuestro país, sumándose a otros organismos públicos que a través de sus acciones en las artes facilitan la importante articulación entre la obra de los creadores nacionales y la comunidad. La convocatoria a la primera edición del Premio Nacional de Pintura 2007 reunió a 717 artistas plásticos provenientes de todo el país que presentaron 2.151 obras. El Jurado de Selección integrado por Laura Feinsilber, Roberto del Villano, Rosa Aiello, Belén Gache y Héctor Médici, eligió las 41 obras finalistas que integraron la muestra. El acto contó con la presencia de la curadora del Banco Central, Sarah Guerra y la Escribana Pública, Silvia Casco. La inauguración de la muestra se realizó el 6 de diciembre de 2007 en el Centro Cultural Borges, donde el Jurado de Premiación integrado por Guillermo Whitelow, Elena Oliveras, Guillermo Roux, Alicia de Arteaga y Alberto Giudici otorgó los premios y menciones a los artistas ganadores. 1° Premio Adquisición: Clorindo Testa Obra "Ciudad no muy extensa" 2° Premio Adquisición: Jacques Bedel Obra "Aproximaciones al mal II" 1° Premio Joven Artista -­ Adquisición: Diego Perrotta Obra "El hombre Volcán" 2° Premio Joven Artista -­ Adquisición: Diego Acuña Obra "Quebrantamiento" Menciones Especiales del Jurado: Juan Astica, obra "Entre líneas 00" Marcelo Boullosa, obra "Sin título N° 43" Eduardo Médici, obra "Boquitas pintadas" Las obras ganadoras junto a las obras finalistas luego pasaron a formar parte de una muestra itinerante durante el 2008 por museos y centros culturales importantes de nuestro país llevando el compromiso institucional del Banco Central. Los destinos donde la muestra itineró fueron: Villa Victoria (Mar del Plata), MNBA (Neuquén), Casa Bebán (Ushuaia), Museo Municipal (Mendoza) y el Museo de Arte Contemporáneo (Salta). II Premio Nacional de Pintura Banco Central 2008 En la segunda edición se incluyó una nueva categoría en la que se rinde homenaje a un grupo de UHFRQRFLGRVDUWLVWDVSOiVWLFRV³*UDQ3UHPLR+RPHQDMH´3DUDHVWDFDWHJRUtDVHLQYLWyDXQVHOHFWRJUXSR
de artistas plásticos: Luis Barragán, Luis Benedit, Sergio Camporeale, Miguel Dávila, María Martorell, Juan Melé, Luis Tomasello y Miguel Ocampo donde un jurado conformado por Elena Oliveras, Guillermo Whitelow, Rafael Ferraro, Clorindo Testa y Rogelio Polesello eligió al artista más distinguido. 7DPELpQ VH SUHYLHURQ ODVVLJXLHQWHV FDWHJRUtDV 3ULPHU 3UHPLR 6HJXQGR 3UHPLR \ GRV SUHPLRV ³-yYHQHV
$UWLVWDV´ \D TXH HV LQWHUpV GHO %DQFR &HQWUDO DSRVWDU \ IRPHQWDU DxR WUDV DxR HO DUWH GH ORV MyYHQHV D
través de estímulos mayores. Como en el año anterior, esta edición se desarrolló en dos etapas, una primera de selección, en la que actuó un jurado compuesto por Belén Gache, Oscar Smoljan, Graciela Taquini, Telma Palacios y Felipe Pino. La segunda etapa consistió en la premiación, con un jurado integrado por Jorge Taverna Irigoyen, Alicia de Arteaga, César López Osornio, Nelly Perazzo y Daniel García. La inauguración de la muestra se realizó en el 25 de septiembre de 2008 en el Museo Nacional de Bellas Artes, donde fueron proclamados y premiados los ganadores. Gran Premio Homenaje Adquisición Luis Tomasello 2EUD³$WPyVIHUDFURPRSOiVWLFD1ƒ´ 1º Premio Adquisición Silvana Lacarra 2EUD³9LQR\FKDPSDJQH´ 2º Premio Adquisición Juan Astica 2EUD³&XDGUDGR´ Jóvenes Artistas Adquisición Florencia Levy 2EUD³DPE&RF\ExRFRPSOFIWHEOFyQIUDQFHVWRGRDQYRUHFLpQSLQWDGR9HUKR\GHDKV´ Verónica Di Toro 2EUD³6LPHWUtD1ƒ´ La exposición permaneció en el Museo Nacional de Bellas Artes hasta el 25 de octubre de 2008 para iniciar luego la muestra itinerante al igual que en la primera edición. La muestra comenzó a itinerar y se exhibió durante el verano en Villa Victoria (Mar del Plata), Museo 0XQLFLSDO GH %HOODV $UWHV ³'U 8UEDQR 3RJJL´ 5DIDHOD 6Dnta Fe), la ex Estación de Ferrocarril (Puerto 0DGU\QHO0XVHR3URYLQFLDOGH%HOODV$UWHV³5RVD*DOLVWHRGH5RGUtJXH]´6DQWD)H\HO0XVHR6XSHULRU
de Bellas Artes Evita (Córdoba). III Premio Nacional de Pintura Banco Central 2009 En esta edición se presentaron más de 2.700 obras presentadas por 924 artistas plásticos de todo el país. Esta edición logró un récord en cantidad de inscriptos. El Jurado de selección estuvo integrado por Graciela Taquini, Juan Astica, Diana Wechsler, Rosa Faccaro y Teresa Pereda. El Jurado de premiación estuvo integrado por Jorge Taverna Irigoyen, Alicia de Arteaga, Eduardo Stupía, Josefina Robirosa y Carmen Martorell. 3RURWURODGRHO-XUDGR³*UDQ3UHPLR+RPHQDMH´ORLQWHJUy1HOO\$UULHWDGH%ODTXLHU(OHQD2OLYHUDV1Hlly Perazzo y Guillermo Whitelow. El 28 de octubre se realizó en el Museo Nacional de Bellas Artes (MNBA) la entrega de los premios a los cinco finalistas. Gran Premio Homenaje Adquisición Luis Felipe Noé 2EUD³%LRJUDItDGHDOJXLHQ´ 1º Premio Adquisición Jorge González Perrin 2EUD³'LQiPLFDGHODPDWHULDOLGDG´ 2º Premio Adquisición Juan Andrés Videla 2EUD³3XHUWD´ Jóvenes Artistas Adquisición Paula Otegui 2EUD³/DHSLIDQtDGH(GD´ Víctor Florido 2EUD³$XWRUUHWUDWR´ Este año, el Gran Premio +RPHQDMH IXH RWRUJDGR DO DUWLVWD /XLV )HOLSH 1Rp SRU VX REUD ³%LRJUDItD GH
DOJXLHQ´(ODUWLVWD1RpXQRGHORVJHVWRUHVGHODOODPDGD1XHYD)LJXUDFLyQVHDGHQWUyHQORVSUREOHPDV
enfrentados por el hombre contemporáneo con una visión crítica y al mismo tiempo humanística, de la irrupción del caos en la vida cotidiana. Luego de la exposición en el MNBA, las obras ganadoras junto a todas las finalistas comenzaron a itinerar por diferentes ciudades del país: Villa Victoria (Mar del Plata), Museo de Arte Contemporáneo (Salta) y actualmente se encuentra en la Sala Municipal de Exposiciones (San Martín de los Andes, Neuquén). Luego continuará su recorrido por Esquel, Córdoba y Tucumán. El alcance federal del Premio y su muestra itinerante contribuyen a la difusión de las expresiones en distintos centros culturales y pone en valor a artistas de distintas generaciones, escuelas y tendencias. Evaluación El Premio Nacional de Pintura Banco Central, con sus tres primeras ediciones, ha logrado instaurarse como una acción institucional permanente logrando un aporte a la historia del arte nacional. En el I Premio de Pintura Banco Central 2007 participaron más de 700 artistas. La muestra itinerante estuvo 240 días en exposición de manera permanente y continua. En el marco de la exposición en la ciudad de Mar del Plata, se declaró ciudadano ilustre de esa ciudad al artista premiado, Clorindo Testa. El II Premio de Pintura Banco Central 2008 tuvo una participación de 564 artistas de todo el país. La apertura y exposición se realizó en el MNBA. Asimismo, se desarrollaron visitas guiadas a cargo de la Curadora del Banco, Sarah Guerra. Cabe destacar que en las dos primeras ediciones más de 100.000 personas visitaron la muestra a lo largo de todo el país. En las dos primeras muestras itinerantes se enfatizó el sentido educativo, realizándose visitas guiadas a alumnos de escuelas primeras y secundarias, en las diferentes ciudades con un anclaje teórico-­práctico sobre la pintura contemporánea argentina. Hasta el momento se han realizado y entregado un total de 12.000 catálogos de las tres ediciones del Premio en los diferentes puntos donde la muestra itineró. Se realizó un video homenaje conjuntamente con el MACLA (Museo de Arte Contemporáneo Latinoamericano) sobre el artista consagrado en la edición 2008, Luis Tomasello. Dicho video se proyectó durante la muestra itinerante. El artista Luis Felipe Noé, por su distinción en la Categoría Gran Premio Homenaje en 2009, autoridades municipales de Mar del Plata declararon al DUWLVWD SOiVWLFR ³9LVLWDQWH ,OXVWUH´ HQ HO PDUFR GH XQD
FRQIHUHQFLDTXHRIUHFLy1RpHQHVHiPELWRVREUH³$UWHH,GHQWLGDG El Banco Central incrementó el acervo pictórico permanente, patrimonio que le pertenece a todos los argentinos. Se logró una amplia difusión en los medios masivos de comunicación nacionales y locales donde las muestras itineraron. Asimismo, se realizaron vínculos con medios especializados de cultura: Arte al día, Magenta, etc. Se intensificó la difusión interna a los empleados del Banco sobre las acciones que se desarrollaron mediante titulares en la intranet, mailings, invitaciones impresas y afiches en carteleras. Las acciones generaron vínculos estratégicos con diferentes centros culturales y museos del país. PREMIOS EIKON 2010 Categoría: Patrocinio o Sponsoring Cultural Caso: Impulsarte: Programa de estímulo al arte contemporáneo Empresa: La Rural Integrantes: Por La Rural: Juan Pablo Maglier, Director de Relaciones Institucionales;; Leticia Guolo, Jefa de Relaciones Institucionales;; Jorgelina Guandalini, Jefa de Prensa. Introducción Historia y naturaleza de la compañía Creada en 1866, la Sociedad Rural Argentina (SRA) es una organización que agrupa a productores agropecuarios de la Argentina y que tiene por objetivo fundacional fomentar el desarrollo del país y promover el mejoramiento de la vida rural en todos sus aspectos, así como el de sus industrias complementarias y derivadas, asumiendo la más eficaz defensa de los intereses agropecuarios. En 1878 la SRA comienza a celebrar la Exposición Nacional de Ganadería en su predio de Palermo, inaugurando allí el recinto ferial La Rural. Con el correr del siglo, la tradicional feria ganadera se convirtió en un clásico de cada año y fue, desde sus comienzos, punto de encuentro de los grupos más diversos de la sociedad local y de la dirigencia nacional. Hacia fines del siglo XXI, el recinto ferial remodela sus oficinas y pabellones, y se convierte en un complejo con una infraestructura de tecnología e inmobiliaria de última generación. Más tarde, en el año 2002, el Grupo de Narváez asume el gerenciamiento del predio, genera un replanteo de negocio y un reposicionamiento de La Rural como compañía, con un modelo de gestión dinámico y diversificado. Desde ese entonces, La Rural S.A. divide su paquete accionario entre la Sociedad Rural Argentina y el Grupo de Narváez en partes iguales. Así es como hoy La Rural, Predio Ferial de Buenos Aires es el recinto ferial más importante del país y de Latinoamérica. En 2009, albergó 40 ferias y exposiciones, 57 congresos y convenciones, más de 60 eventos empresariales y cerca de 30 eventos sociales, que recibieron a casi 4 millones de visitantes. Y se calcula que sólo en ese año, gracias a su actividad, La Rural generó directa e indirectamente más de 50.000 oportunidades de empleo. Entre las ferias y eventos más destacados, en 2009 La Rural fue escenario de arteBA, Feria del Libro, Feria Puro Diseño, el Congreso Forestal Mundial y el 24º Congreso Mundial del Gas. Además, La Rural participó en la organización del espacio Village Dakar del Rally Dakar Argentina-­Chile, BAFWEEK, ExpoNieve, Vinos y Bodegas, Nuestros Caballos y la tradicional Exposición Rural, entre otras exposiciones. A su vez, por primera vez La Rural se ubicó primera en el ranking anual de complejos del país que albergaron la mayor cantidad de congresos durante el último año que revela anualmente el medio especializado del sector. En los últimos años, La Rural fue evolucionando paulatinamente de su carácter de espacio físico al de compañía integral con misión, visión y valores, y perfil institucional, afianzada en sus productos y servicios. Por esta razón y como ícono de la Ciudad de Buenos Aires, centro receptor de múltiples eventos y negocios y punto de encuentro de millones de visitantes, La Rural tiene, siente y cree en el compromiso de contribuir con la sustentabilidad medioambiental y el desarrollo humano de su entorno. De este modo, La Rural cuenta con un plan de Responsabilidad Social Empresaria que incorpora permanentemente nuevas iniciativas y proyectos. Causas por las que se generó el plan La Rural trabaja cada día con un destino claro: ser una gran ventana al mundo buscando mostrar lo mejor de la Argentina. Con un promedio anual de 3.5 millones de visitas, año a año se consolida como plataforma exportadora y polo de atracción cultural, empresarial y social en el corazón de Buenos Aires. Con esta convicción, en 2009 La Rural entendió que debía profundizar su compromiso con la comunidad que la rodea y con una de las exposiciones más importantes que se realizan en el recinto (arteBA) a través del desarrollo de un programa de mecenazgo empresarial dirigido a la expresión de las artes plásticas. Desde hace 10 años, La Rural alberga arteBA, la muestra de artes plásticas más destacada de la región que en cada edición reúne a los galeristas más importantes de la Argentina y a expositores extranjeros y está considerada como la meca de exhibición de nuevos artistas locales que buscan contactarse con el mundo. Con el fin de aportar al desarrollo de las jóvenes promesas del arte nacional y de fomentar la compra de arte como hábito cotidiano en el público general, La Rural creo Impulsarte, Programa de Estímulo al Arte Contemporáneo, que consiste en la selección anual de obras de arte en el marco de arteBA Feria y su posterior exhibición en las distintas ferias, congresos y eventos que tienen lugar en el predio. Objetivos Objetivo principal: convertir una acción de fidelización comercial en un programa de responsabilidad social. Objetivos subsiguientes: ‡ Estimular las artes plásticas de artistas argentinos emergentes ‡ Promover el mercado del arte y a la feria arteBA como vidriera de excelencia para la expresión artística y el espacio donde los artistas de toda América Latina encuentran un punto de expresión y visibilidad ‡ Fomentar la compra de arte como hábito cotidiano en el público general ‡ Apoyar comercialmente a arteBA Feria, muestra que se realiza desde hace más de diez años en La Rural ‡ Fortalecer la imagen de La Rural de compañía socialmente responsable, comprometida con el desarrollo humano de su entorno ‡ Incorporar un programa al eje cultural del plan integral de Responsabilidad Social de la compañía ±
el plan está dividido en tres ejes: cultural, social y ambiental ‡ Vincular a La Rural con marcas prestigiosas como arteBA y otras grandes compañías que participan con programas de adquisición en la muestra, como Mercedes Benz, Petrobras, Zurich y Citi, entre otras ‡ Introducir la marca al mundo del arte para revertir su identificación asociada directamente con temas agropecuarios y otros eventos puntuales realizados en el predio, hacia la de una compañía de acciones institucionales sólidas con una imagen de marca abarcadora de una gran diversidad productos y servicios Ejecución del Plan: Descripción de los pasos y procesos A raíz del interés de La Rural en realizar una acción de fidelización comercial con arteBA feria, la Dirección de Relaciones Institucionales decidió crear un programa de Responsabilidad Social a partir de la adquisición de obras de arte. En primer lugar, se definió el monto para tal fin: en 2009, sería un presupuesto aproximado a los US$9.000. El segundo paso en la construcción de tal programa fue el encuentro directo entre La Rural (representada por Juan Pablo Maglier, Director de Relaciones Institucionales) y el comité organizador de arteBA feria (Alejandro Corres, vicepresidente de arteBA Fundación y Teresa Frías, directora) para definir la política de adquisición y su perfil. Como resultado se concluyó que el programa apoyaría jóvenes talentos y por tal razón, compraría varias obras de precio accesible. Las compras se realizarían entonces en galerías argentinas que promuevan el arte nacional de jóvenes artistas. A partir de este perfLOVHGHILQLyHOQRPEUHGHOSURJUDPD\VXLGHQWLGDGYLVXDO³,PSXOVDUWH3URJUDPDGH
(VWtPXOR D ODV $UWHV 3OiVWLFDV´ TXH HQ FDPELy KDFLD ³,PSXOVDUWH 3URJUDPD GH (VWtPXOR DO $UWH
&RQWHPSRUiQHR´FRQHOILQGHDMXVWDUHOSURJUDPDDODQDWXUDOH]DGHOa muestra y ampliar su perfil hacia otro tipo de obras. Anualmente, antes de la realización de cada edición de arteBA, se designa un comité de selección que recorre la feria y selecciona las obras a adquirir de acuerdo al monto pre-­establecido año a año. Este debe ser tripartito ya que busca la imparidad en la elección, con un representante de la compañía que aporte la visión corporativa de La Rural y dos actores de distintos ámbitos del mundo del arte que aportaran su conocimiento. Así el Comité de Adquisición fue integrado por el Director de Relaciones Institucionales de La Rural, Juan Pablo Maglier, la curadora Eva Grinstein y la periodista crítica de arte Victoria Verlichak. Eva Grinstein es miembro de la Asociación Argentina e Internacional de Críticos de Arte. Se desempeña como crítica, docente y curadora independiente y corresponsal permanente de las revistas Art Nexus (Colombia) y Arte Contexto (España). Realizó la Maestría interdisciplinaria para artistas y comisarios latinoamericanos en el Departamento de Artes Plásticas de Casa de América (Madrid, 2002-­2003) y dirigió el Área de Artes Visuales del Centro Cultural Rojas (Buenos Aires, 2005-­2006). Como curadora presentó, entre otras exhibiciones, Sagrada Familia (Centro Cultural de España, Guatemala, 2009), Buenos Aires / Lust for life (feria Arteamericas, Miami, 2009) y Beloved Structure: the Argentine legacy (Alejandra Von Hartz Gallery, Miami, 2009). Creó y dirige el Premio Foster Catena de Fotografía Contemporánea (2008 y 2009), fue cocuradora del proyecto Arte en el Plata (gigantografías exhibidas sobre la fachada del Edificio del Plata, Buenos Aires, 2008 y 2009) y recientemente curó la Operación Pasamontañas para la Trienal de Chile (Valdivia, 2009). Victoria Verlichak también es miembro de la Asociación Argentina e Internacional de Críticos de Arte. Periodista y escritora especializada en arte, actualmente forma parte de la redacción de Revista Noticias responsable de la sección sobre la temática. Autora de En la palma de la mano y Artistas de los Ochenta (1996/2005), recibió una mención especial del Premio Nacional de Lingüística, Filología e Historia de las Artes y de las Letras, y el Premio Perfil a la Crítica 2004, Editorial Perfil, Buenos Aires. En forma regular integra jurados y participa de seminarios y coloquios, realiza curadurías, como la del envío argentino a la X Bienal de Cuenca, Ecuador (2009), donde Sub [Cooperativa de Fotógrafos] fue premiado por su ensayo IRWRJUiILFR³6DQ'DUtRGHO$QGpQ/DPHPRULDYLYDGH'DUtR6DQWLOOiQ´ Por otro lado, además de brindar apoyo económico específico para los artistas cuyas obras resultan seleccionadas para ser adquiridas, Impulsarte desarrolla otra serie de actividades destinadas al gran público con el fin de hacerlos partícipes del mismo. Entre las actividades se destacan: ‡ Visitas guiadas para socios del Club La Rural, Prensa e invitados especiales: se realizan en el marco de la feria ArteBA y con la presencia de curadores con quienes se recorre la muestra y se destacan las obras más valiosas que la componen. ‡ Montaje de stand propio del programa Impulsarte en el marco de ArteBA con el fin de maximizar la difusión de este programa entre los artistas y la opinión pública. ‡ ([KLELFLyQGHOD³&ROHFFLyQ,PSXOVDUWH´HQGLVWLQWDVIHULDVFongresos y eventos que tienen lugar en el predio. (QHVWHVHQWLGR/D5XUDOH[KLELySRUSULPHUDYH]VXFROHFFLyQGHREUDVDGTXLULGDVHQDUWH%$¶HQHO
marco del BAFWEEK Otoño-­ Invierno 2010, que se realizó del 24 al 26 de febrero de 2010 en La Rural. Dispuso de un espacio propio para Impulsarte donde los visitantes pudieron apreciar la colección 2009 y recibir información sobre el programa de RSE y su proyección para el 2010. La Rural consideró que el BAFWEEK era un marco propicio para poder compartir la colección de obras de arte con la comunidad, porque es un espacio donde la cultura argentina también se pone de manifiesto, en este caso, a través de la moda. El espacio de Impulsarte en BAFWEEK contó con la curaduría de Eva Grinstein, miembro del Comité de selección de obras del programa. En el año 2010, La Rural, Predio Ferial de Buenos Aires será Silver Sponsor de arteBA´10 Feria de Arte Contemporáneo y -­por segundo año consecutivo-­ dará continuidad a Impulsarte, Programa de Estímulo al Arte Contemporáneo. Resultados -­ Evaluación En su primera edición 2009, la selección de obras apuntó a dar cuenta de la amplia variedad de registros que caracterizan hoy a la producción de obra en formato bidimensional: los artistas elegidos utilizan muy diversos medios y técnicas de expresión. De Florencia Rodríguez Giles (Buenos Aires, 1978) fueron adquiridas tres tintas color de la serie Trademe gente, me las comeré y devolveré renovadas. Rodríguez Giles es una artista representada por la Galería Ruth Benzacar que anteriormente ha exhibido fotografías intervenidas digitalmente e instalaciones, y en esta oportunidad presentó en arteBA por primera vez una serie de delicadas pinturas sobre papel. San Poggio (La Plata, 1979) es un joven pintor que ha comenzado recientemente a exhibir su trabajo y que ha sido incorporado por el staff de la también joven galería Jardín Oculto. El comité de selección de Impulsarte decidió sumar su obra Recital, acrílico sobre madera que sintetiza su personal mundo compositivo, plagado de personajes y situaciones fantásticos. En el caso de Bruno Dubner (Buenos Aires, 1978), se trata de un fotógrafo que experimenta con la incidencia de la luz sobre la película fotográfica, reproduciendo el sistema de cámara oscura. La pieza seleccionada puede ser apreciada como una suerte de pintura abstracta efectuada por un hilo de luz que se filtra en una sala en penumbras. Estanislao Florido (Buenos Aires, 1977) ha obtenido ya bastante reconocimiento como videoartista. En esta oportunidad, presentó en la galería 713 una animación digital en formato casi pictórico, a través de una pequeña pantalla empotrada en un marco a la manera de un cuadro tradicional. La pieza, titulada Le reve, implica otro modo diferente de sostener la bidimensión, aunque con una cuota de inmaterialidad implicada en el video digital. Por último Lola Goldstein (Buenos Aires, 1978), es una sutil dibujante representada por la Galería Dabbah Torrejón. La obra adquirida es un pastel graso de mediano formato, sin título, en el que la artista despliega una idea de paisaje exuberante y colorido, cercano al universo vibrante de la brasilera Tarsila do Amaral pero resuelto con materiales ultrasencillos como lo son el pastel y el papel. Se destinó un monto de US$ 9.000 a la adquisición de siete obras pertenecientes a estos 5 artistas plásticos de origen argentino. En 2010, en el espacio propio para Impulsarte que La Rural dispuso en el BAFWEEK Otoño-­Invierno 2010 denominado Espacio Impulsarte, más de 31.200 personas pudieron apreciar las obras e informarse acerca del programa. En mayo-­junio de 2009 cuando se lanzó el programa se obtuvieron 44 menciones sobre Impulsarte en los medios de comunicación nacionales y especializados. El 35% de las publicaciones correspondieron a medios o secciones de arte, el 29% en medios de Información General, el 20% en negocios, el 9% en marketing y el 7% en RSE. Las distribuciones de las publicaciones se concentró mayormente en diarios (34%), medios digitales (32%) y revistas (23%) mientras que un 7% correspondió a agencias de noticias y un 4% a medios audiovisuales (radio y TV). En febrero y marzo de 2010 se registraron otras 11 repercusiones en prensa a raíz de la acción en BAFWEEK. PREMIOS EIKON 2010 Categoría: Patrocinio o Sponsoring Cultural (PYME) Caso: VEKA-­Latina Empresa: Compromiso VEKA, más ahorro energético Agencia de PR: Visión Empresarial Comunicación Integrantes: Por VEKA: Ernesto Castello;; Leonel Castello Introducción Breve reseña de la empresa VEKA-­Latina es una empresa de origen alemán que desde hace 15 años atiende el mercado nacional comercializando sistemas de ventanas de PVC, orientada al segmento Premium. Hasta marzo de 2010, la firma facturó 10 millones de pesos en el país, registrándose un incremento del 65% respecto del año anterior, aumentó su participación de mercado en un 54% y amplió su presencia en todo el país. Su showroom de Bs. As. se encuentra ubicado en la localidad bonaerense de Munro, allí funciona su oficina central: administración, gerencia general, comercial y técnica. Además, cuenta con un red nacional de talleres con elaboradores propios (técnicos encargados de ensamblar los perfiles que se importan desde Alemania) y representantes comerciales para atender las demandas en distintas regiones del país. Entre 2007 y 2009, VEKA-­Latina inauguró dos showrooms para brindar asesoramiento técnico y comercial en las plazas de mayor demanda: Córdoba y Rosario. Los valores fundamentales de su filosofía empresarial son el respeto y la preservación del medio ambiente, la posibilidad de mejorar la calidad de vida del hombre en armonía con su entorno. En este sentido promueve activamente una Arquitectura Sustentable con una oferta de productos cada vez más evolucionados e inocuos para el medio ambiente. Su línea de productos se compone de sistemas de aberturas de alta prestación en PVC: sistemas practicables-­ sistemas corredera-­sistemas especiales-­puertas exteriores-­decks-­ paneles. Todos sus productos se encuentran normalizados bajo la ISO 9002;; basados integralmente en el material PVC, compitiendo en el mercado de aberturas con otros materiales mejor posicionados como el aluminio y la madera. Problema /Solución VEKA-­Latina, ofrece tecnologías de vanguardia en productos elaborados con PVC. En el mercado nacional existe una barrera cultural, ya que es un material con percepción negativa por parte de los consumidores (constructores y/o usuarios finales) acostumbrados a elegir materiales más tradicionales como el aluminio y la madera. La mayor dificultad es el material, pues encierra mitos en cuanto a su durabilidad, seguridad, estética, su prestación técnica y la relación que mantiene con el medio ambiente. Mediante diferentes relevamientos y un analisis FODA, se detectó que los consumidores asociaban al PVC con el plástico y un mito sobre el carácter dañino. Pese a que la empresa dispone de dos plantas extrusoras de PVC para el reciclado de todos los materiales desechados, la percepción del target era la opuesta. 7DPELpQ VH WXYR HQ FXHQWD OD SUREOHPiWLFD ³HVWUXFWXUDO´ de la crisis energética que atraviesa la región Latinoamericana y la imperiosa necesidad de que los usuarios disminuyan sus niveles de consumo diario. Los públicos destinatarios de los mensajes institucionales fueron: constructores, estudios de arquitectura, ingenieros, diseñadores, decoradores, estudiantes de carreras afines, desarrolladores inmobiliarios, periodistas y usuarios finales. Además, a este condicionamiento cultural se sumó el objetivo de negocio planteado por VEKA-­Latina: aumentar la participación de mercado del PVC un 50% hacia el 2012. Esta etapa iniciada en el año 2007, requirió de una campaña comunicacional especialmente orientada a objetivos particulares que se implementó durante 2009/2010. De manera que fue necesario considerar la complejidad de la comunicación en una estrategia integral, de mayor alcance al target y vigente hasta la actualidad. La consultora Visión Empresarial recomendó implementar un programa de sponsoreo para apoyar diferentes actividades vinculadas a la promoción de la arquitectura sustentable. Se apoyaron eventos involucrados con los valores filantrópicos de la empresa: preservación y conservación del medio ambiente, arquitectura sustentable, eficiencia/ahorro energético, compromiso para una mejor calidad de vida, materiales con tecnologías innovadoras inocuas para el planeta. Cabe aclarar, que el programa de sponsoreo estuvo apoyado por la campaña de relaciones públicas orientado a la prensa, como estrategia FRPSOHPHQWDULD SDUD ORJUDU PD\RU ³QRWRULHGDG S~EOLFD´ \ fue la segunda etapa de un plan de comunicación integral iniciado en 2007. El programa de sponsoreo estuvo orientado principalmente al target constructor, dejando en un segundo plano al usuario final. También incluyó a todo el público interno de la empresa, elaboradores y representantes para unificar la comunicación de valores institucionales. Objetivos Posicionar los valores institucionales de la marca. Mejorar la percepción del PVC en el mercado. Concientizar sobre el cuidado del medio ambiente. Promover una Arquitectura Sustentable y su responsabilidad social. Target de VEKA Destinatarios del Plan: Se realizaron mensajes diferenciados (ver anexo eventos seleccionados) para alcanzar al target de esta campaña. La connotación del programa giró en torno al compromiso al concepto de mayor ahorro/eficiencia energética en el marco de las tendencias hacia una Arquitectura Sustentable. En todos los eventos y comunicaciones con la prensa se emitieron conceptos clave vinculados a las ventajas del PVC. Entre ellos se hizo referencia a: el ahorro energético, la reducción de las emisiones de CO2, una mayor capacidad de aislamiento termo-­acústico, el color y forma inalterable, una óptima resistencia, estabilidad y firmeza que evita la condensación del agua, bajo mantenimiento, fácil limpieza y una amplia gama de diseños y colores. La estrategia La estrategia de comunicación fue concientizar al target y a la prensa, sobre la responsabilidad social de la empresa. Se tuvo en cuenta como público a los líderes de opinión de referencia y al periodismo, con poder para instalar en la agenda mediática la importancia del ahorro energético en las viviendas y edificios. Al mismo tiempo, la prensa ejerció un efecto multiplicador considerable para contribuir en la difusión de mensajes desmitificadores del PVC y en la NECESIDAD de promover una Arquitectura Sustentable, que preserve el medio ambiente. Esto sería posible a partir de la incorporación de materiales constructivos con tecnologías cada vez más desarrolladas para evitar la contaminación medioambiental y reducir el consumo energético. Una vez planteados los objetivos, el público destinatario y los mensajes a difundir, se avanzó en el calendario de eventos programados para vincular a VEKA como sponsor de las diferentes iniciativas. Los eventos en los que participó fueron de carácter: cultural, educativo, tecnológico, experimental y deportivo. El propósito principal era alcanzar al target por otros canales, y no únicamente a través de los medios de comunicación (prensa y publicidad), del marketing directo (exposiciones, folletería técnica, showrooms) sino asociar fuertemente los valores que promueve VEKA y su responsabilidad social empresaria con el medio ambiente y la mejora en la calidad de vida. VI Ciclo de grandes arquitectos Argentinos. (2009) La muestra de arquitectura retrospectiva la expuso el estudio Lacroze-­Miguens-­Prati., evento que se realizó en el marco del ciclo de grandes arquitectos argentinos en el Centro Cultural Recoleta desarrollado desde el 15 de abril al 10 de mayo. La muestra reunió a los estudios de arquitectura más relevantes del país, profesionales reconocidos y periodistas especializados. &LFOR³6HPDQDGHODUTXLWHFWRHQHO&$3%$´ Evento organizado por el Distrito IV en el que se desarrollaron exposiciones, talleres, conferencias y homenajes relacionados al patrimonio arquitectónico. Fue una semana temática y de homenaje al rol del arquitecto, con una programación multidisciplinaria y permanente en todas las delegaciones;; además se realizaron reuniones, talleres y conferencias. Entre las actividades previstas se destacaron la presencia de Claudio Williams, hijo del arquitecto Amancio Williams, se realizaron charlas Hacia un urbanismo sustentable en el área metropolitana y las que realizarían los arquitectos Adolfo Pérez Esquivel, Julio .HVHOPDQ1RUEHUWR&XVVL\1RUEHUWR'¶DQGUHDHQWUHRWURV Cursos de Marketing para elaboradores y representantes comerciales. (2009) Se realizaron en el showroom de Bs.As, Rosario y Córdona, con el reconocido Arq. Sergio Corián. El 7UDLQLQJ³6RFLRV9(.$SRUXQFRPSURPLVRFRQHODKRUURHQHUJpWLFR´ Esta actividad se realizó para el público interno (elaboradores y representantes comerciales) de la empresa y con el objetivo puntual de fortalecer conceptos como marketing verde, arquitectura sustentable y sistemas de ventanas que ahorran energía. Exposición interQDFLRQDO )(167(5%$8 ³&RPSURPLVR 9(.$ FRQ OD $UTXLWHFWXUD 6XVWHQWDEOH´
(2010) Esta feria realizada en Nüremberg, Alemania cada dos años, reúne a todos los líderes mundiales del segmento ventanas, puertas y afines. VEKA participó en esta exposición con un stand de más de 500m2 donde se exhibieron las últimas novedades de sus productos, las soluciones sustentables existentes para cada mercado y también adelantó las tecnologías más nuevas que favorecen el ahorro energético. Torneo de Golf para arquitectos, COPA Rotary Club de Olivos (2009) La empresa acompañó la organización del Torneo en Buenos Aires Golf Tour para favorecer el relacionamiento de la marca con sus consumidores en un momento recreativo y de distensión. La copa se jugo el 1º de diciembre en el Club Country Los Lagartos y contó con más de 80 jugadores. :RUNVKRS³3UR\HFWRVVXVWHQWDEOHVVROXFLRQHVHILFLHQWHVSDUDODFRQVWUXFFLyQ´ Esta actividad fue organizada por la Revista Areas, especializada en desarrollos inmobiliarios, negocios e inmuebles comerciales. La participación fue selectiva y exclusiva. El evento fue apoyado por VEKA y la empresa CARRIER. Los participantes de la ronda de negocios fueron: CRIBA, Dycasa, Baresa, Carlos Gringberg, Arq. Juan Urgell, Metro Building, Bovis Lend Lease. Posteriormente al Workshop las editoras de la revista publicaron una nota completa con el balance de los profesionales, fue nota de tapa de la edición correspondiente al mes de Octubre. Sponsor principal en la CasaE de BASF, la casa de la eficiencia energética. (2010) VEKA, contribuyó con sus innovadoras tecnologías a mejorar la eficiencia energética y los beneficios medioambientales como partner estratégico de Basf en la construcción de la Casa de la Eficiencia Energética presentada en el mes de mayo. La utilización de esta ventanas y puertas especiales con tecnología permitió generar temperaturas ambiente agradables, independientemente de las condiciones metereológicas exteriores y redujo (ensayado por el INTI), notablemente, el consumo de la calefacción o refrigeración en un 70%. La CasaE de BASF, es un showroom que materializa y traduce las megatendencias globales en la construcción de una casa eficiente, sustentable, innovadora y confortable para mejorar la calidad de vida. Apoya el proyecto de la Casa Alemana y capacita a los profesionales sobre Eficiencia energética. (2010) En el mes de junio la firma participó activamente en el marco de los eventos temáticos desarrollados por el lanzamiento del prototipo de la Casa Alemana en el país, con índices elevados de eficiencia energética. Allí expuso detalles técnicos sobre la aplicación de tecnologías de eficiencia energética, ante un multitudinario auditorio con más de un centenar de profesionales. VEKA promueve un compromiso activo con la preservación y respeto por el medio ambiente, apoyó esta iniciativa de la Casa Alemana para continuar la difusión de tecnologías que favorezcan la eficiencia energética. Evaluación Los resultados cualitativos del programa de sponsoreo se monitoreó y evaluó mediante técnicas de investigación cualitativas, tales como: reuniones focales con el target, evaluaciones de desempeño técnico HQREUDORVUHJLVWURVGHODHPSUHVDDFHUFDGHODFDQWLGDG\³FDOLGDG´GHFRQVXOWDVUHFLELGDV Se pondera cualitativamente: Satisfacción del cliente. La percepción positiva: sobre inversión con rendimiento hacia el futuro, son ventanas de lujo, Premium, la mayoría de los consumidores revelaron el deseo de tenerlas en sus viviendas. Percepción negativa: su elevado costo comercial para la adquisición. Estas ponderaciones de los consumidores en torno a la percepción negativa, demuestran el cambio de eje de la problemática detectada en el diagnóstico de situación con anterioridad a la implementación del programa. Calidad de las consultas técnicas. Se destacó la demanda del servicio técnico cualitativamente diferente con respecto al nivel de las preguntas realizadas, el envío (por parte de los arquitectos) de los proyectos en CAD para incluir la especificación de las ventanas en sus planos, su requerimiento presencial en las obras, datos que dan cuenta de una realidad distinta al período anterior. Se estima que uno de los factores principales de consulta se vio motivado a partir de las relaciones públicas con los profesionales en los eventos por parte de la empresa y la consultora. También se realizó la siguientes evaluación de carácter cuantitativo para apoyar la efectividad del programa. Se pondera cuantitativamente: Consultas telefónicas al showroom central % 50% . Consultas por productos 60% . Solicitud de Información 150% . Especificaciones Técnicas 20% . Cotizaciones 10% . Visitas en obra Consultas por E-­mail En números % 10% . Consulta por productos 20% . Solicitud de Información 10% . Solicitud de Cotizaciones 10% . Datos de Representantes 25% . Info por visitas a obras Folletos entregados (totales) Cantidad impresa y entregados 30.000 300 . Por correo 10.000 . Retiro del showroom 17.000 . En eventos Volumen de Ventas % 25%+ Hoteles 5%+ Edificios (en general) 70%+ Vivienda Contacto de personas por Canales % 20% . Publicidad/ Prensa y RRPP 10% . Revistas 20% . Website 5% . Diarios 10% . Portales + Redes sociales 70% .Showroom / Puntos de venta Cantidad de visitas mensuales on line 4800 hits www.veka-­Latina.com.ar PREMIOS EIKON 2010 Categoría: Comunicaciones Financieras o con los Inversores Caso: Una memoria con lo mejor de Molinos Empresa: Molinos Río de la Plata Integrantes: Por Molinos: Adela Sáenz Cavia;; María Verónica Gené, Departamento de Relaciones Institucionales Introducción Este caso muestra cómo y por qué Molinos cambió su emblemática memoria y balance luego de más de 100 años. ¿El desafío? Hacerla accesible a nuevos públicos, manteniendo los atributos que la hicieron una favorita de la comunidad económica argentina. La experiencia resultó tan positiva que aumentaron los pedidos externos e internos de la pieza: ahora, por ejemplo, los empleados la utilizan para presentar la compañía en profundidad. Molinos Río de la Plata: una empresa emblemática de la Argentina Molinos Río de la Plata es una empresa estrechamente vinculada con la Argentina y su actividad industrial y económica. Durante sus 100 años de vida, conservó siempre la identidad nacional de sus capitales y profundizó una labor empresarial que frecuentemente es asociada con el país: la exportación de graneles y la producción de alimentos. En la actualidad y gracias a un crecimiento sostenido, Molinos se ha convertido en uno de los actores clave de la industria alimenticia de Sudamérica. Lidera la exportación de alimentos que llevan marca argentina y es también uno de los primeros en el procesamiento y comercialización de soja y sus derivados. Por tomar un ejemplo, las ventas de 2008 repartidas entre todos los habitantes argentinos representan una compra anual de 22 productos de Molinos por persona. Información que espera el universo económico nacional A lo largo de esos años, la memoria y balance de Molinos ha desempañado un rol que excede el mero reporte de una compañía. Reflejo de una actividad representativa, la memoria es aguardada todos los años con gran expectativa por la comunidad económica. Su descripción de la realidad macroeconómica, el desempeño de sus negocios, las perspectivas que anticipa, han sido tradicionalmente tomados por observadores y analistas como índices ilustrativos de la marcha general de la economía. Esta situación particular ha creado una carga de responsabilidad adicional a la que tiene naturalmente el reporte de cualquier empresa. Por eso, en el caso de Molinos, se trabaja con extremo cuidado la exactitud de la información ±no hay lugar para errores ni omisiones, por pequeños que sean±, y también con celeridad: muchos otros reportes y análisis aguardan la salida de la memoria para utilizarla como referente El desafío de 2009: conservar los atributos de siempre y ampliar la prestación de la memoria Como resultado de estas exigencias, en Molinos se privilegió siempre la calidad y transparencia del contenido y el estricto cumplimiento de los plazos de producción, por sobre los atractivos de la presentación y la llegada a otros públicos que no fueran los accionistas. Pero en 2009 se resolvió cambiar. Además de conservar los atributos que la habían consagrado, la Memoria y Balance Molinos Río de la Plata 2009 se propuso expresar también el nuevo modo en que la compañía había elegido presentarse a sí misma. Resumido en su nuevo claim, Lo mejor de nosotros, Molinos se mostraba antes que nada como un equipo de personas orgullosas de su origen y su identidad. Y también de la calidad de sus productos y de su decidida orientación hacia sus consumidores y públicos de interés. La memoria y balance Molinos 2010, entonces, asumió esta doble tarea: mantener su prestigio en la comunidad económica argentina y mostrar a la vez la identidad renovada de la compañía, dirigida a todos los públicos posibles. Ejecución del plan Se puso entonces en marcha el plan de trabajo destinado a renovar una modalidad que había tenido mínimas variaciones desde hace años. La primera medida del plan consistió en convocar un equipo multidisciplinario de profesionales, algo inusual para una pieza que era resuelta por el propio departamento de Relaciones Institucionales y la ayuda de un diseñador gráfico externo. El departamento oficiaba de coordinador, recopilaba la información de cada una de las áreas y luego la editaba para lograr un estilo homogéneo, semejante año a año. Una vez normalizado, el documento iba a diseño e impresión, también según pautas previamente establecidas. Las dificultades eran las propias de una compañía grande y compleja como Molinos. En el proceso de la elaboración de la memoria, participaban alrededor de 15 personas de diferentes áreas, de acuerdo con protocolos de trabajo previamente establecidos por la gerencia de Relaciones Institucionales. Esta se ocupaba de reunir los resultados y de describir los procesos que habían tenido lugar en las áreas y sectores de Molinos durante el ejercicio contable. Este proceso se desarrollaba entre los días finales de diciembre y mediados de marzo, fecha límite para la presentación de la Memoria y Balance ante la Comisión Fiscalizadora y los auditores. Más trabajo en el mismo tiempo En esta oportunidad, entonces, la gerencia convocó con suficiente antelación a especialistas por cada área FRPXQLFDWLYDGHODPHPRULDODDJHQFLD/LHEUH$PRWLQDGDFRODERUyFRQODV³HQWUDGDV\WH[WRV´HOHVWXGLR
Wallace con las imágenes y el Grupo KPR para el diseño gráfico. En la mesa de trabajo rápidamente se establecieron las intenciones y objetivos: Objetivo 1: Transformar la memoria y balance en un reflejo de la renovación de la identidad de la empresa. Para cumplirlo, el equipo de trabajo acordó como primera medida hacer visibles a las personas de la FRPSDxtD3DUDHOORVHXWLOL]DURQODVWRPDVGHORVDYLVRVLQVWLWXFLRQDOHVTXHOD$JHQFLD³/LHEUH$PRWLQDGD´
HQFRQMXQWRFRQ³(VWXGLR:DOODFH´KDEtDGLVHxDGRSDUDODFRPSDxtD Complementariamente, el equipo resolvió también destacar la nueva identidad gráfica de la empresa. Por eso, la tapa del reporte presentaba casi en exclusividad el nuevo isologotipo de Molinos y su claim. Con un agregado: se transparentó la letra M del isologo, habitualmente blanca, para enfatizar la idea de apertura y transparencia. Detrás de ella, se leían algunas de las palabras que conformaban la declaración de apertura de la memoria. Resultado general: la pieza ganó en atractivo. Se volvió más amena gracias a la inclusión de retratos y testimonios y aumentó, debido a ellos y a recursos comunicacionales como el de la tapa, su expresividad. Objetivo 2: Ampliar los públicos de llegada Para que la memoria trascendiera sus lectores habituales ±accionistas, funcionarios, economistas, periodistas y público especializado en general-­, el equipo resolvió que la memoria contemplara distintos lectores y abordajes. Básicamente, trabajó con tres instancias de lectura. 1. El cuerpo central. Este texto principal estuvo organizado según los parámetros tradicionales de toda memoria. Esto es, distintas secciones y capítulos para describir contextos, panoramas macroeconómicos, y el desempeño de las áreas y negocios de la compañía. Cada una de esas secciones estuvo internamente dividida en apartados y escrita en un estilo claro, de fácil comprensión. 2. El cuerpo de destacados y recuadros. Paralelamente a este cuerpo central, se elaboró otro grupo de textos pensado para una lectura más rápida, menos pormenorizada. Encabezado por un texto introductorio de 12 líneas de tipografía grande que especificaba en lenguaje llano como se ve actualmente Molinos a sí misma, este cuerpo paralelo de textos incluyó a continuación un recuadro de datos consolidados (financial highlights) donde era posible observar comparativamente los principales resultados de la compañía de los últimos cinco años. Además, cada capítulo presentó un texto destacado que sumariaba su contenido principal. En cuestión de minutos, un lector apurado podía obtener un pantallazo del estado actual de la compañía. 3. El relato de los testimonios de empleados. Y adicionalmente a estos dos textos se agregó un tercero conformado por los testimonios e imágenes de los empleados. Como se expresó más arriba, este conjunto de ocho pequeños relatos junto a sus correspondientes fotografías, ayudaban a construir un retrato general más cercano de la compañía. Yendo de testimonio en testimonio, un lector casual podía formarse rápidamente una visión esencial sobre Molinos. Resultado general: Gracias a esta arquitectura textual, la pieza ganó en claridad, posibilidades de lectura y usos. Ahora, no solo funciona como un documento contable sino que es a la vez una fuente de información de fácil acceso para público interno y externo. Objetivo 3: Encarnar valores y prácticas de la compañía Una de los valores centrales de la gestión de Molinos es el cuidado del medio ambiente, a punto tal que todos sus procesos están guiados según una rigurosa política ambiental. Atento a esto, la memoria está certificada por el Forest Stewardship Council (FSC), una organización no gubernamental internacional que vela por el uso responsable de los recursos forestales. Entre otras cosas, esta certificación garantiza que el papel utilizado en la memoria no fue extraído de bosques o selvas naturales y que, por el contrario, fue generado a partir del uso sustentable de los recursos. Los desafíos del cambio Los desafíos fueron los propios de cambiar una modalidad de trabajo arraigada a lo largo de muchos años (desde que la empresa empezó a cotizar en la Bolsa de Buenos Aires). En cada entrevista fue necesario explicitar intenciones, anticipar resultados, persuadir a quienes tuvieran dudas sobre los eventuales beneficios de cambiar. Y todo dentro de los estrechos márgenes de trabajo que establece la fecha límite para presentar la memoria. En lo concreto, a la elaboración del texto central -­que por habitual, no dejaba de ser compleja por las razones ya mencionadas-­, se agregó la elaboración de los otros dos textos: el cuerpo de destacados y el grupo de testimonios. Evaluación: aprobación unánime y sostenida Los primeros sondeos informales ±su ciclo de utilidad está todavía en plena vigencia-­ indican que la memoria y balance ha superado sus propósitos iniciales. Uno de los nuevos públicos que ha cautivado ha sido el propio: la memoria se ha convertido en uno de los instrumentos favoritos de las áreas de negocios cuando deben presentar la empresa. Del mismo modo, y a pesar de que cuentan con una versión digital en el sitio web de la empresa, las oficinas internacionales continúan solicitando al día de hoy la versión impresa para usarla con estos mismos fines En este sentido, la apreciación general interna, también recabada a partir de comentarios espontáneos orales o escritos, es que la memoria ha acertado en su descripción de la actualidad de la compañía: en general, los empleados se sienten reflejados en el reporte. Por último, todas las personas involucradas en la elaboración de la pieza han expresado su satisfacción por los resultados y se ha mostrado proclive a participar de un proceso similar el año entrante. Respecto de públicos externos, se recibieron comentarios de tono similar, especialmente aprobatorios con el rediseño: se destacan espacialmente la facilidad para encontrar los datos más relevantes y lo mucho que ha contribuido la presencia en texto e imagen de empleados de la empresa a completar la visión general de Molinos. Conclusión: la apuesta a modificar la presentación anual de la compañía se está probando exitosa. A partir de la confirmación de este resultado, es probable que la versión 2009 de la memoria y Balance 2009 sea percibida en años venideros como un hito en la comunicación institucional de la compañía. Tanto por hacer acompañado la renovación general de su identidad como por haberse transformado en una herramienta informativa de mayor alcance y atractivo. PREMIOS EIKON 2010 Categoría: Comunicaciones Financieras o con los Inversores Caso: Reporte de Sustentabilidad 2007/2008 y Memoria y Balance 2009 Empresa: Transportadora de Gas del Sur ±TGS Agencia: Marcini&Menéndez Por TGS: Daniel Perrone, Director de Asuntos Regulatorios e Institucionales;; Mario Yaniskowski, Gerente de Relaciones Institucionales. Introducción: La compañía Transportadora de Gas del Sur SA (TGS) nace en 1992, cuando luego del proceso de privatización de Gas del Estado SE, obtiene la licencia por 35 años (con opción a 10 años adicionales) para operar el sistema de transporte sur de gas natural de la Argentina. Considerando que la Matriz Energética Nacional se sustenta un 53% en gas natural, TGS es la transportadora de gas líder en el país, ya que transporta aproximadamente el 60% del gas consumido en Argentina. Abastece en forma directa a distribuidoras, generadoras eléctricas e industrias y llega en forma indirecta a más de 4,4 millones de usuarios. Con una extensión de 8.627 Km. de gasoductos que conectan siete provincias, TGS opera el sistema más extenso del país y de Latinoamérica. Además, la reciente inauguración de la obra de ampliación del Gasoducto Transmagallánico, le otorga al sistema una potencia instalada de 608.900HP, y una capacidad de transporte de hasta 74,04 millones de metros cúbicos de gas natural por día. Además del servicio regulado de transporte de gas, TGS ha crecido diversificando sus negocios a través de la provisión de servicios en el segmento no regulado. Estos negocios no regulados abarcan la producción y FRPHUFLDOL]DFLyQGHOtTXLGRVGHJDVQDWXUDO/*1VHUYLFLRV³PLGVWUHDP´\WHOHFRPXQLFDFLRQHV TGS es el segundo procesador de gas natural en Argentina y uno de los principales productores y FRPHUFLDOL]DGRUHV GH OtTXLGRV GH JDV QDWXUDO ³/*1´ WDQWR SDUD HO PHUFDGR ORFDO FRPR LQWHUQDFLRQDO
brindando también servicios logísticos asociados a estos productos. Asimismo, a través de los servicios "Midstream", TGS brinda soluciones integrales en materia de gas natural desde la boca de pozo hasta los sistemas de transporte. Esta unidad de negocios implica el tratamiento, separación de impurezas y compresión de gas, así como otros servicios relacionados con la estructuración comercial y financiera, la construcción llave en mano, la operación y mantenimiento de las instalaciones de superficie (captación, acondicionamiento y transporte). Actualmente, TGS procesa el 60% del gas del mercado de las instalaciones tercerizadas, interviniendo activamente en la exportación de gas a Chile y Uruguay. 3RURWUDSDUWHGHVGH7*6SURYHHVHUYLFLRVGHWHOHFRPXQLFDFLRQHVFRPR³FDUULHU´PD\RULVWDDWUDYpV
de su sociedad controlada Telcosur SA. En 17 años de gestión y operación, TGS ha contribuido al crecimiento del país junto a todos los actores de la industria, contribuyendo al desarrollo sustentable, brindando soluciones creativas e innovadoras para satisfacer las necesidades de sus clientes y la demanda creciente de energía de Argentina. Situación de TGS 2008 y 2009 Durante el período 2008-­2009, la compañía logró muchas metas por las que venía trabajando desde hace algunos años y que se habían convertido en verdaderos desafíos. El objetivo alcanzado PiV UHFLHQWH IXH OD ILUPD SRU SDUWH GHO 3RGHU (MHFXWLYR GH OD 1DFLyQ ³3(1´ GHO
decreto No. 1.918/, por el cual se autorizó un aumento de tarifas del 20% retroactivo al 1 de septiembre de 2008, y que significó un incremento en los ingresos por ventas por Ps. 122,1 millones en el ejercicio 2009. Otro hito destacado fue la culminación de la primera etapa de las obras de ampliación de los gasoductos 2006/2009, ejecutadas y financiadas bajo el Programa de Fideicomisos de Gas, que permitió aumentar la capacidaGGHWUDQVSRUWHGHQXHVWURVLVWHPDSRUPLOORQHVGHPHWURVF~ELFRVSRUGtD³00PG´(VWD
obra de infraestructura, finalizada en 2009 e inaugurada en marzo de 2010, conocida como Gasoducto Magallánico II, es la más grande que se realiza desde 1978. Asimismo, el refinanciamiento de la deuda de la empresa, fue un hecho de gran importancia que permite a TGS contar con una estructura de capital acorde con el volumen de negocios que maneja. Adicionalmente, en este período la compañía logró la Recertificación de la Política de Gestión de Calidad, Medio Ambiente y Seguridad y Salud Ocupacional de los empleados y contratistas. Por otro lado, desarrolló un sistema propio de relevamiento y evaluación de defectos por corrosión en gasoductos. También, con un gran esfuerzo de todo el equipo de TGS y a las inversiones realizadas, se hizo el mayor despacho de gas desde el inicio de las operaciones en 1992, logrando un promedio de entregas pico en tres días de 75,8 MMm3/d, alcanzando al mismo tiempo el 98,5% de disponibilidad en el sistema de transporte. El problema A partir de estas dos publicaciones, la Memoria y Balance 2009 y el Reporte de Sustentabilidad 2007-­
2008, la empresa se propone brindar un panorama más completo de los resultados obtenidos dentro de la gestión así como también divulgar todos los aspectos que intervinieron en las decisiones corporativas, sus resultados y sus proyectos futuros. Un desafío importante fue registrar los principales hitos de la obra de infraestructura de ampliación del Gasoducto Transmagallánico, eje temático de la Memoria y Balance 2009, y asumir el compromiso de definir los indicadores bajo los cuales cada 2 años TGS elaborará su Reporte de Sustentabilidad, según los lineamientos G3 del Global Reporting Initiative. Objetivos Con estas dos publicaciones, la Memoria y Balance 2009 y el Reporte de Sustentabilidad 2007-­2008, TGS se propuso sintetizar y comunicar a sus públicos de interés los aspectos más relevantes de la gestión de la compañía y brindarles una reseña informativa sobre sus estados contables y un completo análisis de resultados del período y así como también, destacar las actividades de responsabilidad social empresaria que se llevaron adelante orientadas a contribuir al desarrollo desde una perspectiva sustentable. La Memoria y Balance 2009 buscó reflejar los esfuerzos que se planteó la empresa en este período para el ORJURGHVX9LVLyQ³6HUXQPRGHORGHJHVWLyQWUDEDMDQGRFRQSDVLyQSDUDFUHDUXQYDORUGLIHUHQFLDOFRPR
FRPSDxtD´ Al mismo tiempo, el Reporte de Sustentabilidad 2007-­2008 elaborado ahora bajo lineamientos G3 de Global Reporting Initiative, se propone como una doble herramienta de comunicación y de mejora continua de la gestión económica, social y ambiental de la compañía desde el punto de vista de la sustentabilidad. Públicos Estas publicaciones están dirigidas a los accionistas y mercados bursátiles, clientes actuales y potenciales, líderes de opinión, público interno y a la comunidad en general. Asimismo, como piezas de comunicación institucional, tanto el Reporte de Sustentabilidad como la Memoria y Balance son utilizados para el intercambio con otras compañías e instituciones. El paquete accionario de TGS al momento de la entrega de ambas publicaciones estaba conformado de la siguiente manera: el principal accionista es Compañía de Inversiones de Energía SA (CIESA), quien posee aproximadamente el 55,3% del capital social de la Sociedad, el 44,7% restante del capital social cotiza en las bolsas de Buenos Aires y de Nueva York. Por su parte, los accionistas de CIESA son Petrobras Energía S.A. y una subsidiaria con una participación del 50%, un fideicomiso financiero, cuyo fiduciario es el ABN AMRO BANK N.V. Sucursal Argentina, con el 40%, y Enron Pipeline Company Argentina con el restante 10%. Canales y medios En la relación con sus inversores, para TGS los principales medios de comunicación son la Memoria y Balance y el Reporte de Sustentabilidad que se publica en forma bianual. Ambas publicaciones institucionales están también disponibles en formato digital para el público en general en la página de Internet de la compañía. La Memoria y Balance se edita en español e inglés y constituye una herramienta de comunicación institucional donde el Presidente del Directorio sintetiza en una carta los objetivos alcanzados en cada uno de los segmentos de negocio de TGS y los próximos desafíos. Además de los resultados económicos alcanzados en el año y comparados con el ejercicio anterior, la publicación sintetiza la situación financiera y patrimonial de la compañía luego de las inversiones realizadas durante el período 2009, la gestión de la compañía en recursos humanos, medioambiente y responsabilidad social empresaria y los estados contables. Por su lado, el Reporte de Sustentabilidad, que se edita en español (e inglés) cada 2 años permite dar cuenta de la gestión de TGS desde el punto de vista de la sustentabilidad. En el caso del Reporte de Sustentabilidad 2007-­2008 (el segundo presentado por TGS) se realizó bajo los lineamientos G3 de Global Reporting Initiative, con lo cual se convierte no sólo en una herramienta de comunicación sino también de mejoramiento continuo. Asimismo, al adherir a un estándar internacional en la medición de la gestión de sustentabilidad, la empresa podrá comparar su gestión con otras empresas del sector a nivel mundial. Acciones La Memoria y Balance 2009 se presentó junto con el segundo Reporte de Sustentabilidad 2007/2008 bajo lineamientos G3 de Global Reporting Initiative y un video institucional de la inauguración de la obra de expansión del Gasoducto Transmagallánico, en la Asamblea Anual de Accionistas el 16 de abril de 2010. Asimismo, ambas publicaciones fueron distribuidas por correo postal y a través de correo electrónico en formato PDF a los diferentes públicos destinatarios. Asimismo, la comunicación de la inauguración de la obra de expansión del Gasoducto Transmagallánico realizada en Ushuaia el 15 de marzo de 2010 con la presencia de la Presidenta Cristina Fernández de Kirchner, quedó reflejada no sólo en el video que se entregó a los accionistas sino también en la cobertura que los medios hicieron de dicho evento. Ejecución del plan En ambas publicaciones, el diseño y la producción editorial estuvo a cargo de la Agencia Macrini & Menéndez. Para ello, se siguió un plan de trabajo conjunto que abarcó las siguientes etapas: Conceptualización, Desarrollo Creativo y de Contenidos y Producción editorial. Asimismo, el desarrollo de los contenidos del Reporte de Sustentabilidad 2007-­2008 siguiendo los lineamientos G3 del Global Reporting Initiative se realizó con el asesoramiento de Fundación Compromiso. El desarrollo de de la Memoria y Balance 2009 se llevó adelante en 4 meses, sin contratiempos, e incluyó la producción gráfica de la Memoria y la publicación de la Reseña Informativa y Estados Contables 2009 en CD junto con el Informe del Auditor y el Informe de la Comisión Ficalizadora. En el caso del Reporte de Sustentabilidad 2007-­2008, con el cambio de metodología y la adopción de los lineamientos G3 de Global Reporting Initiative el proceso fue más largo y se realizó en 6 meses con la colaboración de Fundación Compromiso. Conceptualización y desarrollo creativo Para el caso de la Memoria y Balance 2009, y siguiendo el cambio ya iniciado en 2008, se optó por un diseño bilingüe, en color negro el texto en español y en color gris la versión en inglés. Esta diagramación permitió un ahorro considerable en términos de costos y tiempos de desarrollo de la publicación. Adicionalmente, otra decisión importante fue la separación de la información de la Memoria y del Balance contable. Por primera vez, TGS publicó en formato gráfico la Memoria 2009 y en un CD la Reseña Informativa y Estados Contables 2009 junto con el Informe del Auditor y el Informe de la Comisión Ficalizadora. Asimismo, a la hora de definir el concepto creativo de la Memoria como el hito más importante en la gestión 2009 fue la obra de infraestructura del Gasoducto Transmagallánico, se estableció como meta reflejar la ampliación del gasoducto y sintetizar las etapas de la construcción con fotos del primer y segundo tramo de la obra terminada. La paleta cromática fue creada para seguir una armonía con las fotos y con cada sección de la edición. La elección tipográfica se hizo por legibilidad y estética. Como ya señalamos, la diagramación bilingüe fue un desafío que se resolvió con una versión de texto en español en color negro sobre columna izquierda, y su contrapartida en inglés en columna derecha en formato cursiva en color gris. En el caso del Reporte de Sustentabilidad 2007-­2008, la adopción de los lineamientos G3 de Global Reporting Initiative significó un compromiso en la definición de los indicadores a partir de los cuales la empresa medirá cada 2 años su gestión sustentable. El concepto eje que definLy OD SXEOLFDFLyQ IXH ³7UDQVSRUWDPRV ELHQHVWDU D ORV KRJDUHV´ \ HVD LGHD GH
bienestar encarnada en el compromiso de las personas que trabajan en TGS se reflejó en la selección de las imágenes, todas fotografías de personas trabajando. La paleta cromática fue seleccionada para destacar cada sección y estética de la edición, siguiendo los parámetros del Manual de Identidad Corporativa. La elección tipográfica se hizo por legibilidad y estética. Se desarrollaron elementos gráficos identificatorios de cada título del índice y se incorporó una tabla con los indicadores GRI que tomaron para medir la gestión económica, social y ambiental. A diferencia de la Memoria y Balance 2009, para el caso del Reporte de Sustentabilidad 2007-­2008 se optó por realizar dos versiones una en español y otra en inglés. En ambas publicaciones hay elementos gráficos comunes, líneas oblicuas que funcionan como soportes de identidad y unificación estética de las dos piezas de comunicación. Asimismo, la calidad del papel y el uso de lacas y tratamientos especiales en fotografías y elementos gráficos constituyen estrategias para darle a ambas piezas un carácter identificatorio más allá del diseño. Producción de contenidos En la elaboración de la Memoria y Balance 2009 se produjo un cambio importante en relación a la presentación de los contenidos. Como ya señalamos, se decidió separar los contenidos institucionales de la Memoria de los datos numéricos presentes en la Reseña Informativa y Estados Contables 2009. Esta separación permitió llegar con mejor nivel de eficacia a una diversidad de públicos que buscan información diferente en una publicación de estas características. El proceso de redacción, sin embargo, fue el mismo al de años anteriores, liderado por la Gerencia de Relaciones Institucionales. En una primera etapa, se definió el concepto rector que guiaría los contenidos de la publicación. Luego, se recopilaron los datos contables actualizados con el cierre del balance del año, se registraron los principales logros de la compañía en materia de negocios, inversiones, gestión ambiental, desarrollo de capital humano y responsabilidad social. Posteriormente, se hicieron las correcciones pertinentes, y la traducción al inglés. Finalmente, se coordinó con Macrini & Menéndez la etapa de diseño gráfico y diagramación de la publicación. El proceso de elaboración de los contenidos del Reporte de Sustentabilidad 2007-­2008 fue un desafío porque significó armar un equipo de trabajo específico, asesorado por Fundación Compromiso para seguir los lineamientos G3 de Global Reporting Initiative. Ese equipo de trabajo involucró a referentes de todas las áreas de la compañía. En una primera etapa se definió la matriz de indicadores a partir de la cual TGS evaluaría su gestión económica, social y ambiental con datos cuantitativos. Para ello, se utilizó como base los indicadores descriptos en el primer Reporte de Sustentabilidad 2005-­2006. En este primer estadio fue de gran utilidad el trabajo de revisión de procesos y análisis de desempeño realizado por la Compañía al presentarse en el Premio Nacional a la Calidad;; como así también todos las otras instancias de evaluación de la gestión a la que la Compañía estaba habituada a atravesar, como Normas ISO y OHSAS, Sarbanes Oxley y Great Place to Work. En una segunda instancia, cada uno de los integrantes del equipo de trabajo proveyó la información correspondiente a su rol. Luego, se corrigieron los contenidos y se validaron de acuerdo al área a la que correspondían. Finalmente, se coordinó con el estudio de Macrini & Menéndez la etapa de diseño y diagramación, con algunas ediciones finales de contenidos. Producción editorial La última etapa en la elaboración de la Memoria y Balance 2009 y el Reporte de Sustentabilidad 2007/2008, fue la producción editorial de ambas publicaciones. Una sola versión en el caso de la Memoria y Balance 2009 ya que se hizo una edición bilingüe, y dos versiones una en español y otra en inglés en el caso del Reporte de Sostenibilidad 2007-­2008. Para el Reporte de Sustentabilidad 2007/2008 se utilizó un sistema de impresión offset con formato 21.6 x 28 cm. La publicación cuenta con 62 páginas interiores impresas a 4 colores en papel ilustración mate de 170 gramos con laca sectorizada en imágenes y recursos gráficos. Y, las últimad 2 páginas, impresas a 1 color en cartulina de 300 gr, con troquel. La tapa y contratapa fueron confeccionadas en papel ilustración mate de 300 gramos e impresas a 4 colores con polipropileno mate, laca texturizada y sectorizada en tapa y laca sectorizada en contratapa. El Reporte se entregó dentro de una caja contenedora desarrollada en papel ilustración de 350 gramos e impresa a 4 colores con polipropileno mate y laca sectorizada en tapa y contratapa. Se imprimieron 500 ejemplares en español y 500 en inglés con encuadernación binder. Para la Memoria y Balance 2009, como ya señalamos en el punto Conceptualización, se utilizaron dos soportes. Por un lado, la Memoria 2009 se imprimió en offset con formato 21x29.7 cm. compuesta de 42 páginas interiores impresas a 4 colores en papel ilustración de 150g. con laca sectorizada en fotos y recursos gráficos. La tapa y contratapa, también impresas a 4 colores en papel ilustración de 300gr. con acabado en polipropileno mate y laca sectorizada en recursos gráficos. Se imprimieron 500 ejemplares con encuadernación cosida. Por otro lado, el Balance con el análisis de resultados contables de 2009 se publicó en formato CD, calzado en la retiración de contratapa de la Memoria 2009. Evaluación La Memoria y Balance y el Reporte de Sustentabilidad son materiales de consulta frecuente en la compañía, y constituyen una fuente importante de información no solo para el área de Relaciones Institucionales, sino también para el área de Recursos Humanos para el desarrollo de su marca empleadora y como información clave que reciben los nuevos empleados durante el proceso de inducción. Se entregaron un total de 500 ejemplares de la Memoria y Balance 2009 y del Reporte de Sustentabilidad 2007-­2008. Un número inferior al de años anteriores pero siguiendo una estrategia de eficacia en la comunicación en la segmentación de públicos y diversificación de los canales de comunicación. La incorporación de información en soporte digital fue una decisión apoyada en criterios de sustentabilidad. La adopción de un estándar internacional como el Global Reporting Initiative le permite además a la compañía comparar su gestión económica, social y ambiental con otras compañías a nivel mundial, asumiendo mayores compromisos en el mantenimiento y superación de los indicadores de desempeño. Tanto la Memoria y Balance 2009 como el Reporte de Sustentabilidad 2007/2008 representaron el compromiso de TGS con la transparencia en la comunicación de su gestión y la mejora continua en todos sus procesos, incluidos los de comunicación. Ambas publicaciones están disponibles en formato PDF en la página Web www.tgs.com.ar PREMIOS EIKON 2010 Categoría: Comunicaciones Financieras o con los Inversores Caso: TGN 2009 Memoria y estados contables Empresa: Transportadora De Gas Del Norte S.A. -­ TGN Agencia: Macrini&Menéndez Por TGN: José Montaldo Gerente De Asuntos Institucionales y Regulatorios;; María Carla Covini Coordinadora De Asuntos Institucionales Introducción La Compañía A lo largo de sus 6.062 km de gasoductos, Transportadora de Gas del Norte S.A. (TGN) es la empresa dedicada al transporte de gas natural por gasoductos de alta presión en el centro y norte de la República Argentina. A través de sus dos gasoductos troncales, el Norte y el Centro Oeste, TGN abastece a 8 de las 9 distribuidoras de gas y a numero¬ sas generadoras eléctricas e industrias del mercado doméstico ubicadas en 14 provincias argentinas. A su vez, el sistema de TGN está vinculado con el transporte de gas al centro \QRUWHGH&KLOHDWUDYpVGHORV*DVRGXFWRV*DV$QGHV*DVGHO3DFt¿FR\1RUDQGLQRDOVXUGH%UDVLOSRU
medio del Gasoducto a Uruguayana (TGM) y a la provincia de Entre Ríos y República Oriental del Uruguay por el Gasoducto Entrerriano. En total TGN opera y mantiene cerca de 8.700 km de gasoductos. Como SUHVWDGRUDGHXQVHUYLFLRS~EOLFRQDFLRQDO7*1VHHQFXHQWUDVXMHWDDXQDVLJQL¿FDWLYDUHJXODFLyQHVWDWDO
basada en la Ley del Gas Nro. 24.076, que es ejercida por el Ente Nacional Regulador del Gas (ENARGAS). Contexto Histórico Desde el inicio de sus operaciones en diciembre de 1992, TGN expandió la capacidad de transporte desde cabecera de 22,6 MMm3/día a 54,4 MMm3/día, lo que representa un incremento de más del 141%. Las expansiones, así coPRODVQXPHURVDVREUDVGHPDQWHQLPLHQWR\FRQ¿DELOLGDGGHOVLVWHPDHLQFRUSRUDFLyQ
de tecnologías de última genera¬ción, requirieron inversiones por un importe aproximado de US$ 1.166 millones por parte de TGN. En términos físicos, las expansiones a cargo de TGN exigieron la instalación de más de 1.300 km de nuevos gasoduc¬tos, la construcción de 5 nuevas plantas compresoras y la instalación de 14 equipos turbocompresores, los que adicionaron 150.000 HP de potencia instalada al sistema. Desde el año 2005 se desempeña como Gerente de Proyecto de las ampliaciones realizadas bajo ODPHWRGRORJtDGH¿GHLFRPLVRV¿QDQFLHURVFUHDGRVSRUHO*RELHUQR1DFLRQDO$VtVHLQFRUSRUDURQDOVLVWHPD
de TGN, 2 nuevas plantas compresoras, 588 km de gasoductos, 46.330 HP de potencia y 5 nuevos equipos turbocompresores. Expresa su responsabilidad social a través de compromisos y acciones destinadas a contribuir con el desarrollo sostenible, el diálogo y la búsqueda de creación de valor de las comunidades que integra. Para ello instrumenta acciones voluntarias vinculadas con la educación, la construcción de ciudadanía, el cuidado del medio ambiente y el desarrollo local. Está comprometida con lograr y mantener niveles de desempeño en calidad, ambiente, seguridad, salud y manejo de riesgos comparables con los mejores de la industria. Para ello ha establecido como herramienta XQ 6LVWHPD ,QWHJUDGR GH *HVWLyQ FHUWL¿FDGR TXH FXPSOH FRQ ORV HVWiQGDUHV ,62 ,62 \
OHSAS 18001. Cada paso hace visible la idoneidad, la dedicación y la acción de una empresa comprometida con el desarrollo y el crecimiento del país. El Problema Debido al continuo deterioro de la ecuación económico-­¿QDQFLHUDGHOD6RFLHGDGTXHREHGHFHDOHIHFWRGH
ODGHSUHFLDFLyQ GHOSHVR VREUHWDULIDVGRPpVWLFDVTXHSHUPDQHFHQ¿MDVFRPELQDGRFRQ una caída en los ingresos por transporte de exportación a raíz de las limitaciones gubernamentales de envío de gas al exterior y con un incremen¬to generalizado de los costos en pesos y en dólares, el 22 de diciembre de 2008 el Directorio de TGN se vio en la necesidad de postergar el pago a su vencimiento de las cuotas de capital e intereses correspondientes a sus Obliga¬ciones Negociables. Esta decisión provocó la intervención dispuesta por el ENARGAS en diciembre de 2008 a través de la Resolución ENRG I/587, la que fue prorrogada sucesivamente por este organismo hasta julio de 2010. El 23 de abril de 2009 TGN DQXQFLy OD SUHVHQWDFLyQ GH XQD RIHUWD GH FDQMH \ SHGLGR GH $FXHUGR 3UHYHQWLYR ([WUDMXGLFLDO ³$3(´
dirigida a la reestructuración total de sus pasiYRV ¿QDQFLHURV TXH IXH SRVWHULRUPHQWH PHMRUDGD \
PRGL¿FDGD SRU XQD QXHYD RIHUWD \ SHGLGR GH $3( ODQ]DGD HO GH VHSWLHPEUH GH TXH VH PDQWXYR
abierta hasta el 14 de octubre de 2009 y que obtuvo un nivel de aceptación del 87,97% computado sobre el pasLYR WRWDO VXMHWR D UHHVWUXFWXUDFLyQ $O GtD GH KR\ HO FLHUUH GH HVWD UHHVWUXFWXUDFLyQ ¿QDQFLHUD HVWi
pendiente, pero los Directivos, junto a todo el equipo, enfrentan la situación como un desafío y trabajan para convertir la crisis en una oportunidad de cambio. Esta particular circunstancia ameritaba el desarrollo de una Memoria y Balance especial, que transmitiera cabalmen¬te el respaldo de un sólido equipo mancomunado en una estrategia de cambio creativa. Objetivos La Memoria y Balance 2009 se orienta a la difusión de los indicadores que dan cuenta de la evolución y resultados del ejercicio económico de la Empresa, además de detallar las principales actividades realizadas en el período. El objetivo es llegar con la información más completa a los inversores, a la comunidad ¿QDQFLHUD HQ JHQHUDO \ D GLVWLQWRV HQWHV JXEHUQDPHQWDOHV \ S~EOLFRV GH LQWHUpV WDQWR QDFLRQDOHV FRPR
H[WUDQMHURV$VXYH]EXVFDUHÀHMDUODWUDQVLFLyQGHODFULVLVSRUODTXHSDVy7*1HQHODxR\
SRU VXSXHVWR UHÀHMDU HO WUDbajo de la empresa para superar las vicisitudes y encarar el 2010 ya con un SDQRUDPDPiVFODURHQFXDQWRDODVH[SHFWDWLYDV7RGRHVWRDWUDYpVGHXQDSUHVHQWDFLyQJUi¿FD\YLVXDO
que a nuestro criterio nos permitió lograr el concepto. Públicos La pieza HVWi GHVWLQDGD D LQYHUVRUHV \ DFFLRQLVWDV QDFLRQDOHV \ H[WUDQMHURV D HQWLGDGHV ¿QDQFLHUDV D
gobiernos y a organismos públicos con actuación o interés en el área de licencia, al área de Relaciones Institucionales de las Compañías que redistribuyen a sus públicos interesados, a periodistas especializados y a otras empresas. Canales y Medios La Memoria y Balance se presentó con un brochure de 24 páginas en el cual se revela una síntesis del IRUPDWR ¿QDO GHO &'$PEDVSLH]DVVH SURGXMHURQHQYHUVLRQHVHspañol e inglés. El canal de distribución prioritario fue el envío por correo al público objetivo, a nivel nacional e internacional. Además, se subió al sitio web de TGN, y a los sitios bursátiles de la Bolsa de Comercio Argentina y de la Comisión Nacional de Valores (CNV) y se envió internamente a las diferentes direcciones de la Compañía. Ejecución e implementación del plan /D *HUHQFLD GH $VXQWRV ,QVWLWXFLRQDOHV \ 5HJXODWRULRV GH¿QLy ORV REMHWLYRV TXH RULHQWDUtDQ HO GLVHxR GHO
plan de la Memoria y Balance 2009. Con el aval de una carta enviada por el Director General a todas las gerencias de la compañía se procedió a reunir la información. Luego se inició la redacción de los FRQWHQLGRV \ XQ UHGDFWRU H[WHUQR HVWXYR D FDUJR GH OD XQL¿FDFLyQ GH HVWLOR 3RU ~OWLPR VH UHDOL]y OD
traducción de los textos al inglés. En conjunto con la agencia macrini&menendez se proyectó un plan de trabajo para el desarrollo de la pieza, que se implementó en un plazo de tres meses, respetando el cronograma propuesto. Las etapas de ejecución fueron las siguientes: desarrollo de diseño, cotización de producción editorial, producción de fotos, armado editorial y produc¬ción editorial. Desarrollo visual Concepto general El concepto general de la memoria y balance de TGN se construyó a partir de la frase de Albert Einstein ³6LQ FULVLV QR KD\ GHVDItRV´ 'H DKt SDUWLPRV SDUD HQFRQWUDU XQ HOHPHQWR YLVXDO que nos permitiera GLVWLQJXLU D SULPHUD YLVWD OD LGHD D WUDQVPLWLU/R SODVPDPRV ¿QDOPHQWH SRU PHGLR GH XQ FRQMXQWR GH
OtQHDVTXHFUX]iQGRVHHQIRUPDLUUHJXODUORJUDQJHQHUDUXQFDRVGHHVSDFLRVLQWHULRUHVFDSD]GHVLJQL¿FDU
que algo está sucediendo. La idea en general es ir del caos a la tranquilidad y para eso nos trasladamos de un negro con líneas blancas a una transición de fondo blanco con líneas de color gris y así hasta llegar al blanco. Esta representación mediante elementos abstractos se refuerza con la producción de las fotos del Presidente y de los Directores General y de Operaciones, que comunican la solidez de una conducción segura ante la crisis. Materialización Para representar un año difícil en TGN, con muchos problemas y muchas ideas, fue necesario recurrir a ODV OtQHDV FRPR UHFXUVR JUi¿FR FHQWUDO &RQ HOODV VH ORJUy XQD WUDPD TXH DFRPSDxDGD FRQ XQD SDOHWD
cromática entre el negro y el blanco, generó una imagen irregular con mucho movimiento. Luego se trabajó con el croma de negro a gris para simbolizar la mayor crisis, continuando de gris a blanco para UHSUHVHQWDU HO ¿Q GH ORV SUREOHPDV (O WUDWDPLHQWR GH FDGD LPDJHQ GH ODV QXHYH TXH FRPSRQHQ OD
Memoria, está basado en respaldar por detrás toda la información de la empresa sin que sean vistas en su totalidad y generando un marco de contención a la lectura. Los límites de los rectángulos blancos de textos y la tipografía de palo seco permiten una lectura simple, rápida y contenida. El interior de cada capítulo contiene texto informativoy fotos que ilustran de manera indirecta los contenidos del texto, el concepto global de cada capítulo y la memoria en general. El contenedor es de alguna manera un resumen JUi¿FRTXHVLQWHWL]DWRGRDTXHOORTXHHQFRQWUDUHPRVHQHOFGLQWHUDFWLYR(OFRQFHSWRVHUHIXHU]DFRQOD
GLVWLQWDJUi¿FDGHQWURGHODVSiJLQDVLQWHULRUHVFRPRDVtWDPELpQFRQHOWUDWDPLHQWRGHODODFDVHFWRUL]DGa dentro de la pieza del contenedor. Paleta cromática: De acuerdo con el manual de identidad de TGN, trabajamos con colores institucionales como el azul de TGN y un gris neutral para los textos, además del blanco importante en las primeras páginas que se continúa en la tranquilidad de los bloques de lectura. Tipografía La tipografía principal elegida es la Helvética Neue, considerada una de las mejores tipografías a nivel internacional, proporciona una colección de anchos y pesos coherente y un diseño más actual. La Helvética HVXQDWLSRJUDItDFRQXQDDOWDOHJLELOLGDG\H¿FDFLDHQWRGRWLSRGHVLWXDFLRQHV\IXHJUDFLDVDHOODSRUOD
que Max Miedinger, quien la desarrolló en el año 1957, pasó a la historia de la tipografía. Producción de fotos Se realizaron producciones especiales de fotos, tanto en interiores como exteriores, para poder transmitir y respon¬der al concepto visual del presente de TGN. Por un lado se realizaron fotos de estudio con el Presidente, Director General y Director de Operaciones de TGN y un corpóreo gigante del isologotipo ilustrando el respaldo hacia toda la empresa. Además se desarrollaron producciones de fotos dentro de las LQVWDODFLRQHVGHODVR¿FLQDVHQODVGLVWLQWDViUHDV\DVXSHUVRQDO3RU~OWLPRVHUHFRUULyIRWRJUi¿FDPHQWH
las distintas plantas del norte del país. Puesta en página En primer lugar se realizó una selección minuciosa de imágenes y se comenzó la etapa de diagramación HGLWRULDO GH ORV WH[WRV ¿QDOHV 6LJXLHQGR HO tQGLFH GH FRQWHQLGRV FRPR JXtD VH WUDEDMy HQ EDVH D OD
siguiente estructura: Directorio y Comisión Fiscalizadora Nuestra Actividad La Industria Del Gas En La Argentina Aspectos Regulatorios Situación Financiera Aspectos Operativos Salientes Calidad, Seguridad Y Medio Ambiente Gestión De Tecnología, Sistemas Y Comunicaciones Recursos Humanos Responsabilidad Social Empresaria Para ilustrar los capítulos se utilizaron aquellas imágenes que representan los aspectos más relevantes de TGN. 3URGXFFLyQJUi¿FD La empresa adjudicada para la realización del desarrollo estético y la producción de la misma fue macrini&menendez ya que cumplía con los requisitos para poder llevar a cabo el desafío del trabajo. En la realización de la Memoria y Balance 2009, se utilizaron 2 sistemas de impresión, en el caso del brochure se realizó en offset y el cd en serigrafía y cada uno con sus diferentes características técnicas. Cantidad de Memoria y Balance 300 Brochure 300 CD Brochure Contenedor externo formato 73.5x29.7cm abierto (cerrado 21x29.7cm) impreso a 4 colores de frente y 4 colores de dorso. Impreso sobre ilustración mate de 300grs. Trazados en 3 posiciones y troqueladas. Con polipropileno mate más laca sectorizada en las imágenes. En el caso de la aplicación del cd dentro del brochure se solucionó con un triángulo de plástico para mini cd, con un agarre del 100%. Cuadernillo compuesto de 24 páginas formato 21x29.5cm impreso a 4 colores de frente y 4 colores de dorso, impreso sobre papel ilustración mate de150grs. Cuadernillo posteriormente pegado al contenedo. Impresos en Triñanes Gráfica S.A. que alcanza lDFHUWL¿FDFLRQ1RUPD,62 &' ,PSUHVRV \ GHVDUUROODGRV SRU OD HPSUHVD 7HOWURQ 6$ TXH DOFDQ]D OD FHUWL¿FDFLRQHV 1RUPD ,62
9001:2000 e ISO 9002. Cada uno de estos cd son originales y con un número correspondiente de identificación. Evaluación La Memoria y Balance de TGN constituye un completo e importante material de información y consulta, no sólo para el área de Asunto Institucionales, sino también para todas las gerencias que conforman la Compañía. El exhaustivo trabajo liderado por el área de Asuntos Institucionales, y llevado adelante conjuntamente con los demás sectores de la Compañía y varios actores externos (redactor, traductor, fotógrafa, consultora de impresión, agencia de publicidad, imprenta) quedó plasmado en una pieza editorial GHFRQWXQGHQWHSUHVHQFLDFRQXQFRQWHQL¤GRGHWDOODGRTXHUHÀHMDOD0LVLyQ9LVLyQ\9DORUHVGH
7*1 /RV PLVPRV VH UHD¿UPDQ \ FRQVROLGDQ HQ HO GHVDUUROOR YLVXDO DOFDQ]DGR /D SLH]D VH GLVWULEX\y
exitosamente entre los jefes de zona y jefes de sección de las 19 plantas compresoras actuales de TGN, llegando a las 14 provincias por las que atraviesa el gasoducto. Se difundió además entre las áreas FRPHUFLDO ¿QDQFLHUD H LQVWLWXFLRQDO GH ODV HPSUHVDV GHO VHFWRU \ D ORV 'LUHFWRUHV *HQHUDOHV GH FDGD
licenciataria. Finalmente se comunicó a los periodistas especializados y a las universidades y colegios que visitaron las plantas en el mes de mayo y junio. PREMIOS EIKON 2010 Categoría: Eventos Caso: TEDxBuenosAires Empresa: TEDxBuenosAires Agencia de PR: Muchnik, Alurralde, Jasper & Asoc. / MS&L Integrantes: Por Muchnik, Alurralde, Jasper & Asoc. / MS&L: Laura Muchnik, Carolina Wartelsky y Juan Muchnik Introducción TEDxBuenosAires es un emprendimiento organizado por un grupo de profesionales que trabajan en red sin fines de lucro, con el objetivo de desarrollar una plataforma para difundir ideas e iniciativas sociales en campos tan diversos como la tecnología, el diseño, las artes y las ciencias. TEDxBuenosAires es una licencia de TED, una organización no comercial dedicada a difundir ideas que merecen ser contadas. Con este espíritu, TED creó TEDx, un programa de eventos organizados de manera independiente, que reúnen a personas que comparten sus experiencias a través de conferencias de 18 minutos, donde, de una manera creativa e interactiva con el público presente, se comparten ideas innovadoras. Cuando comenzó hace 25 años en California, la conferencia duraba cuatro días. Desde ese momento, la iniciativa creció y se modificó para apoyar a todos aquellos que intentan crear un mundo mejor. La conferencia anual invita a los pensadores y hacedores más importantes del mundo, entre los que se destacan: Bill Gates, Al Gore, Jane Goodall, Elizabeth Gilbert, Sir Richard Branson, Nandan Nilekani, Philippe Starck, Ngozi Okonjo-­Iweala, Isabel Allende y el Primer Ministro británico, Gordon Brown, entre muchos otros. Una vez finalizado el evento, las charlas están disponibles de manera gratuita en TED.com, donde, gracias al Proyecto de Traducción Abierta, cada conferencia es subtitulada. TED también ha establecido el Premio TED anual, a través del cual se distingue a individuos excepcionales con un fuerte deseo de cambiar el mundo y TEDx ofrece la posibilidad de que se organicen eventos independientes en cualquier parte del mundo. Asimismo, el programa TEDFellows ayuda a las personas innovadoras de todo el Planeta a que puedan llevar a cabo sus proyectos y a ser parte de la comunidad TED para poder amplificar el impacto de sus actividades. TEDxBuenosAires propuso crear la primera experiencia en la Argentina: un encuentro de carácter gratuito para 1480 personas, donde 20 oradores del campo de las ideas, las iniciativas sociales, el diseño, las artes y las ciencias compartieran lo que piensan, hacen y sueñan para difundir y debatir ideas y contenidos que generen un impacto positivo en la sociedad de hoy y del futuro. Objetivos ‡ 3RVLFLRQDU D 7('[%XHQRV$LUHV FRPR HO SULPHU HYHQWR JUDWXLWR GHGLFDGR D OD GLIXVLyQ GH ODV LGHDV HQ
áreas multidisciplinarias como la ciencia, tecnología, arte y diseño. ‡,QVWDODUHOGHEDWHGHLGHDVHQODVRFLHGDG ‡*HQHUDUXQFDPELRSRVLWLYR\FRQVWUXFWLYRSRVLELOLWDGRSRUODWUDQVPLVLyQ\HOFRPSDUWLUGHH[SHULHQFLDV
reales. ‡2IUHFHUXQDH[SHULHQFLDGHDOWDFDOLGDGDFRUGHFRQODSURSXHVWa ofrecida por TED a nivel mundial. ‡ *DUDQWL]DU OD SOXUDOLGDG HQ HO DFFHVR D OD LQIRUPDFLyQ H LJXDOGDG GH RSRUWXQLGDGHV SDUD SDUWLFLSDU GHO
evento. El primer desafío TEDxBuenosAires fue comunicar esta iniciativa al público en general, ya que, al ser una nueva propuesta en el país, debía lograr trascender el círculo de los internautas que conocían las conferencias a través de los videos de la web. Entonces, para lograr un verdadero impacto en la sociedad -­
objetivo principal del evento-­ se necesitó llegar a los medios masivos de comunicación, sin dejar de respetar y propiciar el pluralismo, garantizando la igualdad de oportunidades para todos los que quisieran formar parte de esta experiencia. El primer paso entonces fue desarrollar una plataforma web www.tedxbuenosaires.org desde la cual se centralizaron todas las comunicaciones y anuncios sobre el evento. Los interesados podían acceder a la información, conocer los perfiles de los oradores y de los organizadores e inscribirse para participar. El sitio también se utilizó para la transmisión en vivo de las conferencias. Paralelamente, se habilitaron cuentas en Twitter, Facebook, Linkedin y Sonico donde se podía interactuar directamente con la organización. En noviembre de 2009 se realizó el primer comunicado inaugurando así el contacto con los medios y la prensa en general, con el objetivo de comenzar a difundir la propuesta y la posibilidad de pre registrarse en el evento. Cuando se lanzó el segundo comunicado en marzo de 2010 ya se contabilizaban 3.100 pre registrados, superando ampliamente la capacidad del lugar. Finalmente, las inscripciones cerraron con un total de 5389 personas. Para garantizar la igualdad de posibilidades se optó por la realización de un sorteo de entradas, por los 1300 lugares disponibles, pero dado el gran interés, se optó por instalar pantallas gigantes en la Facultad de Derecho y la Facultad de Ciencias Exactas y Naturales de la Universidad de Buenos Aires, en ORT y en ITBA donde se transmitió el evento en vivo. Pero además, para poder lograr la difusión y alcance de la propuesta se cerró un acuerdo con el grupo La Nación y Turner para que participasen en calidad de media partners del evento. De esta manera, se obtuvieron espacios de publicidad en el diario La Nación y en el portfolio de medios del grupo La Nación así como una gran cantidad de spots en los principales canales de cable de Turner (CNN en español, ISAT, Much Music, entre otros). La locación también fue clave: contando con La Rural como sponsor, se decidió hacer uso de las instalaciones y así poder contar con un lugar acorde a las necesidades logísticas para la óptima realización el encuentro. Además, acompañaron la iniciativa las siguientes compañías: Telefónica, Banco Hipotecario, Los Grobo, Brapack, Intel, Red Hat, Globant, Dridco, Filmsuez, Cachamai, Lightech, Café Martinez y Cardón, quienes hicieron posible ofrecer un evento de primera línea. El 8 de abril todos los acreditaros pudieron ingresar a La Rural donde recibieron un desayuno y una bolsa con el booklet con información acerca de TED y de TEDxBuenosAires, también las biografías de los oradores, además de regalos de los sponsors. Durante los coffee breaks, los participantes también podían disfrutar de espacios de intercambio. Respetando el espíritu de TED, no se dispusieron espacios VIP ni se contó con invitaciones especiales. Sólo se dispuso un área de prensa, con conectividad y herramientas informáticas a disposición para facilitar el trabajo de difusión. La estrategia de comunicación previa al evento consistió en el envío constante de información a medios de Tecnología, Salud, Información General,Sociedad, Arte, Ciencia, Marketing y Agendas. Se designó a un vocero del evento, Gerry Garbulsky, quien fue el encargado de dar entrevistas a los medios. Se ofrecieron y gestionaron notas con los oradores y el día previo al evento se coordinó instancias one to one. El evento fue presentado por Adrián Paenza y los oradores participantes fueron: Luis Pescetti, Bea Pellizzari, Manu Ginóbili, Alberto Kornblihtt, José Cibelli, Gabriel Gellón, Inés Sanguinetti, Roberto Guareschi, Mariano Sigman, Luis Moreno Ocampo, Miguel Brechner Frey, Constanza Ceruti, Matías Zaldarriaga, Marcos Salt, Jaime Lerner, Rafael Spregelburd, Mercedes Salado Puerto, Axel Krygier y Marcelo Moguilevsky. Públicos ‡ 7('[%XHQRV$LUHV HVWXYR GLULJLGR DO S~EOLFR JHQHUDO LQYLWDQGR D OD SDUWLFLSDFLyQ DELHUWD D WRGRV ORV
sectores sociales, con el objetivo de interactuar e intercambiar ideas y experiencias positivas. ‡'HVGHODFDPSDxDGHFRPunicación se propuso alcanzar la mayor cantidad de audiencia contactando a medios de Tecnología, Salud, Información General, Sociedad, Arte, Ciencia, Marketing, Jóvenes, Lifestyle, Arquitectura, Agendas, Tendencia y medios Femeninos, tanto en gráfica, como radiales, digitales y televisivos. ‡5HGHVVRFLDOHV Comunicación ‡'HVDUUROORGHXQDSODWDIRUPDGLJLWDOGHIiFLODFFHVRFRPRFDQDOSULQFLSDOGHFRPXQLFDFLyQGLUHFWD ‡5HDOL]DFLyQGHJDFHWLOODV ‡/DFRPXQLFDFLyQKL]RKLQFDSLpHQHOVLWHZZZWHG[EXHQRsaires.com y en las redes sociales. ‡ 6H RSWy SRU /D 5XUDO FRPR HVSDFLR GDGR TXH FXPSOtD FRQ ORV UHTXLVLWRV QHFHVDULRV SDUD JDUDQWL]DU HO
armado y el desarrollo de un evento de estas características. ‡ &RQIHFFLyQ \ HGLFLyQ GH XQ ERRNOHW GH DOWtVLPD FDOLGDd gráfica y editorial, disponible para todos los asistentes. ‡(GLFLyQGHOPDWHULDODXGLRYLVXDO\XSORDGDOVLWHGHWRGDVODVFRQIHUHQFLDV Estrategia implementada ‡'HVDUUROORGHXQD&DPSDxDGH3UHQVD\'LIXVLyQDQLYHOQDFLRQDO ‡(VWUDWHJLDGHVSRQVRring. ‡$FXHUGRVFRQ0HGLD3DUWQHUV ‡'LIXVLyQHQUHGHVVRFLDOHV\PHGLRVRQOLQH ‡3DUWLFLSDFLyQHQODSODQLILFDFLyQJHQHUDOGHOHYHQWR7('[%XHQRV$LUHV ‡$FFLRQHVGH35HQYtRGHJDFHWLOODVLQIRUPDFLyQHLQYLWDFLRQHVDORVPHGLRV ‡2UJDQL]DFLyQ\FRRrdinación del evento. ‡&RRUGLQDFLyQGHHQWUHYLVWDVRQHWRRQHFRQORVRUDGRUHV ‡+RVSLWDOLW\SDUDWRGRVORVSHULRGLVWDVDVLVWHQWHV ‡*HVWLyQGHHQWUHYLVWDVFRQORVRUDGRUHVHQPHGLRVJUiILFRVWHOHYLVLYRV\UDGLDOHV ‡*HVWLyQGHHQWUHYLVWDVFRQHOYRFero, Gerry Garbulsky, en medios gráficos, televisivos y radiales. Resultados TEDxBuenosAires superó todas las expectativas de los organizadores, ya desde la etapa de registración contabilizando 5389 solicitudes de acreditaciones, cuadriplicando la capacidad del evento. Finalmente 1480 formaron parte del primer encuentro TEDxBuenosAires y más de 10.000 personas lo siguieron en directo vía web. En cuanto a publicaciones y participación de los medios: ‡)XHURQSXEOLFDGDVQRWDVHQORVPHGLRVJUiILFRV\online. ‡6HUHDOL]DURQGHHQWUHYLVWDVHQUDGLR\79DRUDGRUHV\YRFHURV\XQDJUDQFDQWLGDGGHPHQFLRQHV ‡6HUHFLELHURQSHGLGRVGHDFUHGLWDFLyQHVSRQWiQHDSRUSDUWHGHSHULRGLVWDV ‡6HDFUHGLWDURQSHULRGLVWDV\OtGHUHVGHRSLQLyQ ‡$VLVWLHUon 81 periodistas de los principales medios de la Argentina durante todo el día. TEDxBuenosAires contó con 8 avisos publicados en medios gráficos y 23 avisos pautados en espacios en la vía pública: ‡'LDULR/D1DFLyQDYLVRVSXEOLFDGRV ‡'LDULR(O&URnista (2 avisos publicados) ‡5HYLVWD2EORJRDYLVRVSXEOLFDGRV ‡5HYLVWD1RFKH3RODUDYLVRSXEOLFDGR ‡)LOP6XH]DYLVRVHQYtDS~EOLFD A su vez, se emitieron 123 spots de 30 segundos cada uno en los siguientes canales de TV: ‡&11HQ(VSDxRO ‡0XFK0XVLF ‡,6DW ‡6SDFH TNT La gestión de prensa obtuvo 228 repercusiones entre las que se destacan: Medios gráficos La Nación Revista Perfil Brando La Nación, Información General Oh LaLá! Veintitrés Página 12, Futuro Crítica La Nación, Suplemento de Ciencia y Salud Página 12, Sociedad Revista Ñ, Clarín El Cronista Noticias La Prensa Apertura La Razón 7 Días Fortuna Medios digitales La Nación online Clarin.com El Cronista online Página 12 online Perfil.com Infobae.com Infobae Profesional TN On Line Apertura online G7 digital Information Technology Newsweek Blogs 90+10 Uno y Punto Riesgo & Recompensa Mate Way Clarisa Herrera La Propaladora Gastón Mirra eBlog Radios Continental Mitre Palermo Cultura Metro Identidad América Blue El Mundo TV CanDO3URJUDPD³&LHQWtILFRV,QGXVWULD$UJHQWLQD´ 0HWUR3URJUDPD³&RQWURO$UJHQWLQD´ 0HWUR3URJUDPD³5HVSRQVDELOLGDG6RFLDO´ CN23. Noticiero. Principales medios nacionales asistentes a TEDxBuenosAires Apertura Brando Clarín Crítica El Cronista Infobae Information Technology La Nación La Nación digital Clarin.com La Prensa Mercado Newsweek Noticias Página 12 Perfil Blue Revista Ñ, Clarín Veintitrés Yahoo CN23 IT Sitio TN.com.ar A nivel cualitativo, TEDxBuenosAires logró superar todas las expectativas. El evento no sólo se instaló como una iniciativa con un gran reconocimiento en los medios de comunicación, sino que fue reconocido por los periodistas y líderes de opinión como una iniciativa de alto valor. Además, el espíritu de TED logró instalarse en el público masivo, quienes celebraron la iniciativa a través de mails, foros, blogs y sites de internet. De esta manera, TEDxBuenosAires pudo posicionarse como un encuentro innovador y motivador para toda la sociedad. Esta iniciativa logró crecer localmente y hoy ya fue anunciada su segunda edición -­prevista para marzo de 2011-­ que incluirá el cambio de nombre por TEDxRíodelaPlata, dado que ampliará su contenido para acercar ideas inspiradoras en las que hoy están trabajando los profesionales más destacados del país y la región. PREMIOS EIKON 2010 Categoría: Eventos Caso: Un encuentro tecnológico de cara a la gente Empresa: Universidad de La Punta Agencia de PR: Mazalán Comunicaciones Integrantes: Por Universidad de la Punta: Alicia Bañuelos;; Néstor Arellano;; Melina Manzur Por Mazalán Comunicaciones: Carlos Mazalán;; Eduardo Bermúdez;; Laura Conde;; Gabriela Fabrizio. Introducción La Universidad de La Punta (ULP) ha sido creada con el propósito de formar profesionales en áreas estratégicas asociadas al crecimiento y progreso de la Provincia de San Luis. Al ser una Universidad provincial, su misión es ser el instrumento para darle a cada habitante de San Luis la oportunidad de formarse intelectual, social y culturalmente. Siguiendo este criterio, se dictan carreras relacionadas con el Cine -­en concordancia con la ley de promoción de la Industria del Cine-­ y el Desarrollo de Software, conforme a la adhesión de la provincia a la Ley Nacional de Promoción del Software. Asimismo, se forman profesionales en las áreas de Turismo, Agro, Empresa y Medioambiente, acompañando la política estratégica de la provincia. La Universidad de La Punta es el órgano de gestión de la agenda digital de la provincia de San Luis, la cual es ejecutada por el gobierno provincial desde 2007, con el objetivo principal de incluir a la provincia en una próspera economía digital. Este plan estratégico denominado San Luis Digital está dividido en seis ejes (Infraestructura, Gobierno, Productivo, Educativo, Tecnológico y Marco Legal) para agrupar las distintas iniciativas que se están ejecutando o se ejecutarán durante los próximos 20 años. Todas las iniciativas que se llevan a cabo en el marco de la agenda digital se dan a conocer en el evento anual denominado, al igual que el plan: San Luis Digital. El evento nació con el propósito de reunir en un mismo escenario a todos los actores de la agenda digital, al mismo tiempo que se propuso incluir a los habitantes de la provincia en la Sociedad del Conocimiento y mostrar los avances anuales de la ejecución del plan San Luis Digital. Otro de los principales objetivos es brindar la oportunidad a todos los argentinos de conocer las acciones que desarrolla la Universidad de La Punta, en conjunto con el Gobierno provincial, dentro del marco de esta Agenda Digital. El plan San Luis Digital está dirigido a todos los sectores de la sociedad puntana para que puedan tener un mayor acercamiento a la tecnología y aprovechen todas las bondades que ella brinda. Este es el mensaje central que se quiere transmitir en el evento. El mismo está dirigido a alumnos, docentes, empresas, entes de gobiernos, medios de comunicación y comunidad en general. Para los alumnos se brindan charlas informativas acerca de la actualidad del mundo tecnológico y sobre la industria tecnológica radicada en San Luis, al mismo tiempo que se les da la posibilidad de contactarse directamente con las empresas del sector. Para los docentes lo más atractivo del evento se centra en las capacitaciones diseñadas especialmente para ellos tendientes a actualizarlos sobre las últimas herramientas tecnológicas disponibles para utilizar en el aula. Para las empresas se destinó un lugar especial dentro del evento en el que instalaron sus stands y presentaron al público sus iniciativas y sus propuestas de productos y servicios, entre otras cosas. /RPiVDWUDFWLYRGH6DQ/XLV'LJLWDO³8QHQFXHQWURWHFQROyJLFRGHFDUDDODJHQWH´HVTXHVHWUDWD
del único evento de tecnología dedicado a la comunidad en su conjunto y pensado para ella. San Luis DLJLWDO FRQWy FRQ ORV VHFWRUHV µ1DWLYRV 'LJLWDOHV¶ \ µ-yYHQHV1HW¶ HO SULPHUR SHQVDGR SDUD ORV PiV
pequeños;; el segundo para la juventud. Entre las muchas actividades pensadas para los más chiquitos, se encontraron un laboratorio de arte digital y un taller en que les enseñaron a medir la cantidad de dióxido de carbono que se emite a la atmósfera con el uso de la electricidad. San Luis Digital 2009 también fue un evento interesante para las entidades gubernamentales quienes tomaron contacto con las iniciativas de inclusión desplegadas por la provincia de San Luis, y gestionadas por la Universidad de La Punta. Conocer cómo se lleva a cabo la implementación de cada proyecto, le permite a representantes de otras provincias y ciudades evaluar la posibilidad de replicar alguna de las iniciativas en sus propios territorios. En el marco de la edición 2009, tuvo lugar la firma de un acuerdo entre la provincia de San Luis y la ciudad de Buenos Aires con el objetivo de fomentar el crecimiento del distrito tecnológico porteño. Para los periodistas se elaboró una agenda del evento enfocada en aquellos anuncios e hitos que se consideraron más relevantes desde el punto de vista periodístico. La misma les fue enviada con suficiente antelación permitiéndoles definir cuáles eran las iniciativas, proyectos o anuncios sobre los que le gustaría hacer foco, al mismo tiempo que les dio la posibilidad de saber cuáles eran los referentes claves de la industria que iban a participar del evento y así poder coordinar entrevistas con ellos. En el evento se dispuso una sala de prensa con todas las comodidades (computadoras, conexión a Internet, telefonía) para que puedan trabajar sin inconvenientes y se habilitó una sala especial para aquellos periodistas que necesitaban hacer transmisiones radiales. Además de la prensa local, viajaron al evento 28 periodistas desde Buenos Aires, quienes representaron a Clarín, Página /12, Crítica, Infobae, Infobae Profesional, Information Technology y la agencia española de noticias EFE, entre otros. La Universidad de La Punta cubrió todos los gastos de los periodistas en el marco del evento, incluyendo traslados, alojamiento y refrigerios. Para combinar el trabajo con la dispersión, se programó un paseo turístico pensado especialmente para la prensa, que incluyó un recorrido por la localidad de Potrero de los Funes. Para difundir San Luis Digital en 2009, se optó por una estrategia integral que incluyó a todos los medios de comunicación en todas sus formas: gráficos, radiales, televisivos y online, tanto de alcance provincial como nacional. La campaña comunicacional del evento se dividió en tres partes troncales. La primera fue previa al mismo, en la que se realizó un trabajo de difusión y promoción de las actividades que se iban a llevar a cabo durante el encuentro. La segunda parte de la estrategia se implementó durante el evento. En esta parte en concordancia con la temática de San Luis Digital y aprovechando los recursos tecnológicos que disponemos hoy en día, se hizo una transmisión simultánea de todas las actividades en el momento en que ocurrían a través de pantallas desplegadas en el Predio Ferial, al mismo tiempo que se podía acceder a ellas a través del sitio web de San Luis Digital. Por último, se realizó una tarea de seguimiento de toda la información publicada sobre el evento tanto en los medios provinciales como en los nacionales. Para llevar adelante la estrategia comunicacional de San Luis Digital se utilizaron distintas herramientas de acuerdo a las necesidades de cada etapa de la campaña. El 4 de agosto de 2009 se realizó la presentación oficial de San Luis Digital Un encuentro tecnológico de cara a la gente en San Luis. El lugar elegido para la misma fue la Casa de Gobierno de la provincia y estuvo a cargo de la rectora de la Universidad, Alicia Bañuelos. Dos días después, se realizó una presentación del evento en Buenos Aires en la sede de la Sociedad Científica Argentina (SCA), en la que participó el gobernador de la provicia, Alberto Rodriguez Saá. A la misma asistieron más de 200 invitados entre empresarios del sector tecnológico y periodistas. Además, se pautaron entrevistas radiales y televisivas con las autoridades máximas de la Universidad de La Punta, tanto con medios de alcance local como nacional. El Departamento de Prensa de la Universidad de La Punta, en conjunto con Mazalán Comunicaciones, estuvo a cargo de la producción de gacetillas sobre todos los temas abordados en el evento. El material fue enviado a medios digitales, radiales, televisivos y gráficos, tanto a nivel provincial como nacional. Desde lo publicitario se realizó una campaña integral para promocionar al evento que incluyó publicidades en medios gráficos, radiales y televisivos. Además, San Luis Digital cuenta con una página web propia a través de la cual se puede acceder a toda la información vinculada al evento. A través de ellas se puede tomar contacto con datos vinculados al lugar en que se desarrollará el evento e información relacionada con la oferta de hospedaje de la zona para aquellos que asistan desde otros puntos del país. Asimismo, se puede acceder a la agenda del evento que reúne todas las actividades programadas y consigna en qué lugar se realizará cada una y quiénes participarán de cada disertación. Una función fundamental de la página web es que permite realizar las pre-­acreditaciones al evento lo que agiliza el ingreso de los asistentes, quienes sólo deben acercarse a la entrada del predio a retirar la credencial que los habilita a participar del megaevento. También se puede acceder al listado de empresas y entes de gobierno que participan del evento y a videos de las distintas conferencias, capacitaciones, premiaciones y firmas de convenios que van teniendo lugar. En el mismo site, en la sección de prensa, podemos encontrar todas las gacetillas que fueron enviadas antes, durante y después del evento, al mismo tiempo que podemos observar las principales repercusiones del mismo en medios locales, nacionales e internacionales. Ejecución del Plan ³6DQ /XLV 'LJLWDO -­ Un encuentro tecnoOyJLFR GH FDUD D OD JHQWH´ WXYR OXJDU HQ HO 3UHGLR )HULDO \ GH
Convenciones de la Ciudad de San Luis. En cuando a la distribución del espacio, se destinó un sector a las empresas del sector tecnológico, el Gobierno Digital y la Universidad de La Punta. A este se lo denominó ³(PSUHVDV´ \HVWXYRFRQVWLWXLGRSRUVWDQGVODERUDWRULRVTXHFRQWDEDQFRQFRPSXWDGRUDV\XQD
pizarra digital con proyector y sonido. Otra carpa estuvo destinada a las actividades relacionadas con los distintos proyectos que lleva adelante la 8QLYHUVLGDG WDPELpQ FRQWy FRQ ODERUDWRULRV KDQGV RQ ODE \ IXH GHQRPLQDGD ³1DWLYRV 'LJLWDOHV´ (VWH
espacio se dividió en Astronomía, Ambiente, Balance Cero, Olimpíadas, Contextos, Robótica, juegos educativos, juegos científicos, Ajedrez Escolar Inicial, Arte Digital y un estudio de TV. 8QDWHUFHUDFDUSDIXHGHQRPLQDGD³-RYHQHV1HW´\XQDYH]PiVVHFRQWyFRQHODUPDGRGHODERUDWRULRV
hands on labs que se utilizaron para las actividades relacionadas con: Gaming.Net, Robótica, juegos educativos, juegos científicos y un estudio de radio. Se decidió destinar otro sector para las conferencias de disertantes de primer nivel, ya que estas tendrían un mayor número de audiencias. Por eso este espacio tenía capacidad para más de 400 personas. Allí tuvieron la palabra: Guillermo Cascio, presidente de IBM Argentina;; Guillermo Almada, director de Sector Público de Microsoft Latinoamérica, Esteban Galuzzi, Gerente General para las operaciones de Intel Cono Sur, Alejandro Prince, Presidente de Prince & Cooke y Anibal Carmona, Presidente de Unitech, entre muchos otros. El sector destinado a la acreditación de los asistentes al evento estuvo ubicado en otro sector del predio. Allí se les daba la bienvenida a los invitados y se les entregaba material sobre la Universidad de La Punta. 7DPELpQ VH DUPy XQD FDUSD FRQ FDSDFLGDG GH SHUVRQDV TXH IXH GHQRPLQDGD ³,QIRUPDU´ $OOt VH
brindaron charlas destinadas a los alumnos del anteúltimo año del colegio secundario, en las que se abordó la temática de las posibilidades de trabajo que ofrece la industria tecnológica. Este mismo espacio VHXWLOL]yHOILQGHVHPDQDGHOHYHQWRSDUDODILQDOSURYLQFLDOGHOFHUWDPHQ³*DPLQJ1HW´\XQ*UDQG3UL[
de Ajedrez Escolar. El sector VIP estuvo situado en una carpa con capacidad de 50 personas. La misma contaba con una sala de estar compuesta de sillones. En cuanto a la propuesta gastronómica, se ofreció a los asistentes al evento una variada selección de stands, que incluyeron un sector de comidas asadas, otro de comidas rápidas y un bar. Evaluación/Pruebas San Luis Digital Un encuentro tecnológico de cara a la gente, se transformó en el evento de tecnología del año 2009. Este hecho se vio reflejado en las notas obtenidas en medios de IT y de educación en todo el país. Al evento asistieron 42.927 personas de los cuales 5572 eran alumnos de escuelas de la provincia y 1907 eran docentes. La cifra superó ampliamente a las 31.241 visitas logradas en 2008 y las más de 10.000 alcanzadas en 2007. Fueron 16.000 los participantes mediante streaming en la web y 100 las empresas que participaron de la exposición, entre ellas Oracle, IBM, HP, Indra, Intel, Logicalis, SAP y Telmex. Fueron 28 los periodistas que decidieron viajar desde Buenos Aires especialmente a la provincia de San Luis para cubrir el evento. A ellos se sumaron una veintena de periodistas que trabajan para medios locales. El evento San Luis Digital es el punto de encuentro de todos los actos de la agenda digital de la provincia de San Luis. En él las empresas, los entes gubernamentales, los docentes y los niños se juntan para disfrutar de la tecnología en todas sus formas. Con el propósito de realizar una evaluación del evento, la Universidad de la Punta realizó una encuesta de satisfacción entre los asistentes. De la misma participaron 3.492 personas. Entre los datos más relevantes que arrojó el estudio se destacan que el 98% de los asistentes manifestaron que volverían el año próximo a San Luis Digital, y que el 99% de los visitantes cree que es positivo para la sociedad sanluisina realizar un evento que muestre el estado de la agenda digital provincial. PREMIOS EIKON 2010 Categoría: Eventos Caso: Pintando con tu artista Empresa: Aldeas Infantiles SOS Argentina Agencia de PR: Colombo PR Comunicación Maravillarte Gestión de Arte Daniela Rombolá Diseño Integrantes: Por Aldeas Infantiles: Mariana Mangiarotti, Asesora de Comunicación Introducción Sobre Aldeas Infantiles SOS ALDEAS INFANTILES SOS trabaja desde hace 60 años en el mundo en la promoción, protección y restitución de los derechos de niños y niñas, como una organización no gubernamental, independiente y de carácter social. Todo niño y niña tiene derecho a ser querido, protegido y respetado. Todo niño y niña tiene derecho a la educación y cuidado de la salud. Todo niño y niña tiene derecho a crecer en un entorno familiar estable para poder desarrollarse. Estos son los principios que guían la labor de la organización en 132 países y territorios en el marco de la Convención sobre los Derechos del Niño de las Naciones Unidas (CDN). Sobre Aldeas Infantiles SOS Argentina ALDEAS INFANTILES SOS Argentina desarrolla su labor en el país desde 1979, y hoy brinda apoyo a más de 2000 niños y niñas en situación de vulnerabilidad social. De ellos, 375 niños, niñas y jóvenes crecen en el programa de Acogimiento Familiar en las Aldeas Infantiles SOS en Misiones, Córdoba, Mar del Plata y Luján. La organización también desarrolla el Programa de Fortalecimiento Familiar y Desarrollo Comunitario en Mar del Plata, Luján y Rosario, desde allí trabaja con las familias y comunidades en riesgo social apoyándolas para que desarrollen su capacidad de proteger y cuidar a sus hijos, y recuperen así su rol esencial. Actualmente participan en este programa 462 niños y niñas de 0 a 6 años, y sus familias. Como la educación también es un derecho, apoya el desarrollo educativo de niños, niñas y jóvenes a través de los Colegios Hermann Gmeiner: cuenta con un jardín de infantes en Mar del Plata, y un jardín de infantes y un colegio de niveles primario y secundario en Oberá a los cuales asisten más de 1200 alumnos en el corriente año. Diagnóstico de comunicación A principios del 2009 se comenzó a desarrollar el departamento de Comunicación en la Argentina (como así también en otros países de Latinoamérica). En marzo del 2009 se presentaba la siguiente situación: ALDEAS INFANTILES SOS Argentina desarrolló su misión en el país desde 1979, recibiendo donaciones provenientes de países europeos. Aunque la organización contaba ya con un posicionamiento fuerte a nivel internacional, con predominio de acción en el continente europeo, en la Argentina no se encontraba posicionada en el público argentino. ALDEAS INFANTILES SOS Argentina cumple con todas las legislaciones nacional y provinciales. Y es referente actual en Acogimiento Familiar. Los beneficios que generan los programas de AI SOS son demostrables. Se registran algunas pocas acciones aisladas de comunicación externa, como la inauguración de la Aldea Infantil SOS Lujan. No se diseñaron planes integrales de comunicación. No se organizaron eventos de posicionamiento. En 2009, se comienza a ejecutar un plan de comunicación estratégica con el objetivo primario de instalar la marca en el mercado nacional con un programa anual de múltiples acciones a bajo costo o sin costo. Identificación de la oportunidad En ALDEAS INFANTILES SOS Argentina era necesario desarrollar más y mejores recursos para informar, sensibilizar y desatar procesos participativos. Con este propósito, incluimos en la planificación anual de Comunicación la implementación de un evento, por primera vez para la organización. En el campo de la comunicación de las organizaciones involucradas en el desarrollo de la comunidad, nos vemos convocados a diseñar mensajes sociales y formas atractivas de comunicarlos. En este caso, la visión estratégica se encomienda a la sensibilidad social. Nuestro objetivo fue generar un evento innovador y atractivo, pero que pudiera transmitir un mensaje genuino que permitiera llegar al público masivo y sensibilizarlo. Además de los objetivos de comunicación, la acción debía focalizarse en todo sentido en el cuidado y protección de los niños y niñas. Luego de analizar del comportamiento de las ONGs en el país, observamos un común denominador entre la mayoría de las grandes organizaciones: la generación de un evento similar, la tradicional ´gala a beneficio´. Nuestra propuesta debería diferenciarse de la gran cantidad de galas que cubren la agenda de eventos en el país. Detectamos una oportunidad: la generación de un evento artístico original con la participación de los niños y niñas. Para avanzar en la propuesta, primero definimos los objetivos, el mensaje y los públicos. Y así luego surgió la idea original. Los objetivos generales Posicionar a ALDEAS INFANTILES SOS Argentina como una organización sólida, seria y confiable a favor de la niñez. Desarrollar una actividad distintiva que permitiera asociarse con los valores de la organización. Desarrollar una actividad que generara acercamiento a diferentes públicos. Los objetivos de prensa Crear una acción de contenido relevante y diferenciado que se refleje en los medios a nivel nacional. Reforzar las relaciones con la prensa, ampliando las temáticas actuales de vinculación con periodistas. El mensaje general Sólo un entorno familiar de amor es el mejor lugar para que crezca cada niño y cada niña. Nuestra misión es brindarles un ambiente familiar saludable, donde puedan construir relaciones duraderas, vivir sus infancias a pleno, y apoyarlos para desarrollar su pleno potencial hacia una vida adulta independiente. El mensaje del evento Este evento es un ejemplo de las acciones que realizamos para los niños y niñas. En esta ocasión, les proporcionamos una acción cultural de calidad, incentivando sus capacidades creativas. Gracias por acompañarnos, juntos podemos hacer la diferencia. Los públicos Los públicos a alcanzar con el evento eran diversos. Por un lado, se necesitaba acercamiento a posibles Embajadores SOS argentinos. La organización no contaba con personajes aliados a la marca. En el mundo son muchos las celebridades que apoyan la misión de la ONG: Nelson Mandela, Príncipe Felipe de Asturias, Angelina Jolie & Brad Pitt, entre otros. El futbolista Javier Pupi Zanetti colaboró en el 2006, y era necesario retomar la relación. Se determinó que la prensa era el segundo público objetivo, para así llegar a la opinión pública. Y los Amigos SOS se los contó como público en tercer orden. Amigo SOS se denomina al individuo que realiza un aporte voluntario económico, de forma mensual. La organización en la Argentina contaba el 31 de octubre de 2009 con 3524 (activos e inactivos). Y luego, estaba el público interno. Ellos son parte fundamental de nuestra labor, y este evento debería ser una motivación para todos ellos. A los colaboradores, alentándolos a imaginar ideas posibles en el futuro. Y a los niños, niñas, jóvenes y madres, alentándolos a soñar y disfrutar de emociones inolvidables. Definición del evento Bajo el nombre ¨Pintando con tu artista¨, proyectamos la idea original del evento que consistía en convocar a prestigiosos artistas nacionales para pintar obras de gran formato junto a los niños y niñas de los programas en Luján (seleccionamos los programas de Lujan, siendo esta la localidad más cercana, el resto de los programas se implementan en Mar del Plata, Córdoba, Rosario y Oberá). Dichas obras firmadas por los artistas y los niños serían subastadas en un evento a beneficio. El proyecto debía respetar la norma de calidad de la organización, por lo que decidimos contratar un proveedor que cumpliera con una organización integral en forma detallista. La segunda norma consistía en ejecutarlo con un presupuesto restringido, lo que presentó la primera dificultad. La consultora de arte Maravillarte* fue el proveedor seleccionado para la organización integral, con quienes se negoció pagarles una parte del fee al contado y el resto a riesgo según los resultados de la subasta. A continuación se detallarán las negociaciones con cada una de las parte para llevar a cabo la acción planificada. Logística de la acción integral 1/ Selección de artistas La selección de los artistas tuvo un rol relevante en este proyecto. El criterio que se priorizó para su designación fue: el reconocimiento nacional, experiencia pedagógica, la capacidad de interpretar las emociones de los niños, que fueran referentes indiscutidos ante los medios de comunicación. Junto con la consultora de arte Maravillarte* definimos la cantidad de ocho artistas y convocamos a: Luis Felipe Noé, Ana Eckell, Marino Santa María, Rafael Gonzalez Moreno, Felipe Gimenez, Carolina Antoniadis, Valeria Maculán y Mireya Baglietto. Todos ellos aceptaron participar ad-­honorem. 2/ Selección del lugar del taller La idea original consistía en realizar el taller en la Aldea Infantil SOS Lujan, pero algunos de los artistas no podían trasladarse hasta dicha localidad, por lo que comenzamos la búsqueda de una locación en la Ciudad de Buenos Aires. El Gobierno de la Ciudad ofreció la Sede de la Dirección General de Museos situada en Costanera Sur, por lo que decidimos realizar el taller en los jardines del lugar. 3/ Convocatoria de niños y niñas La política de la organización está centrada en el interés superior del niño y la niña. Existía el riesgo de no lograr la convocatoria necesaria. Al ser obras de gran formato, cada artista había solicitado la cantidad de entre 8 y 10 niños y niñas por obra. Comenzamos a comunicar la acción a los directores de los dos programas en Lujan: Acogimiento Familiar y Fortalecimiento Familiar para que comenzaran a comunicarlo informalmente. A la semana, enviamos una presentación dirigida a las madres SOS y madres comunitarias para que se interiorizaran de la acción y de los artistas, y así transmitirle la importancia de este evento a los niños y niñas. Para asegurarnos la cantidad de mínima de 80 niños y niñas, convocamos a un colegio de la Ciudad de Buenos Aires, el colegio Aletheia, para que invitaran a sus alumnos a participar. Esto creo un ambiente de integración de gran importancia para el desarrollo de los niños y niñas de los programas de Aldeas Infantiles SOS. 4/ Reunión con los artistas Para lograr que ellos se incorporaran la misión de la ONG, se llevaron a cabo reuniones en los talleres de los artistas. En dichas reuniones se coordinaron las temáticas de las obras y la participación colectiva de los niños y niñas. Asimismo, se definieron las técnicas para cada obra y las necesidades para que los artistas y los niños pudieran trabajar en total comodidad y vivir una experiencia inolvidable. Esta inducción nos permitió convertirlos en referentes eficientes del proyecto. Se logró también el compromiso de los artistas para asistir a la subasta, evento al que asistiría la prensa. 5/ Taller artístico El sábado 17 de octubre de 2009, Día internacional de la erradicación de la pobreza, fue el gran día. Los niños comenzaron a llegar luego del mediodía. Asistieron 71 niños y niñas de nuestros programas en Luján (acompañados por las madres SOS y las madres comunitarias), y participaron 15 alumnos del Colegio Aletheia. Comenzaron con una serie de actividades para introducirlos al mundo de los ocho prestigiosos artistas con los que luego se reunieron mientras tomaban la merienda. Cada artista trabajó junto a 10 u 11 niños y niñas en obras con diferentes técnicas y estéticas, cada una con un atractivo particular. El taller fue coordinado por Maravillarte y el equipo de ¨Arte para Chicos¨ al mando de Vali Guidalevich. Cabe destacar, la colaboración de Fundación Pepsico y Fundación Danone donando barras de cereal y lácteos para la merienda de los niños y niñas. (O SLQWRU QHR H[SUHVLRQLVWD /XLV )HOLSH 1Rp FRPHQWy ³<R RILFLp GH GLUHFWRU GH RUTXHVWD &DGD QLxR
comenzó realizando su propia obra con tema libre sobre el bastidor, con los materiales que yo suelo utilizar: tinta china, lápiz, fibras y acrílicos de colores fluo. Luego fui marcando las pautas para armar la obra, darle continuidad a las líneas, balancear los cálidos y los frío. La obra se llama Laberinto Colorido, se ODSXVLHURQORVFKLFRV\DPLPHJXVWy´ Felipe Gimenez agregó: ¨Agradezco a Aldeas Infantiles SOS la oportunidad de haberme involucrado. Más allá de los resultados que luego se logren en la subasta, esto ya fue una jornada magnífica. ¡Esto los niños no se lo olvidan más!¨ Las ocho obras pueden verse en www.aldeasinfantiles.org. Ver anexos 1 y 2. 6/ Producción de fotos de obras Una fotógrafa especializada en temáticas de la niñez realizó la producción de fotos del taller. Y un especialista en arte, Gustavo Lowry, realizó la producción de fotos de las obras. Ambos donaron un importante porcentaje de sus honorarios. 7/ Desarrollo de piezas de comunicación Catálogo invitación | Anexo 3 Se diseño un folleto tríptico que brindó la doble función de invitación y catálogo de obras. Esta pieza sirvió de comunicación de la marca, y reunió los siguientes mensajes: -­ Carta del presidente -­ Obrad de gran formato de grandes artistas -­ Imágenes de niños -­ Agradecimientos a empresas y personas que colaboraron -­ Página web para mayor información Envío digital | Anexo 4 Se creó un flyer digital, que fue enviado en dos momentos. El primero fue enviado la semana posterior al taller como anuncio de la subasta. Luego se envió nuevamente la semana previa a la subasta como recordatorio. Estos envíos tenían por objetivo posicionar la iniciativa en la prensa y generar participantes compradores de obras. Website | Anexo 5 Para una mejor difusión y una mayor posibilidad de participación, se desarrolló un espacio en home del website (www.aldeasinfantiles.org.ar) con información y una galería de imágenes del taller artístico, las bases y condiciones de la subasta. Aviso publicitario | Anexo 6 La subasta tuvo apoyo de Fundación La Nación quien donó espacios en el diario para la publicación del aviso publicitario. Cartelería | Anexo 7 Se produjeron banners para la ambientación de la subasta, según en nuevo manual de marca implementado en 2009. Se utilizó la misma imagen de niños del catálogo. Estos banners son utilizables para todos los eventos. Video Editamos una presentación con imágenes del taller, utilizando música del grupo español ¨Delafe y las flores azules¨, que colabora con Aldeas Infantiles SOS España. 8/ Organización de la subasta Se crearon bases y condiciones que explicaban el espíritu de la subasta y las posibilidades de participación de compra. La organización de la subasta tuvo como condimento especial la negociación con empresas y colaboradores para poder llevarla a cabo con los escasos recursos económicos disponibles. Así el Hotel Sofitel Arroyo Buenos Aires donó los costos de alquiler del salón Saint Exupéry, Premium Wines donó champagne Cumbres Andinas y Swarowsky donó una joya para sortear entre los artistas y los compradores. 9/ Convocatoria para participar de la subasta Por su parte, era importante convocar a celebridades. Así, Teresa Calandra ofició de rematadora, mientras que Horacio Cabak fue el conductor, convirtiéndose así en los primeros personajes en comprometerse con la misión de Aldeas Infantiles SOS Argentina en este año. Ambos participaron ad-­honorem. Cabe destacar que Javier Pupi Zanetti había colaborado en el 2006 con la ONG. Con la misión de acercarlo nuevamente, le cursamos una invitación para recibir una placa de honor como Embajador SOS Argentina. Por otro lado, se convocó al evento a empresas, coleccionistas de arte y Amigos SOS. Dado que el evento se planificó para una cantidad restringida de invitados, se enviaron invitaciones (por correo y por mail) a quienes colaboran con una suma mayor a 200 pesos en forma mensual. 10/ Subasta Las obras fueron subastadas en un cocktail el 25 de noviembre de 2009 en el Hotel Sofitel Arroyo Buenos Aires. Teresa Calandra y Horacio Cabak condujeron el evento. Estuvieron presentes el Presidente de la ONG, miembros de la Comisión Directiva, los artistas plásticos, Amigos SOS e invitados de empresas. También la actriz Natalia Lobo y el diseñador Benito Fernández. Durante el cocktail, con música de cámara en vivo, se proyectaron tres videos: el video institucional, una presentación con resultados de gestión durante el discurso de Máximo Speroni, Presidente de Aldeas Infantiles SOS, y finalmente el video con las imágenes del taller donde se mostraban los niños y niñas felices junto a los artistas. Se entregó la placa de honor de Embajador SOS a Javier Pupi Zanetti. Estando él en Italia, acudieron a recibirla el Presidente de Fundación Pupi y la Vicepresidenta. Teresa Calandra, martillera pública, estuvo a cargo de la subasta de las obras. Luego se sorteó la joya de Swarovski entre los compradores y los artistas, que fue adjudicada a la artista Mireya Baglietto. Acudieron a la subasta periodistas y fotógrafos. Así culminó con éxito el primer evento de Aldeas Infantiles SOS Argentina, superando los objetivos de comunicación. 11/ Comunicación de la acción La campaña buscó posicionar Aldeas Infantiles en los medios masivos. Se decidió dar soporte de comunicación primordialmente a la subasta y no invitar a los medios al taller, para asegurar la intimidad e identidad de los niños y niñas y que así pudieran disfrutar de una experiencia artística única. Igualmente, se distribuyó información y fotos del taller artístico a medios del tercer sector. Una semana previa a la subasta se distribuyó el catálogo entre la prensa, acompañado por la gacetilla invitación. Asistieron periodistas y cámaras al evento. Luego se enviaron fotos del evento con una nueva gacetilla informativa. Logramos cobertura en medios que antes no habían prestado atención a la ONG, este evento significó la puerta de entrada a canales masivos de comunicación: Diario Clarín;; Diario Z;; revistas Gente, Newsweek en español y Vanidades;; Radio América;; América TV y América 24. También se publicó cobertura de la acción en diferentes medios, a continuación se detalla la cobertura periodística y el VAP correspondiente. Encontrará mayor información y el clipping de notas en el anexo 8. Paralelamente, se publicó un aviso publicitario (espacio donado) en el diario La Nación anunciando la subasta a beneficio (ver anexo 6): En el website de Aldeas Infantiles SOS Argentina se armó una página especial incluyendo información actualizada semana a semana, una galería de fotos del evento, una galería de fotos de las obras y posteriormente fotos de la subasta. Esta acción sirvió de contenido para una nota de la revista de la ONG que editamos trimestralmente (ver: http://www.aldeasinfantiles.org.ar/conozcanos/noticias/Pages/nuestra-­revista-­aldeas-­informa.aspx) 12/ Comunicación interna Concluimos la acción con la difusión en los dos públicos internos clave: casa matriz y los programas en la Argentina. A la oficina de Comunicación Internacional se les presentó el video sobre el taller, y un informe con la cobertura de prensa. Dos acciones de la región fueron seleccionadas para publicarlas en la Intranet: nuestra acción ¨Pintando con tu artista¨ y una acción de Navidad que realizó Aldeas Infantiles SOS Perú. A todos los directores de programas de todo el país se les envío la presentación para que la compartan con las madres, niños y niñas, conduciendo a los colaboradores a imaginar ideas posibles en el futuro. Conclusiones y resultados generales ¨Pintando con tu artista¨ transmitió un nuevo mensaje de integración dentro de la organización, lo que conllevó a un trabajo más integrado entre todos los colaboradores. Los niños, niñas y jóvenes fueron invitados a soñar. Los artistas y el proceso creativo les permitieron disfrutar de emociones positivas que llevarán consigo durante su crecimiento. La convocatoria al taller superó el mínimo requerido: asistieron 86 niños y niñas. Y los ocho artistas convocados asistieron con compromiso. Las obras producidas alcanzaron un nivel artístico auténtico. El proyecto fue inédito en la historia de las ONGs en la Argentina, como así también para Aldeas Infantiles SOS. Comenzamos la relación con personajes de la cultura, y personajes mediáticos argentinos quienes continúan colaborando con Aldeas Infantiles SOS, y algunos se anunciarán como los primeros Embajadores SOS en la Argentina durante el este año. Cumplimos y superamos el objetivo de comunicación, logrando menciones y apariciones de nuestra marca en medios masivos por primera vez. El Valor Publicitario logrado nos ubica por encima de cualquier acción de comunicación realizada en la ONG hasta el momento (VAP: $43.840). A través de esta acción logramos contacto y colaboración del Gobierno de la Ciudad de Buenos Aires, y sumamos empresas donantes: Pepsico, Fundación Danone, Hotel Sofitel, Swarowski y Premier Wines. La recaudación de la subasta superó la inversión realizada. Fue el primer evento que se realizó para agasajar y encontrarnos con los Amigos SOS y empresas que colaboran con la ONG. PREMIOS EIKON 2010 Categoría: Eventos (Regional) Caso: EARTH siembra el futuro Empresa: Universidad EARTH Agencia de PR: Comunicación Corporativa Ketchum Integrantes: Por Ketchum: Carmen Mayela Fallas;; Marcela Alfaro;; Olman López;; Cynthia Castillo, Ana María Álvarez y Jackeline Jiménez Introducción La Universidad EARTH es una Institución internacional privada y sin fines de lucro, fundada en 1986 por ley del Gobierno de la República de Costa Rica. Este centro académico forma profesionales en ingeniería agronómica de manera integral, con misión de liderazgo, conciencia ambiental, ética, mentalidad empresarial y compromiso con el bienestar del planeta y sus habitantes. EARTH nació hace 20 años con la visión de renovar la educación universitaria alrededor del mundo y en respuesta a este llamado, ha sido líder en la promoción de un desarrollo sostenible que permita a las comunidades del trópico húmedo mejorar su calidad de vida sin comprometer el medioambiente. El programa académico integra la sostenibilidad como un pilar fundamental para asegurar que los estudiantes tengan una visión de bienestar ambiental. De manera consistente con su filosofía, la Universidad procura que su operación sea sostenible y cuenta con un programa para uso el racional de los recursos que vela por el uso adecuado de la energía, la gestión del recurso hídrico y el manejo integrado de desechos sólidos. En el 2007 EARTH se constituyó carbono neutral y así se convirtió en el primer campus de Costa Rica neutro en emisiones de CO2. Posteriormente desarrolló un sistema de gestión para brindar consultoría a otras organizaciones en este campo. En la actualidad tiene la meta de convertirse en Institución Certificadora de Carbono Neutro. En el marco de su XX Aniversario la Universidad EARTH se planteó el reto de llevar a cabo una acción de gran visibilidad para su proyección global como una institución líder en sostenibilidad ambiental, vinculando a graduados, donantes y amigos. El proyecto se desarrolló bajo la premisa de realizar una acción concreta para mitigar el calentamiento global e inspirar al mundo a actuar a favor de la conservación y uso racional de los recursos. La iniciativa sería liderada desde el campus principal en Guácimo de Limón, Costa Rica, dada su amplia experiencia en el desarrollo y puesta en marcha de programas a favor de la sostenibilidad ambiental, en coordinación con graduados de la Institución en otros países. De esta forma, EARTH Siembra el Futuro se definió como un evento global con la meta de plantar 200.000 árboles de manera simultánea en 26 naciones donde residieran graduados de EARTH. La fecha elegida fue el 5 de junio de 2010, dentro del marco de la celebración del Día Mundial del Ambiente. Los objetivos planteados se dividieron concretamente en: Objetivo del proyecto: ‡ Sembrar 200.000 árboles de manera simultánea en 26 países. Objetivos institucionales: ‡ Incrementar la conciencia ambiental alrededor del planeta. ‡ Involucrar a nuevos y antiguos amigos personales y corporativos de EARTH al evento. Objetivos de comunicación: ‡ Incrementar la conciencia acerca del impacto que la Universidad EARTH ha tenido a través de sus graduados, en sus 20 años de historia. ‡ Generar cobertura positiva de prensa en medios nacionales e internacionales acerca de la Universidad EARTH y sus graduados. EARTH Siembra el Futuro se dirigió a dos diferentes públicos con mensajes especializados para cada uno de ellos: a. Donantes potenciales (personas, organizaciones y gobiernos): ‡ Mensajes: i. A lo largo de 20 años la Universidad EARTH ha respondido a la urgente necesidad de atender la destrucción ambiental y el cambio climático, acción en la cual los graduados han sido claves en la introducción de la sostenibilidad en sus trabajos y comunidades. ii. La Universidad EARTH es un líder global entre instituciones de educación superior por sus iniciativas ambientales, sociales y de sostenibilidad. iii. Con su apoyo el próximo 5 de junio podremos brindar un respiro al planeta sembrando árboles que mitiguen el calentamiento global. b. Ciudadanía del mundo (personas de todas las edades, géneros, niveles socioeconómicos, etc.) ‡ Mensajes: i. En el Día Mundial del Ambiente, la Universidad EARTH lo invita a apoyar y participar en la siembra simultánea de al menos 200.000 árboles en 26 naciones. ii. Juntos podemos detener el calentamiento global. Sembrar árboles es una acción concreta para mitigar las emisiones de gases de efecto invernadero. Para comunicarse de manera efectiva con cada uno de estos públicos, se seleccionaron diferentes canales de comunicación: ‡ ListaV GH FRUUHR HOHFWUyQLFR D WUDYpV GH +70/¶V GLVHxDGRV HVSHFtILFDPHQWH SDUD SURPRYHU HO
proyecto a nivel de bases de datos generadas por la Universidad. ‡ Página web: sitio en Internet diseñado especialmente para el proyecto, con actualizaciones constantes de países comprometidos, empresas participantes, árboles alcanzados y artículos sobre la iniciativa. ‡ %RVTXH9LUWXDO'HQWURGHODSiJLQD:HEVHLQWHJUyXQDDSOLFDFLyQOODPDGD³%RVTXHYLUWXDO´FRQHO
fin de integrar a la población, especialmente joven, a la iniciativa y, sobretodo, mantener un flujo constante de visitantes al sitio web del proyecto. En el primer ingreso las personas se registraban en el bosque, obteniendo de esta manera una importante base de datos, a partir de ahí iniciaba el proceso de siembra que incluía la selección del bosque y la especie a sembrar (15 especies de árboles para trópico seco y trópico húmedo, las mismas especies que se plantarían el 5 de junio en los distintos lugares, siendo este un importante componente de educación), así como el mantenimiento semanal de sus árboles (riego y fertilización), para lo cual, se enviaban recordatorios periódicos a los usuarios de tal forma que estos lograran evolucionar su especie al siguiente nivel, seis en total. Para el bosque virtual se gestionaron patrocinios que permitieran sembrar un árbol real por cada 20 árboles sembrados en el bosque virtual. Es importante destacar que las especies utilizadas para el sitio eran las reales, diferenciadas en Bosque Tropical Seco y Bosque Tropical Lluvioso). ‡ Redes sociales: utilización de Facebook, Twitter, Flickr, YouTube y Wikipedia para dar a conocer los avances y sumar seguidores a la iniciativa. ‡ 3URPRFLRQDOHVYLGHRVEURFKXUHVYRODQWHV+70/¶V\DILFKHVSDUDGLYXOJDUODLQLFLDWLYD ‡ Concursos internos: venta de árboles por parte de estudiantes y colaboradores de la Universidad, construcción de un árbol con materiales reciclados. ‡ Publicidad: publicación de una página completa en un periódico de circulación nacional (La Nación) para invitar al público a integrarse. Pauta de un comercial de 30 segundos en CNN Internacional y a través de YouTube. ‡ Relaciones con la prensa: desarrollo de una estrategia con medios de comunicación para dar a conocer la Universidad, su aniversario y su iniciativa de una siembra global. Todos los esfuerzos de comunicación estuvieron soportados por las siguientes acciones: ‡ Desarrollo de la plataforma de comunicación compuesta por mensajes clave, comunicados de prensa, sitio web y plataforma de cooperación individual y empresarial. ‡ Desarrollo de una estrategia de mercado y promoción para obtener patrocinadores globales y en Costa Rica, la cual incluyó preparación de propuestas, reuniones, negociación de términos de vinculación y promoción conjunta. ‡ Identificación clara de los públicos clave que interesaban a la Universidad capturar. ‡ Seguimiento constante a cada una de las tácticas propuestas para lograr la divulgación del proyecto y la captura de seguidores. Ejecución del plan La implementación del plan de comunicación se desarrolló de la siguiente manera: a) Visita a graduados de países involucrados: visita del rector y la coordinadora del proyecto a los graduados líderes del proyecto en los países participantes para exponerles el proyecto y definir su labor en el proceso. b) Activación de redes sociales: previo al lanzamiento de la página Web se activaron redes sociales como Facebook, Twitter, Flickr, YouTube y Wikipedia. Facebook y Twitter se implementaron con una frecuencia creciente, que iba desde 5 hasta 10 publicaciones por semana durante el primer mes, hasta 5 a 10 por día en los meses posteriores. Los temas eran variados, desde motivación a visitar el sitio web, conocer su huella de carbono en el contador que incluía la página y sembrar árboles virtuales, hasta publicación de actualizaciones, avances en la gestión de árboles, alianzas y patrocinios en los distintos países. Se creó una entrada en Wikipedia con información del evento y de la Universidad, YouTube se utilizó como canal para subir el comercial y otros videos producidos y Flickr se alimentó a partir del día del evento con fotografías de la siembra mundial. c) Lanzamiento de la página web: lanzamiento del sitio web dedicado al proyecto junto con cada una de las acciones de cooperación individual como el bosque virtual, las redes sociales y la compra de árboles reales*. d) Gira de medios de comunicación: como parte del plan de prensa se estableció una gira con medios de comunicación tanto para promover la divulgación del evento así como para que asumieran un rol de aliados. Se gestionaron reuniones del rector de EARTH, Dr. José Zaglul, con directores de medios de comunicación clave: las dos cadenas de televisión comercial (Teletica y Repretel), la periodista de radio con mayor influencia en la opinión pública (Amelia Rueda, Programa Nuestra Voz) y el principal grupo de prensa escrita del país (Grupo Nación). Con todos se logró una reunión que permitiera explicar el proyecto y se obtuvo una respuesta muy positiva: amplia cobertura en todos los medios y el voluntariado de Grupo Nación el día de la siembra. En el ámbito internacional, se aprovechó la buena relación que EARTH mantiene con CNN en español para gestionar una entrevista con Glenda Umaña, para el programa Nuestro Mundo (tras esta entrevista, se incrementó en más de mil seguidores el grupo de Facebook de EARTH Siembra el Futuro). De igual manera los graduados fueron motivados a replicar esta iniciativa en sus distintos países. e) Celebración interna del aniversario: el 26 de marzo de celebró internamente el aniversario número 20 de la Universidad, se dio a conocer el proyecto EARTH Siembra el Futuro a la comunidad inmediata y se presentó el concurso de venta de certificados (árboles) para involucrarlos. f) Búsqueda de Patrocinios y Aliados: identificación de empresas privadas con posible interés en formar parte del proyecto, elaboración y envío de propuestas de patrocinio ajustadas a las posibilidades y necesidades de cada empresa. g) Conferencias virtuales: Con el fin de motivar a los graduados, mantenerlos informados del avance y obtener retroalimentación del proyecto, se programaron varias conferencias web a través de UStream. Los encargados de interactuar con los graduados fueron el rector y preboste de EARTH, por ser ellos claves en el proceso de mantener a los graduados vinculados a la Institución. La participación siempre superó las 100 personas, a pesar de realizarse durante el día. h) Transmisión en vivo: El 5 de junio se transmitió en vivo vía UStream el evento de siembra en la sede central de la Universidad, en Guácimo de Limón, Costa Rica. * Luego del lanzamiento de la página web del proyecto, motor del proceso de divulgación, se identificó la necesidad de generar nuevas formas de atracción de visitantes a raíz de que la cantidad de visitantes, seguidores y participantes en el bosque virtual crecía lentamente. Se da un giro en la formalidad de la comunicación y se comienza a distribuir a nivel de redes de contactos la información del proyecto para generar cadenas fundamentales en círculos de amigos que contribuyeran a dar a conocer la iniciativa, a participar y unirse. Evaluación / Comprobación El proyecto se dio a conocer a través de múltiples medios, lo cual permitió que el liderazgo de EARTH, así como la conciencia ambiental generada por esta iniciativa, hicieran alcanzar las metas propuestas del proyecto. El resultado conseguido fue casi 6 veces mayor a lo proyectado, sembrando un total de 1.195.371 árboles en 31 países. Tan solo en el campus de EARTH en Guácimo y en su segundo centro académico en Liberia, Guanacaste, se sembraron 33.000 árboles y participaron más de 2.000 personas. Uno de los mayores logros mediáticos se dio a través de la alianza con CNN, desde el primer momento, EARTH Siembra el Futuro se concibió como un proyecto que requería un socio mediático. CNN se identificó como el socio ideal por su impacto y alcance como conglomerado de medios. Tras buscar la forma de llegar a casa matriz, se iniciaron conversaciones con CNN Internacional, que transmite en inglés para toda Latinoamérica, y la cadena se mostró muy interesada en el proyecto. Al final de la negociación se logró una pauta del comercial de EARTH Siembra el Futuro a una frecuencia diaria de tres, durante tres semanas (27 emisiones en total). El principal beneficio del patrocinio fue el respaldo que la imagen de CNN brindó como patrocinador global. En Costa Rica se logró la participación y presencia de la Presidenta de la República durante el evento de siembra en Guácimo, lo que aportó aún mayor cobertura mediática. A continuación un cuadro resumen con la cuantificación de los resultados: Acción Cantidad Árboles comprometidos 1.195.371 Árboles virtuales comprometidos 15.779 Países unidos 31 Empresas patrocinadoras 28 Empresas aliadas 65 Seguidores en Facebook 5.836 Seguidores en Twitter 513 Publicaciones en Costa Rica 89 ($118.784 aproximado) Publicaciones en otros países 46 ($21.910 aproximado) Número de personas incorporadas en la base de datos (para seguimiento del proyecto) 3256 La Universidad EARTH generó una modificación en la percepción de la gente al demostrar que basta con una buena intención para generar un cambio. La cantidad de personas y empresas involucradas demostraron el éxito del proyecto, el interés por contribuir a mejorar el futuro de todos y la necesidad de que este tipo de procesos sean gestados por instituciones o empresas con alta credibilidad y liderazgo. PREMIOS EIKON 2010 Categoría: Lanzamiento de Productos Caso: Lanzamiento de el lugar de las aves. El aviario más grande de Latinoamérica Empresa: Fundación Temaikèn Agencia de PR: La Comunidad Brand Connection Salem Viale Gonzalez Villanueva Integrantes: Por Fundación Temaikèn: Denise Berger;; Jefe de RRII y Comunicación;; Andrea Giudici, Jefe De Marketing;; Agustin Allocco, Analista De Prensa Y Marketing;; Felipe Vàzquez;; Diseñador. Introducción Un poco de historia Temaikèn, nace de la unión de dos vocablos tehuelches, TEM (tierra) y AIKEN (vida), y evoca el respeto por la naturaleza. Se encuentra ubicado en Escobar a 50 km de la Ciudad de Buenos Aires y fue inaugurado en Julio de 2002. Los ambientes deben transmitir el concepto amplio de biodiversidad, de manera que las especies vegetales presentes sean las adecuadas para representar el contexto en el que habita el animal, y el visitante sienta una contención visual, basada en la separación por barreras naturales. Temaikèn tiene el objetivo de contribuir a la Conservación de la Biodiversidad, y esta tarea es llevada adelante a través de la Fundación Temaikèn con diferentes proyectos vinculados con la flora y fauna autóctona cuyas poblaciones se encuentren seriamente amenazadas. (Tapires, Mariposas Autóctonas, Aguará Guazú, Ecosistema del Pino Paraná y Loro Vinoso) En julio del 2010 y tras 4 años de obra, Temaikèn inauguró en concordancia con el inicio de las vacaciones de invierno, una nueva atracción para el público: El Lugar de las Aves, un espacio de 3 hectáreas con más de 200 especies de aves provenientes de todo el mundo. 2500 aves ordenadas en 5 aviarios según su lugar de procedencia o grupo de especie (América, Oceanía, África, Eurasia). Esto permite descubrir y apreciar las características de guacamayos, flamencos, tucanes, cacatúas, aves acuáticas y casuarios, entre otras especies exóticas. El nuevo producto también cuenta con un Centro de Interpretación de última generación, convirtiendo al nuevo Lugar de las Aves de Temaikèn en el más grande de Sudamérica y el más moderno del mundo. Problemáticas Intrínseca: El público tenía a El Lugar de las Aves como algo fuera de Temaikèn, más relacionado con la heladería Munchi`s que con el Bioparque. Revertir la idea de que las aves no son populares a la hora de definir una salida o un paseo en familia. Se debía transmitir el concepto de ambientes de inmersión, en el cual los visitantes ingresan a espacios que recrean el ambiente de origen del animal y que no eran sólo espectadores, sino parte del nuevo espacio. Extrínseca: Aparición de la gripe AH1N1 y la recomendación a la comunidad de no salir, suspensión de clases y actividades recreativas. Objetivos Los objetivos de la Estrategia apuntaron a: Mantener la noticia del lanzamiento del nuevo producto por al menos 6 meses en los medios, y en consecuencia instalar el tema en el público. Lograr alto impacto en la opinión pública mediante las características diferenciales: especies exóticas, dimensiones, arquitectura, único en la región y ambientes de inmersión. Instalar en la comunidad a El Lugar de las Aves como parte de Temaikèn y no como un lugar independiente. Reforzar el posicionamiento de Temaikèn a través de esta inauguración como lugar vinculado a la conservación de especies en extinción y la importancia del medioambiente. Hacer populares a las aves, a través de sus características, colores y adaptaciones, entre otros. Incorporar en todos los mensajes un contenido educativo o de conservación, tendiente a seguir GHVDUUROODQGRHOFRQFHSWRGH³FRPXQLFDFLyQTXHHQVHxD´ Públicos Con lo antes planteado, se desarrolló una estrategia de comunicación a medida de cada uno de los públicos, generando una propuesta de comunicación y posicionamiento integral. Las campañas publicitarias se orientaron a los chicos (Target Objetivo: chicos entre 6 y 14 años, ABC1, C2 y C3 resientes en la Ciudad de Buenos Aires, Prov. de Buenos Aires y Rosario) y en un segundo nivel a los adultos (Target Amplio: padres y madres entre 30 y 55 años, ABC1, C2 y C3 residentes de la Ciudad de Buenos Aires, Prov. de Buenos Aires y Rosario, Córdoba y Paraná.) buscando asociar la marca al concepto de Bioparque. Desde Prensa la estrategia consistió en generar contenidos apuntados a la conservación y la educación centrada en: ‡ Medios de comunicación y prensa: general, especializada (mascotas, medioambiente y RSE), medios del interior, regionales, zonales y medios digitales ‡ Líderes de opinión ‡ Autoridades: locales y del sector ‡ Público general El paraguas de la estrategia fue la educación y la conservación, mientras que el camino fue la construcción GHXQFRQFHSWRHVSHFtILFR³FRPXQLFDFLyQTXHHQVHxD´ Ejecución del plan 1. Evento de Prensa y Comunicación El 8 de julio, fue la fecha elegida para comunicar en un mismo día a los principales medios la inauguración del nuevo producto de Temaikèn. Dada la aparición de la Gripe A, se realizó el evento para periodistas y sus familias. La recomendación de las autoridades sanitarias era estar en lugares abiertos;; y siendo Temaikèn un espacio al aire libre, se definió justamente posicionar al Bioparque como la mejor opción para salir en familia. Así, se invitó a periodistas de diferentes secciones y medios (medioambiente, información general, marketing, arquitectura, zonales, corresponsales, etc.) a que asistieran a la presentación de El Lugar de las Aves. Se puso a disposición transporte desde Capital Federal y se realizó un desayuno de prensa, donde el Gerente General, Damián Pellandini, realizó la bienvenida y presentación en exclusiva del Nuevo Lugar de las Aves. Luego, realizaron una recorrida por El Lugar de las Aves, con un perfil informativo y apuntando a ³PRVWUDU´ OD QRWLFLD 0LHQWUDV ORV KLMRV GH ORV SHULRGLVWDV UHDOL]DEDQ XQ UHFRUULGR SRU HO OXJDU FRQ
divulgadores educativos, quienes habían preparado una visita exclusiva por el fascinante mundo de las DYHV SDUD HVH WDUJHW /XHJR DPERV JUXSRV VH XQLHURQ HQ ³/D 1LGDGD´ SDUD DOPRU]DU \ OXHJR VHJXLU
recorriendo los aviarios según sus preferencias. Al retirarse, los periodistas se llevaron un kit de prensa con todo el material y un obsequio para los más chicos. El 9 de julio, un día después, siendo feriado y estando los medios audiovisuales más permeables a las notas de color, se convocó nuevamente a algunos móviles de noticieros y radios a hacer notas y entrevistas en un lugar al aire libre, que no representaba un riesgo con la gripe A. Así, se volvió a tener notas sobre el Lugar de las Aves. En simultáneo, se había enviado a un listado de líderes de opinión y autoridades afines, una invitación exclusiva por correo postal para disfrutar y descubrir el Lugar de las Aves. La misma estaba abierta para que vinieran con sus familias por un período de 6 meses, teniendo en cuenta que es un target que no suele querer visitas guiadas o estar en grupos. Por ello, en el ingreso al Bioparque, en el Centro de Atención al Visitante, se dejaron bolsas con información sobre este nuevo producto de Temaikèn, así como un obsequio para la familia;; para que cuando se presentaran con la invitación, se les hiciera entrega de la misma. 2. Campaña Publicitaria de Lanzamiento 3DUD HO ODQ]DPLHQWR VH SUHVHQWDURQ ORV VSRWV ³3DWR &DSXFKLQR´ \ ³7XFiQ &RP~Q´ FRQ PRWLYR GH OD
inauguración de El Lugar de las Aves. Con personajes entretenidos y un código fresco y habitual para los chicos, la estrategia junto a la agencia La Comunidad se basó en generar historias basadas en sus simpáticos nombres, buscando continuar con la comunicación pedagógica, habitual en todas las acciones que realiza el Bioparque Temaikèn. La campaña incluyó piezas de Radio, Vía Pública y un restyling de la comunicación interna. La estrategia de medios de la mano de Brand Connection, se concentró en las señales de cable infantiles. Los chicos son mucho más conscientes de la necesidad del cuidado del planeta y de los animales, por eso con estos comerciales se buscó acercar la marca a los chicos, para que conozcan a las aves y así den el primer paso para protegerlas. Temaikèn es un lugar donde no solo se pueden ver animales, sino también conocer más sobre ellos y el medio ambiente en el que viven. 3. Notas y entrevistas one to one La noticia había sido reflejada por los medios de información general, pero aún existía la oportunidad de seguir generando presencia en los medios desde: -­ Arquitectura: dada la trascendencia de la construcción y características únicas de la misma. Por ejemplo la realización de una malla para los aviarios hecha a mano para que no generara contaminación visual entre el visitante y el ave. -­ Paisajismo: para la lograr rápida estructura en el paisaje y por la necesidad de dar refugio tanto de sombra como de protección a los animales, se realizaron 110 transplantes de grandes árboles de diversas especies y 400 matas de Bambusa tuldoides. La gran mayoría de las plantas fueron producidas por el Vivero de Temaikèn, durante tres años. -­ Marketing&Publicidad: se comunicó a los medios del sector, la campaña publicitaria de Temaikèn con motivo de este nuevo producto, donde los protagonistas de las piezas eran las aves. Asimismo, se dio a conocer a los medios de marketing, material de prensa respecto al desarrollo del Estudio de Diseño Shakespeare en materia de identidad y diseño del nuevo Lugar de las Aves. -­ Medioambiente & conservación: el nuevo espacio cuenta con más de 2000 aves, donde la mayoría se encuentra en peligro de extinción. Un ejemplo, es el Loro Vinoso, de gran importancia para Temaikèn, dado que se encuentra en peligro de extinción y es uno de los proyectos de conservación, principalmente en la provincia de Misiones. -­ Turismo: este punto fue el eje para generar notas en los medios del interior y regionales como El Observador de Uruguay o La Voz del Interior de Córdoba. Así, se buscaba tener permanencia de la noticia a lo largo del tiempo y desde diferentes ángulos para llegar a todos los públicos que era uno de los objetivos del plan;; tanto desde medios diarios y semanales, como mensuales. 4. Ambient Marketing Para mantener la noticia en los medios y en la opinión pública, se realizó por iniciativa de la consultora Salem Viale, González Villanueva, una acción en vía pública el 23 de julio. Así, Bioparque Temaikèn FRQYRFDEDDWUDYpVGHQRWDV\HQWUHYLVWDVDYLYLUXQDH[SHULHQFLD~QLFD\GLVIUXWDUGHODV³DYHVTXHQXQFD
YLVWH´ HQ SOHQR PLFURFHQWUR GH OD FLXGDG 'H D KV HQ &DUORV 3HOOHJULQL \ OD $Y &RUULHQtes, se GHVDUUROOy XQD DFWLYLGDG GH ³5HDOLGDG $XPHQWDGD´ GRQGH VH UHSOLFDURQ HQ ' H[SRQHQWHV GHO QXHYR
³/XJDUGHODV$YHV´ Las personas que pasaron por ese punto neurálgico de la ciudad, pudieron disfrutar de una experiencia inédita en nuestro país: un tucán, un guacamayo y un casuario reposaban en el brazo de la gente. La ³5HDOLGDG$XPHQWDGD´IXQFLRQDDWUDYpVGHXQFyGLJRLPSUHVRTXHDOH[SRQHUORDXQDZHEFDPSHUPLWH
visualizar en el monitor de la PC un ave tridimensional. Este sistema es de alcance masivo: el código se obtenía en la web de Temaikèn y se imprimía en cualquier impresora hogareña, permitiendo que el vínculo marca-­cliente ingresara en los hogares y fuera a mediano y largo plazo. 5. Promociones Para lograr visibilidad sostenida en el tiempo, entre los meses de Julio y Diciembre, se trabajó en forma conjunta con diferentes socios estratégicos por medio de acciones promocionales, siendo la premisa, la difusión de la apertura de El Lugar de las Aves y con el objetivo final de popularizar las aves. El esquema general de promoción fue el beneficio 2x1. Con estas acciones, se ganaba espacio y cobertura en los medios, durante los períodos en los que Temaikèn no lo hacía, logrando presencia durante todo el año calendario. Además, como parte de este tipo de acciones se generaron eventos para clientes, como ser un Evento Exclusivo para clientes de Cablevisión, al que se accedía mediante la participación de un concurso en el sitio;; y otro de iguales características para los socios del Club La Nación. 6. Acciones Online Para el cierre del año, se realizó una acción online de interacción que fomentó la conciencia ambiental en XQ WRQR O~GLFR \ DWUDFWLYR HQ ZZZVDOXGRWXFDQ\SDWRRUJDU (Q HVWH PDUFR QDFLy OD FDPSDxD ³$YHV
0HQVDMHUDV´ GRQGH ORV YLVLtantes del sitio pudieron saludar a sus amigos y familiares con motivo de la llegada de fin de año por medio de un video personalizado con los personajes de Temaikèn. En la realización, se priorizó la viralización, y por eso se realizo una compra por clicks y no por impresiones. El objetivo fue que la gente entrara a la página y mandara un saludo personalizado. Para la segunda etapa de la acción, se generó una actividad interactiva donde los chicos debían contestar una trivia para conseguir un voucher de beneficio 2x1 en la compra de entradas, el cual se recibía por mail. Esta segunda etapa buscaba generar tracción al Bioparque continuando con las temáticas relacionadas con las aves, y como resultado además de la generación de una base de datos dirigida generar conversiones. 7. Actividades específicas Para los meses de verano, se generó una serie de actividades para continuar posicionando El Lugar de las Aves, a través de Vuelos en la Noche: un mágico recorrido nocturno por los cinco continentes, una cena bajo las estrellas y un maravilloso espectáculo de cierre con aves en vuelo los visitantes descubrieron las más de 2500 aves del lugar. Para comunicar esta nueva novedad del Lugar de las Aves, desde prensa se volvió a invitar a los principales y periodistas a disfrutar de un producto totalmente diferente en Buenos Aires 8. Campaña Vacaciones de Verano 2010 Como cierre de la estrategia se generó una campaña de Vía Pública para reforzar el camino que se venía trazando en el público infantil, pero esta vez apuntado al target amplio. Por medio de una estética inspirada en el lenguaje de los chicos, se invitaba a las familias a descubrir el lugar de las aves durante el período estival. Desde la creatividad se apuntó a generar piezas con los personajes de Temaikèn pero en esta oportunidad, en situaciones inspiradas en el verano, sin dejar de lado el espíritu por lo cual habían sido lanzados tendientes a difundir un contenido en la comunicación. A nivel pauta, se generaron intervenciones en séxtuples, centauros y en gigantografías con un refuerzo de las películas originales en los canales infantiles. Evaluación/pruebas Asistieron al evento de prensa del 8 de julio, más de 40 periodistas con sus hijos. En esa fecha contamos con difusión de El Lugar de las Aves por parte de los noticieros del país, con móviles en vivo. (Telefé, América, Canal 9). Se generaron en sólo 4 meses, más de 200 repercusiones en TV, gráfica, radio y online a nivel local, nacional, regional e internacional: ‡ 2388 cm2 en diarios nacionales, internacionales y locales. ‡ 10502,18 cm2 en revistas nacionales, internacionales y locales. ‡ 6565 segundos de radio a través de comentarios y entrevistas. ‡ 1978 segundos en noticieros y programas (Canal 13, TN, Telefé, Disney Channel, VetTV) El tema logró instalarse en los medios de difusión con repercusiones sostenidas en el tiempo, basadas en los contenidos adaptados para cada uno de los medios especializados, como así también Durante las vacaciones de invierno, se recibieron 100.000 visitantes pese a la cancelación de las clases, y la suspensión de las actividades con motivo de la incidencia de la Gripe AH1N1. El público infantil llegaba a Temaiken, preguntando por las aves, especialmente por el Pato Capuchino, protagonista de uno de los spot publicitarios. Se generó un efecto no previsto de viralización de los spots, ya que al subirlos a plataformas digitales los chicos los compartieron por medio de redes sociales. La actividad de Realidad Aumentada en el centro porteño, generó que más de 300 personas participaran del juego, se fotografiaran con aves en su brazo y reenviaran un mail con la foto a sus familiares. Fomentó las repercusiones en medios de tecnología y la viralización de los videos entre portales destinados a tal fin. Gracias a las promociones con terceros, se alcanzaron públicos a los cuales hubiera sido muy difícil llegar con un presupuesto acotado, y a lo largo del período, el porcentaje de penetración de promociones se encuadró dentro de un 19% del total, lo que asciende a más de 85.000 personas. Las acciones online permitieron 204.000 visitas en el sitio (172.637 usuarios únicos) con motivo del saludo de fin de año y la promoción 2x1. Esto generó que 120.000 personas se registraran en la base de datos de Temaikèn. El 15% de los vouchers online se vieron reflejados en las boleterías del Bioparque. De la encuesta de respuesta de la actividad Vuelos en la Noche, más del 86 % definieron a la misma como que experimentaron un momento excelente o muy bueno;; participaron 2000 personas en 14 funciones nocturnas. De acuerdo a la última encuesta de satisfacción de clientes (enero-­marzo 2010) sobre la experiencia en el Lugar de las Aves, más del 73% lo calificó como excelente, donde además de conocer aves de los 5 continentes, pudieron experimentar un contacto mucho más interactivo y cercano a las aves. Durante los meses que duró el plan de comunicación (julio 2009 ± febrero 2010) se recibieron 450.000 visitantes, una de las mayores pruebas se alcanzaron los objetivos, ya que de no ser por la incidencia de la Gripe AH1N1 en el plan de visitante se hubieran alcanzado los 500.000 visitantes, lo que representa un 70% del total de visitantes del ejercicio anual. PREMIOS EIKON 2010 Categoría: Lanzamiento de Productos Caso: El tiempo cuenta/ Lanzamiento de ActemRA en la Argentina Empresa: Roche Argentina Agencia de PR: Llorente y Cuenca Integrantes: Por Roche Argentina: Alejandra Loureiro;; Jessica Claros;; María Ana Luccioni. Introducción Creando la campaña Roche Argentina: innovación en salud Roche es una compañía internacional líder en el sector de la salud que trabaja para transformar positivamente la vida de los pacientes. Para lograrlo, desarrolla productos y servicios que detectan, previenen, diagnostican y tratan enfermedades como el cáncer, la diabetes, la hepatitis, el HIV, el mal de Alzheimer y otros trastornos que plantean necesidades médicas no resueltas. Emplea a más de 80.000 personas en 150 países y tiene sede central en Basilea (Suiza). Mantiene acuerdos de cooperación con diferentes socios en investigación y desarrollo, área en la cual invierte el 20 por ciento del volumen total de sus ventas. En la Argentina, donde brinda trabajo a más de 450 personas, cumple en 2010 sus 80 años. Detección temprana, beneficios posteriores La artritis reumatoidea es una de las enfermedades autoinmune más comunes y, sin embargo, menos conocidas. Una patología progresiva y crónica, que afecta a 21 millones de personas en el mundo, alterando todo el organismo y destruyendo las articulaciones del 70 por ciento de los pacientes al finalizar los primeros dos años de enfermedad. En un 50 por ciento de los casos, incluso los lleva a la discapacidad. Lo cierto es que una persona con artritis reumatoidea puede tardar horas en levantarse de la cama. La vida cotidiana se convierte en una odisea en la que acciones tan simples y habituales como abrir una canilla constituyen un obstáculo difícil de superar. Si se quiere evitar este deterioro, es crucial acceder al tratamiento en un período inicial llamado ³YHQWDQD´6LQHPEDUJRVXVVtQWRPDVFDUDFWHUtVWLFRVHOGRORU\ODLQIODPDFLyQHQODVDUWLFXODFLRQHVMXQWR
a una fuerte rigidez que se siente particularmente por las mañanas) suelen confundirse con los de la artrosis y otras patologías, y eso demora el diagnóstico y el tratamiento apropiados. Desinformados, los pacientes visitan a distintos profesionales y pierden un tiempo valioso antes de dar con el indicado: un reumatólogo, capaz de detectar la enfermedad. Intentando cambiar esta realidad QDFLy ³(OWLHPSRFXHQWD´XQDFDPSDxDSHQVDGD SDUDFUHDU YDORUHQHO
vínculo de Roche con sus principales grupos de interés. Y que tuvo por objetivos presentar el novedoso tratamiento de la compañía contra la artritis reumatoidea, ActemRA, concientizar sobre la enfermedad, atraer la atención de la opinión pública sobre la importancia de un diagnóstico temprano y acompañar a los pacientes para ayudarlos a mejorar su calidad de vida, desde el rol de referente ante la comunidad. Conocer para actuar El primer paso para avanzar en una campaña era hacer un diagnóstico que permitiera analizar el contexto en el cual se recibiría el producto. Diagnosticar el conocimiento público que existe sobre la enfermedad y también el efecto que ésta tiene en la vida cotidiana de los pacientes, a nivel físico y emocional. Para ello, Roche encargó, a comienzos de 2008, dos investigaciones de diferentes características. o Informe Discovery: realizado por Ogilvy Argentina, es un trabajo de campo de tipo cualitativo en el que investigadores especialmente entrenados convivieron con pacientes en recuperación y grabaron en video todo lo que acontecía. El estudio buscó conocer el día a día de los pacientes a través de sus experiencias personales, sus actividades cotidianas dentro y fuera del hogar, y su relación con los médicos, la familia y el contexto social. Sus hallazgos principales: la enfermedad implica un duelo, perder DO³\RVDOXGDEOH´ORTXHWLHQHXQLPSDFWRHQRUPHHQODYLGDFRWLGLDQD/RVPLHPEURVGHODIDPLOLDWLHQHQ
problemas para aceptar a la persona enferma, que se siente sola. El dolor es intenso, constante, y hace difíciles a las cosas más insignificantes. Por eso, el modo en que los médicos tratan a los pacientes es de suma importancia porque éstos necesitan sentirse comprendidos. o ,QIRUPH FXDQWLWDWLYR UHDOL]DGR SRU ,SVRV 0RUD \ $UDXMR HO HVWXGLR ³¢4Xp VDEH OD JHQWH VREUHOD
DUWULWLVUHXPDWRLGHD"´DSXQWyHYDOXDUHOFRQRFLPLHQWRS~EOLFRJHQHUDOVREUHODHQIHUPHGDG$OFDQ]yDPiV
de 1.200 mujeres y hombres en ciudades grandes, medianas y pequeñas de todo el país, y mostró que el 20 por ciento de los entrevistados confunde la artritis reumatoidea con la artrosis y que la gran mayoría desconoce que existen especialistas dedicados a tratar esta patología (médicos reumatólogos), por lo cual demora aún más en acceder al tratamiento. Tampoco saben que esta enfermedad acorta años de vida. Informar a tiempo 3DUD FRQWURODU OD HQIHUPHGDG \ UHWUDVDU HO DYDQFH GH VXV FRQVHFXHQFLDV OD FDPSDxD ³(O WLHPSR FXHQWD´
tuvo por objetivos: ‡ Informar sobre el lanzamiento de Actemra, (tocilizumab) -­el primer anticuerpo monoclonal receptor inhibidor de interleukin 6-­ que fortalece el liderazgo de Roche en la lucha contra la enfermedad. La compañía se ha abocado a investigar y desarrollar medicamentos que cubran las necesidades médicas no resueltas. La artritis reumatoidea es una de ellas. En este campo, Roche ha producido uno de los mayores descubrimientos en lo últimos tiempo: tocilizumab, un agente biológico capaz de desalentar el progreso de la enfermedad, cuyo uso fue aprobado en la Argentina a fines de 2009. ‡ Estrechar la relación de Roche con las ONG dedicadas a la AR. Estas organizaciones son referentes y difusoras de información ante los pacientes, por lo cual la compañía se esfuerza por mantener un vínculo estrecho con ellas, brindándoles información valiosa, herramientas para sobrellevar la enfermedad y apoyo a sus actividades. ‡ Concientizar a la comunidad en general sobre la enfermedad, sobre sus impactos y sobre la importancia de detectarla a tiempo y acceder a un tratamiento adecuado. De esta forma Roche demuestra su compromiso con la sociedad en la que opera, contribuyendo no sólo a la creación de valor económico sino también social. ‡ Involucrar a los colaboradores de Roche, a fin de que conozcan la importancia estratégica de la lucha contra esta enfermedad entre las líneas de investigación y desarrollo de la compañía. Y también por su rol de multiplicadores de la comunicación entre su familia y amigos. ¿Para quiénes, cómo y qué? Público, estrategia y mensajes 5RFKH HOLJLy SDUD ³(O WLHPSR FXHQWD´ XQD HVWUDWHJLD FHQWUDO FUHDU HVSDFLRV GH SDUWLFLSDFLyQ FDSDFHV GH
brindar información valiosa y de demostrar ‡ cómo la artritis reumatoidea afecta la vida de los pacientes, dada la seriedad de su impacto en la salud y calidad de vida, ‡ la importancia de ofrecer nuevas alternativas terapéuticas, eficaces y seguras, que contribuyen al progreso del tratamiento de la enfermedad, ‡ el cambio positivo en el mejoramiento gracias a un tratamiento adecuado, asociado a los beneficios terapéuticos de tocilizumab, ‡ el firme compromiso de Roche en el desarrollo de tratamientos innovadores y efectivos para la artritis reumatoidea, tanto como su apoyo a las ONG. Este mensaje adoptó diversas formas en función de cada público: ‡ pacientes y familias, ‡ médicos, ‡ ONG de pacientes, ‡ empleados de Roche, ‡ opinión pública, ‡ y los medios de comunicación (estos últimos, como target per se pero también como puente hacia otros grupos de interés) A través de actividades apoyadas por otros grupos de interés, como asociación de pacientes y líderes de opinión, Roche buscó instalar y validar sus mensajes vinculados al impacto de la AR y los progresos en su tratamiento. Desafíos contra reloj La campaña enfrentó los siguientes retos: ‡ Por la variedad de públicos, comprender las necesidades informativas de cada uno para llegar a ellos con acciones a medida. ‡ Porque la compañía quería darle una vuelta de tuerca al tradicional esquema de difusión, aplicar la creatividad para lograr espacios de participación, donde se pudiera no sólo recibir información valiosa sino también experimentar lo que viven los pacientes. ‡ Por el nivel de desconocimiento general sobre la AR, crear interés por informarse y disipar confusiones en torno a ella para garantizar que pueda ser identificada a tiempo y tratada en forma temprana. ‡ Por la dificultad de explicar tanto los mecanismos de incidencia de la enfermedad como los de acción del medicamento, construir un mensaje claro, simple y conciso sobre el progreso que significa tocilizumab. Acciones a tiempo A medida de cada público 3DUDDIURQWDUORVGHVDItRV\ORJUDUORVREMHWLYRVGHODFDPSDxD³(OWLHPSRFXHQWD´5RFKHGLVHxyDFFLRQHVD
medida de cada público, con mensajes que respondieron a sus necesidades informativas y emocionales. Durante octubre y noviembre de 2009, se desarrollaron las siguientes actividades. Para pacientes y familiares, invitados a través de 5 ONG con las que Roche formó alianza para esta campaña: ‡ Talleres sobre el manejo de la artritis reumatoidea* ‡ 7DOOHU³(VFULEtWXGtD´ Los talleres se segmentaron entre pacientes y familiares ya que, muchas veces, al entorno del enfermo le cuesta entender las dificultades que entraña la AR y no cuenta con herramientas para ayudar. Para medios de comunicación, una pieza clave en la difusión informada que llega a toda la sociedad: ‡ Taller exclusivo para periodistas* Para empleados de Roche, que son su comunidad primaria y multiplicadores de la comunicación entre sus familiares y amigos: ‡ Campaña interna del lanzamiento de ActemRA (tocilizumab) Para la comunidad médica: ‡ Presentación de ActemRa entre la comunidad médica *Los talleres tuvieron una modalidad vivencial y no sólo expositiva. Informar, acompañar, difundir Para pacientes y familiares, Roche desarrolló dos acciones de comunicación clave sobre artritis reumatoidea: ‡ Taller para pacientes y taller para familiares, ambos sobre auto-­manejo de la AR. Estos encuentros, de jornada completa, estuvieron coordinados por médicos, psicólogos, kinesiólogos y otros especialistas en el manejo del dolor pertenecientes al Instituto de Reumatología y Rehabilitación, con acreditación para el Curso de Stanford en la Argentina. A través de charlas y presentaciones, este equipo de profesionales brindó información, ejercicios prácticos y herramientas de aprendizaje a los numerosos pacientes que asistieron, para que pudieran mejorar su calidad de vida. Entre otros temas, hablaron de nutrición, actividad física y manejo del estrés (ya que un alto porcentaje de pacientes sufre de depresión debido a la incapacidad que les causa la enfermedad). Además, luego de cada exposición, motivaron a los pacientes a participar y compartir sus propias experiencias, lo que generó un clima de cordialidad y alegría altamente positivo. De ambos encuentros ±desarrollados el 6 y 7 de octubre respectivamente² participaron un total 160 miembros de organizaciones sociales vinculadas a esta enfermedad: ARSI, AMAR, ARTICULAR y APAC. ‡ Taller literarLR SDUD SDFLHQWHV \ IDPLOLDUHV ³(VFULEt WX GtD´ 5RFKH LQYLWy D SDFLHQWHV FRQ $5 D
expresarse a través de la escritura: redactando un cuento corto, una reflexión o un poema. La actividad se llevó a cabo el miércoles 18 de noviembre en el Centro Cultural Borges y tuvo una gran aceptación por parte de los asistentes, que expresaron sus vivencias a través de cuentos cortos y poesías de temática libre (según la inspiración personal de cada artista), pero también de pinturas. Los pacientes concurrieron acompañados por sus familiares y relataron su experiencia con la enfermedad en una serie de textos que formaron parte de una muestra literaria. Además, un coach motivó a los pacientes a ser los ³SURWDJRQLVWDV´GHVXVSURSLDVYLGDVLQGHSHQGLHQWHPHQWHGHODSDWRORgía. Cada una de estas actividades implicó la creación de piezas propias de comunicación. Además, durante ambos talleres, Roche se ocupó de generar una cobertura de prensa especial para concientizar sobre la enfermedad y las diversas herramientas que contribuyen a una mejora en la calidad de vida, y también para anunciar la aprobación de tocilizumab en la Argentina. De acuerdo a los informes de las ONG, como consecuencia de estas actividades creció la cantidad de pacientes que solicitaron información sobre tratamientos alternativos, actividades y ejercicios físicos. Formando para informar Otra acción clave de la campaña fue acercarse a quienes informan y contribuyen a construir opinión sobre la enfermedad. Para ello, Roche organizó talleres de capacitación para periodistas. ¿Cómo llamar la atención de la prensa? ¿Cómo contarles los últimos avances contra la AR y convertirlos en difusores? La solución creativa vino de la mano de una actividad que les permitió vivenciar cómo se siente un paciente de artritis reumatoidea. Para ello, se los invitó a pasar a un sector del salón, donde se hallaban varios elementos que recreaban la experiencia de la patología. Por ejemplo, unos guantes duros que, al ser colocados, inmovilizaban. Con estos elementos, los participantes debían desarrollar ciertas actividades, como por ejemplo tomar un objeto con la mano. Esta posibilidad de experimentar la realidad que sufren los pacientes con AR, llena de dificultades y frustraciones, les permitió comprender más en profundidad la enfermedad y la importancia de su difusión. En el media workshops, además, se entregaron materiales informativos sobre el tema, especialmente preparados para la ocasión. En total, y en menos de un mes, 21 artículos fueron publicados en diarios, revistas, radio, televisión y medios online nacionales, que alcanzaron al 41 por ciento de la población target. Facilitando la actualización médica El 5 de noviembre de 2009, Roche presentó oficialmente ActemRA ±el nuevo tratamiento alternativo para la artritis reumatoidea² a 250 reumatólogos del país. El evento, que fue organizado en Auditorium Buenos Aires, incluyó una serie de sesiones médicas conducidas por especialistas en reumatología, con el liderazgo del Dr. Mark Genovese de Stanford University, Estados Unidos. La actividad consistió en un cocktail, seguido de una cena, show y entrega de presente para los invitados. El Dr. Genovese expuso sobre la importancia de tener en la Argentina la aprobación de este medicamento, poniendo énfasis en la eficacia terapéutica de ActemRA. Se trata del primer anticuerpo monoclonal inhibidor del receptor de la interleuquina 6 (IL-­6) desarrollado para tratar la AR, por lo que constituye una nueva alternativa terapéutica para combatir esta enfermedad. Tocilizumab es así el primero de un nuevo grupo farmacológico con un mecanismo de acción diferente, que brinda nuevas esperanzas a los pacientes con AR. Concientizando puertas adentro Expectativa, juegos, información y charlas fueron parte de la estrategia de comunicación para el lanzamiento de ActemRA dentro de Roche. Durante dos semanas, a fines de octubre de 2009, los empleados experimentaron la transformación positiva que se asocia al tratamiento con tocilizumab a través de una campaña incógnita. ‡ Durante la primera semana: la sede de Roche en Pacheco amaneció cubierta con telas color gris. En el estacionamiento, se colocaron indicadores de calles con mensajes asociados a la disconformidad que genera la enfermedad ±como dolor, depresión y rigidez² mientras que en el interior del edificio se colgaron pósters con imágenes y obras de artistas que sufrieron la enfermedad. Para que los empleados pudieran sentirse parte del logro de la campaña y se comprometieran con ella, fueron invitados a participar de distintos juegos;; aquellos que ganaban, recibían un cupón equivalente a dinero en efectivo que se donaría al Hospital de Niños Dr. Elizalde (que posee una unidad para niños con artritis). Uno de los juegos más llamativos fue una gran caja que incluía dos guantes;; el participante debía agarrar con ellos desde tijeras y otros implementos hasta tickets de papel. La dificultad consistía que los guantes no eran flexibles: representaban la rigidez que causa la AR. También hubo juegos tipo Wii, con imágenes en color gris y mensajes vinculados a las sensaciones que genera la enfermedad. Concientizando puertas adentro ‡ Durante la segunda semana: Para representar el impacto positivo del cambio, el edificio se vistió de violeta y verde, los colores que identifican a ActemRA. Los juegos Wii, que antes estaban en blanco y negro, y los carteles dentro del edificio también cobraron color, mientras que los mensajes cambiaron su contenido y pasaron de la desesperación de la etapa previa a la esperanza y al nuevo producto que llega a la compañía, Actemra. Los empleados fueron invitados a un almuerzo en el que recibieron pads antiestrés y un vaso con el logo de la marca. Más tarde, participaron de una charla que comenzó con un video que resumía las actividades realizadas con los pacientes (CuUVRVGH6WDQIRUG\7DOOHU³(VFULEtWX'tD´\FRQWHVWLPRQLRVGHFyPRHOORV
vivían la enfermedad. El objetivo: mostrarle a cada uno de los colaboradores de Roche lo que siente un paciente y las acciones que la compañía realiza para brindarle una mejor calidad de vida. La reunión estuvo dictada por el Dr. Eduardo Mysler, Director de Medical Research Organization, quien habló sobre las consecuencias de la enfermedad. El Dr. Rubén Cutica ±Director del Departamento de Reumatología del Hospital Elizalde² expuso sobre el impacto de la AR en los niños y fue quien recibió, de parte del hospital, las donaciones generadas a través de los distintos juegos desarrollados la semana previa, que alcanzaron los 15.000 pesos. Finalmente, el equipo de Marketing de Roche presentó ActemRA y su plan de ventas. Resultados Una respuesta a tiempo $WUDYpVGHODFDPSDxD³(OWLHPSRFXHQWD´5RFKH$UJHQWLQDORJUyVXVREMHWLYRV ‡ El lanzamiento de ActemRA fortaleció su compromiso con el desarrollo de drogas efectivas que mejoran la calidad de vida de los pacientes que padecen artritis reumatoidea. ‡ Los pacientes identificaron los puntos clave del tratamiento con ActemRA e internalizaron los mensajes emocionales, físicos y clínicos que Roche diseñó para erradicar la desinformación, clarificar áreas de confusión y fomentar mejor calidad de vida. ‡ Los empleados reconocieron las implicancias de la enfermedad, los beneficios de ActemRA y su rol en el portfolio de Roche. ‡ La droga tuvo muy buena aceptación por parte de la comunidad médica y los empleados del laboratorio. ‡ La alta cobertura mediática incluyó los mensajes claves: la importancia de la concientización sobre la enfermedad, sus impactos en la salud y la calidad de vida de aquellos afectados, tanto como la detección temprana para un tratamiento adecuado. ‡ Roche se posicionó como líder en el mercado de las drogas vitales para enfermedades crónicas como la artritis reumatoidea, de la mano de ONG referentes y líderes de opinión que validaron su mensaje. La campaña en números ³(O WLHPSR FXHQWD´ FRQWULEX\y D SRVLFLRQDU XQ PHQVDMH D WLHPSR D IDYRU GHOD GHWHFFLyQ WHPSUDQD GHOD
artritis reumatoidea, para así asegurar un tratamiento a medida con drogas alternativas como ActemRA, lograr una mejor calidad de vida a futuro y retrasar las consecuencias negativas de la enfermedad. Y así pudo llegar a todos los públicos de la compañía: o 160 personas participaron de los talleres para pacientes y familiares. o Más de 450 empleados vivenciaron la campaña interna. o 30 periodistas asistieron a los talleres de formación para los medios. o 250 reumatólogos participaron en el evento para la comunidad médica. o 21 artículos fueron publicados en diarios, revistas, radio, televisión y medios online nacionales, en menos de un mes y alcanzaron al 41 por ciento de la población. Incluyó publicación en Diario La Prensa, Hoy (de La Plata), La Capital (de Rosario), Agencia Télam, Revista Pronto, Bureau de salud, entre otros. o En menos de 30 días, se registraron ‡ 150 visitas a la página de Internet de Roche de artritis reumatoidea (visitas de las ONG y otros, que excluyen a la comunidad médica) ‡ 10 correos electrónicos sobre cómo conseguir la nueva droga ‡ 100 llamadas recibidas relacionadas con las actividades de pacientes y otros (hechas por pacientes o miembros de la comunidad en general) PREMIOS EIKON 2010 Categoría: Lanzamiento de Productos Caso: Lanzamiento del perfume Natura Humor 5 en BAFWEEK Empresa: Natura Cosméticos Agencia de PR: Muchnik, Alurralde, Jasper & Asoc. Integrantes: Por Natura Cosméticos: Sabina Zaffora y Ana Luz Fundaró. Por Muchnik, Alurralde, Jasper & Asoc: Mariana Jasper, Mercedes Vazquez y Fabiola Flageat. Introducción ‡ Se deberá detallar brevemente la naturaleza de la compañía o institución para la que ha sido realizado el plan comunicacional. ‡ También deberá identificarse el problema (causa y consecuencia) por el cual se implementó dicho plan. ‡ Detallar los objetivos impuestos para el programa respectivo, incluyendo lapsos y/o tiempos previstos para su cumplimiento. ‡ Identificar los públicos a los que el plan apuntó y el mensaje que era necesario transmitir. ‡ Detallar cuáles fueron los canales de comunicación (internos y/o externos) utilizados. ‡ Acciones realizadas que fueron los soportes del plan comunicacional. Natura es una empresa de origen brasileño, creada en 1969 por tres emprendedores de San Pablo. Desde ese momento a la fecha, creció hasta convertirse en un sueño cumplido: ser la principal empresa latinoamericana de cosméticos, mundialmente reconocida como líder en sustentabilidad. Su modelo de negocios se basa en la venta directa y, por lo tanto, en el trabajo emprendedor de cientos de miles de personas que revenden sus productos a su red de relaciones;; Natura cuenta con alrededor de 6,2 mil colaboradores, registró en 2009 una facturación bruta de R$ 5,8 billones y un crecimiento del 19,3% en relación al año anterior. Su fuerza de venta está compuesta por más de un millón de consultoras, con 875 mil en Brasil y 160 mil en el resto de los países. Tiene operaciones en Argentina, Brasil, Perú, Chile, México, Colombia y Francia, donde cuenta con una tienda y un centro de investigación y tecnología. En Bolivia, Guatemala, Honduras y El Salvador actúa por medio de distribuidores. En nuestro país comercializa más de 450 productos desde hace más de 12 años, creciendo a un ritmo sostenible, trabajando para enriquecer su nombre, que es una referencia en el concepto de belleza natural y armonía. Con la misión de contribuir a un mundo mejor, Natura desarrolla líneas de productos basados en la biodiversidad del Amazonas. Este caso que presentamos muestra la búsqueda de una empresa por trascender su imagen, expandir, a través de un lanzamiento de producto, sus propias fronteras fuera de Brasil;; así creó Humor, una línea de perfumería que incorpora los activos de la biodiversidad de forma sustentable y basándose en su principal capital: las relaciones. Con una visión optimista del día a día de los vínculos, Natura Humor traduce este concepto en una línea diseñada para hombres y mujeres, con envases innovadores y una comunicación descontracturada, utilizando el humor como recurso: en cada packaging, los perfumes traen historietas firmadas por los caricaturistas brasileros Angeli, Caco Galhardo y Adão, quienes retratan de manera divertida situaciones de la vida cotidiana y de las relaciones en general. El estuche se transforma en una tira cómica hecha con papel de diario, mostrando así el concepto de la línea que se compone por las versiones Humor 1, 2, 3, 4 y 5. Como todos los productos de Natura, el alcohol utilizado en sus fórmulas es orgánico, producido de forma sustentable y socialmente responsable, proveniente de la caña de azúcar extraída sin quemar y cultivada sin el uso de agrotóxicos ni abonos químicos. Ejecución del plan ‡ Descripción de los pasos y procesos. ‡ Ajustes que se introdujeron durante su implementación. ‡ Dificultades encontradas y solución. Objetivos generales ‡ Aumentar y consolidar el posicionamiento de Natura cosméticos. ‡ Asociar moda y belleza al lanzamiento y a la marca. ‡ Ofrecer una experiencia al público y desarrollar un contacto directo con los interesados. ‡ Maximizar el evento como espacio de encuentro con el mundo de relaciones de Natura. Como en las últimas tres ediciones, Natura es el maquillaje oficial del BAFWEEK. En el caso de 3ULPDYHUD9HUDQR DGHPiVGH OD SUHVHQFLDGHPDUFDVH VXPyHOODQ]DPLHQWRGHOSHUIXPH³1DWXUD
+XPRU´SRUORFXDOVHJHQHUDURQGLYHUVDVDFFLRQHVSHQVDGDVSDUDGDUDFRQRFHUHVWe producto que a la YH]SXHGDFRQYLYLUFRQODOtQHDGHPDTXLOODMH³1DWXUD'LYHUVD´ El desafío consistió en transmitir la esencia de Natura en el BAFWEEK -­el evento de moda más importante de Argentina dirigido a más de 40.000 personas-­ y combinar ante un público variado (prensa, productoras, S~EOLFR JHQHUDO SURYHHGRUHV IXHU]D GH YHQWD OtGHUHV GH RSLQLyQ GLVHxDGRUHV 21*¶V HWF OD
SUHVHQWDFLyQ GH ³1DWXUD +XPRU FRQ XQ PHQVDMH FODUR TXH JHQHUDUD XQD YHUGDGHUD H[SHULHQFLD
Natura" y permitiera capitalizar este espacio de encuentro. El plan de comunicación estuvo orientado a consolidar una acción integrada que pudiera llegar a esta multiplicidad de personas, para lo cual se armó una estrategia en distintos soportes: medios gráficos, televisión e Internet, generando, además, la primera incursión de la marca en Facebook. En el espacio dentro del BAFWEEK, el stand, los gifts, el backstage y las actividades se diseñaron con la FRQVLJQDGHGHVWDFDU³ODLPSRUWDQFLDGHOKXPRUHQODVUHODFLRQHV´(QHOVWDQd se realizaron actividades de maquillaje, sampling del nuevo perfume, distribución de obsequios y organización de juegos con el público, donde se entregaba la nueva fragancia como premio. También se dispuso de un espacio con cartoons corpóreos y carteles humorísticos para que los asistentes pudieran sacarse fotos. (OMXHJRGHVDUUROODGRFRQVLVWLyHQXQ³PHGLGRUGH+XPRU´TXHHQEDVHDFLHUWRVSDUiPHWURVSHVRHGDG
estado del tiempo) junto con la presión ejercida sobre un botón, se lograba establecer el ³QLYHOGHKXPRU´
En los casos en que este nivel se mostraba bajo, recibían un perfume de regalo y para los demás había caramelos, flores o muestras de perfume. Al mismo tiempo, se realizó una campaña en Facebook que convocaba a las personas a enviar postales y mensajes. La aplicación también remitía un perfume virtual a cada integrante de una cadena de amigos, hasta que uno de ellos resultaba ganador del perfume en su versión real. La acción fue tan exitosa que contó con la participación de más de 10.847 usuarios y se entregaron 450 productos. Otra de las acciones asociadas a la estrategia consistió en la organización de un brunch para prensa, con OD SUHVHQFLD GHO JUXSR KXPRUtVWLFR ³/RV $PDGRV´ (O HYHQWR WXYR OXJDU HO GH DJRVWR \ VH FRQYRFDURQ
distintos tipos de medios (Moda & Belleza, Información General, Responsabilidad Social, periodistas del interior y del exterior) y también celebridades del mundo de la moda, editores, periodistas, productoras de moda, diseñadores y contactos estratégicos. A modo de obsequio, se entregó un bolso confeccionado por Juana de Arco, junto con un pin de Natura y una remera de diseño con estampas realizadas por Kostume, Cecilia Gadea, Mariana Dappiano, Vero Ivaldi, Cora Groppo, Marcelo Senra, Vicky Otero y Nadine Zlotogora. Estas creaciones también fueron utilizadas por el staff del stand y durante los desfiles. El lanzamiento estuvo compuesto por: 1. Invitación a los diferentes públicos a visitar el espacio de Natura Humor en BAFWEEK. 2. Brunch de lanzamiento para prenVDFRQDQLPDFLyQGHOJUXSR³/RV$PDGRV´ 3. Envío de gacetilla y fotos del producto a medios de comunicación. Gift y press kit a los periodistas claves que no pudieron asistir. 6. Entrevistas uno a uno con voceros en medios de Moda & Belleza, Información General y medios del exterior. Se desarrollaron comunicados de prensa enfocados en: ‡ Natura en BAFWEEK ± acciones en el stand ‡ Natura Humor 5 en BAFWEEK ‡ Natura Humor 5 -­ acción en Facebook Evaluación/Pruebas ‡ Identificación, análisis y cuantificación de los resultados. ‡ Beneficios producidos por la puesta en marcha del plan comunicacional (En esta parte del trabajo el participante abundará en los detalles necesarios para demostrar el éxito del programa de comunicación). Durante la acción, más de 30.000 personas pasaron por el stand durante los tres días que duró el BAFWEEK, más de 1500 personas participaron del juego del medidor de humor, se distribuyeron más de 25.000 postales con sampling de perfume Humor 5, 170 kg de caramelos con look and feel Humor 5 (aprox. 24.000 unidades), 2000 stickers con consignas de Humor 5, 100 kits de perfume como premio para el medidor de humor y 200 flores con los colores del lanzamiento. La gestión de prensa obtuvo importantes resultados: se realizaron entrevistas en medios gráficos y de televisión como FTV, Cosmo TV, ModaBit, Telefé, Mañaneras, entre otros, y el evento contó con la presencia de 140 asistentes, entre periodistas y relaciones. Medios asistentes: Luz, Para Ti, La Razón, La Nación, La Nación Revista, Oh Lalá, Clarín Mujer, Brando, Bilon, Amo la moda, Agencia Estado, Atypica, BAE, Beauty Mag, Buenas Ideas, Caras, Catalogue, Cosmopolitan, Seventeen, Elle, FTV Mag, Sophia, Menta, Mirabaires, Miradas, Modabit, Noticias, Mujer Country, Página 12, Periodismo Social, Pop Star, Reader´s Digest/ Selecciones, Revista C, Ser Padres Hoy, Viva, Rumbos, Nueva, Shop & Co, Tendencia TV, Tendencia, Tercer Sector, Wicked BA, Vanidades. Diseñadores y fotógrafos: Nadine Zlotogora, Emiliano y Camila de Kostume, Mariana Dappiano, Mariana Cortes de Juana de Arco, Cora Groppo, Marcelo Senra, Gustavo di Mario, entre otros. Se obtuvieron más de 40 repercusiones, entre las que se destacan: ‡ La Nación Revista ‡ Oh Lalá ‡ Mercado ‡ La Nación (Información General) ‡ Clarín Mujer ‡ iEco ‡ La Nación Moda & Belleza ‡ Página12 ‡ Revista Luz ‡ Revista Target ‡ Para Ti En la acción en Facebook participaron más de 10.847 usuarios y se regalaron 450 perfumes. A nivel cualitativo, se incrementó la presencia de marca dentro del BAFWEEK y, gracias a la acción dentro de Facebook, Natura logró llegar a un público más joven, que entró en contacto con la marca desde un nuevo lugar. Los objetivos fueron logrados: Natura pudo instalar su lanzamiento en los medios y transmitir los conceptos fundamentales a una diversidad de públicos. También, reforzar su posicionamiento de marca innovadora, sustentable, que celebra la diversidad y el cuidado de las relaciones en todas sus dimensiones. PREMIOS EIKON 2010 Categoría: Internet/Social Media Caso: Adopción PEDIGREE® Empresa: Mars Cono Sur Agencia de PR: Burson-­Marsteller Integrantes: Por Mars Cono Sur: Julieta Masino;; Florencia Roqueta;; Mauricio Díaz. Por Burson-­Marsteller: Cecilia Rossi;; María Isina Areco;; María Ximena Rojas Rivera. Introducción Detallar brevemente la naturaleza de la Compañía PEDIGREE® es sinónimo de alimentación para perros porque es la marca líder de alimentos para las mascotas a nivel mundial. Todos los productos PEDIGREE® son desarrollados por el Centro de Investigación WALTHAM®, organismo mundial líder en el cuidado y nutrición de mascotas. PEDIGREE® pertenece a Mars Inc., empresa familiar y privada que está presente en más de 130 países, registra más de 30 mil millones de dólares en ventas anuales, posee 151 plantas productivas, 250 oficinas comerciales y más de 70.000 asociados alrededor del mundo. En 1991, Mars llegó a la Argentina y seis años después instaló su primera planta productiva en Mercedes, provincia de Buenos Aires, para abastecer a todo el Cono Sur. Su operación en el país está segmentada en dos unidades de negocios: alimentos para mascotas (con marcas como PEDIGREE®, WHISKAS®, CHAMP® y KITEKAT®) y chocolates (SNICKERS®, M&M´S®, MILKY WAY® y TWIX®). En el país, emplea de manera directa a más de 220 personas y 110 de forma indirecta. ³,PSRVLEOHQRTXHUHUORV´HVHOVORJDQGHODPDUFD3(',*5((ŠFX\DHVHQFLDVHWUDGXFHHQ³HODPRUKDFLD
ORV SHUURV´ $GHPiV GH HODERUDU DOLPHQWRV GH EXHQD FDOLGDG 3(',*5((Š TXLHUH KDFHU GHO PXQGR XQ
mejor lugar para ellos. Es por eso que adquirió un compromiso a nivel mundial a través del Programa Adopción PEDIGREE®, cuyo principal objetivo es construir una cultura de amor y respeto hacia los animales de compañía y fomentar la adopción de perros sin hogar. b) Identificar el problema por el cual se implementó el plan -­ 8 de cada 10 perros de la Argentina jamás encontrará un hogar. -­ La principal forma de maltrato animal es el abandono, debido a la falta de educación en cuanto a la tenencia responsable de mascotas. -­ Leyes obsoletas: la ley 14.346 no considera al abandono como un delito ya que no se actualiza desde 1954. -­ Mitos acerca de cómo controlar la superpoblación canina: está comprobado mundialmente que la castración temprana, antes del 1° celo, es el único método ético. Sin embargo, algunos centros de zoonosis continúan practicando la eutanasia como método de control poblacional. -­ Rol ausente del estado: en cuanto a educación y desarrollo de políticas públicas. -­ En nuestro país existen más de 90 asociaciones protectoras sin fines de lucro dedicadas a rescatar, rehabilitar y dar en adopción a perros sin hogar. 60% de sus recursos son destinados para pagar el alimento de los animales que albergan, y a esto se le suman los gastos para los insumos veterinarios, mantenimiento y limpieza de instalaciones. -­ La mayoría de estos centros están superpoblados y en muy malas condiciones. 'HVGH3(',*5((ŠQRWDPRVTXHORVHVIXHU]RVHVWDEDQDWRPL]DGRV/DFRPXQLGDG³GRJORYHU´GXHxRVGH
perros;; los que aman a los perros, pero no tienen uno;; proteccionistas, etc) no estaba unificada. Los proteccionistas no tenían la voz ni los recursos suficientes como para dar a conocer su causa. Los amantes de los perros, no sabían donde adoptar, o vías alternativas para ayudar;; además, la situación les daba impotencia, los angustiaba, ya que sabían que era un problema que estaba fuera de su control. (Q SDUDOHOR 3(',*5((Š QHFHVLWDED UHDOL]DU XQ ³VWHS FKDQJH´ HQ OD FRQH[LyQ FRQ VXV FRQVXPLGRUHV
adueñándose del vínculo emocional, a partir de una causa genuina que le permitiera hacer tangible su HVHQFLD³(Q3(',*5((ŠDPDPRVDORVSHUURV´ c) Detallar objetivos impuestos para el programa respectivo, incluyendo lapsos y/o tiempos previstos para su cumplimiento Desde Internet, los principales objetivos fueron: -­ Unificar la comunidad dog lover, mediante una plataforma digital integrada. -­ Utilizar Internet como medio para romper con un esquema de comunicación de marca unidireccional, hacia un esquema de interacción y diálogo con nuestros consumidores. Asimismo, la estrategia digital debía contribuir a: ‡ Generar Awareness del Programa de Adopción de PEDIGREE® ‡ Instalar la problemática: invitar a la acción (call to action) y construir sentido de urgencia respecto de la problemática. ‡ Fortalecer el vínculo emocional con los consumidores. ‡ Alcanzar a un público objetivo más amplio (no solo consumidores de PEDIGREE® o de la categoría, sino a todos aquellos que comparten el mismo amor por los perros). ‡ Actuar como refuerzo del trabajo de prensa realizado con los distintos medios gráficos y audiovisuales. Cumplir con los tiempos previstos significó otro gran desafío, ya que toda la campaña de comunicación direccionaba al web site. El plan de trabajo comenzó en Octubre de 2008 y la premisa era lanzar el sitio el 19 de Marzo de 2009. No era un desarrollo simple, ya que había que implementar una galería de perros en adopción (para ello había que censar aquellos perros que eran aptos para la convivencia, pero que además estén castrados, vacunados, desparasitados, y llevar el control), además de contar con un fuerte desarrollo de backoffice y de entrenamiento para la red de refugios participantes del programa, para poder actualizar el status de los perros y recibir las postulaciones on line. Gracias a un riguroso cronograma y un coordinado trabajo en equipo entre las agencias, refugios y la Compañía, el objetivo se cumplió sin inconvenientes. d) Identificar los públicos a los que el plan apuntó y el mensaje que era necesario transmitir La plataforma digital integrada apuntó a captar a: Dueños de perros;; amantes de los perros;; SURWHFFLRQLVWDV \ 21*¶V SUHQVD GLJLWDO JHQHUDO HVSHFLDOL]DGD PDVFRWDV LQWHUpV JHQHUDO \ 56(
Comunidad en general. e) Detallar los canales de comunicación utilizados La estrategia de comunicación on line del programa de Adopción PEDIGREE® incluyó: 1) Creación de una página web que sirva de enlace entre las familias que desean adoptar y los refugios. 2) Creación de una fan page en Facebook. 3) Creación de una cuenta en youtube para viralizar la campaña de TV. 4) Prensa en medios digitales. 5) Campaña de rich media (formatos no tradicionales) en Internet. 6) Campaña de sembrado en blogs y sitios relacionados (adfunky y red de contenidos de Google) 7) Acciones de mantenimiento: Newsletters para suscriptores, blog adopción, calendario de actividades en redes sociales, etc. 8) Integración de la página de Internet con las plataformas de youtube y Facebook. Ejecución del plan a) Descripción de los pasos y procesos 1) Creación web site Se rediseñó completamente el sitio de la marca y los contenidos, en función al programa de adopción y con el objetivo de posicionar a PEDIGREE® como el referente a la hora de consultar respecto de la tenencia y cuidados de un perro. Se agregó una vidriera con más de 600 perros de refugios con su foto, características e historias para acercarles a las personas los perritos en adopción. La web además informa sobre la mecánica del programa y las diferentes vías de ayuda como así también brinda tips de tenencia responsable y consejos para aquellos hogares que incorporan perros de refugios (guía de adopción). Adicionalmente, el sitio cuenta con la sección de producto, y de cuidados para los cachorros. Al mismo, se puede ingresar vía: www.adopcionpedigree.com.ar www.pedigree.com.ar 2) Creación fan page en Facebook Con el objetivo de unificar la comunidad de dog lovers, y tener una comunicación más proactiva y participativa con los consumidores, se creó la fan page www.facebook.com/adopcionpedigreeargentina Para la misma se respetó la estética de Adopción y se volcó todo el contenido de la campaña: videos, fotos, eventos, links, url, concursos etc. La página fue promocionada viralmente por facebook, convocando a los usuarios a KDFHUVH³VHJXLGRUHV´\DUHFRPHQGDr la página a otro usuario. Cabe aclarar que la acción no contó con pauta paga. Se invitó a los visitantes a dejar comentarios, subir fotos, videos, historias etc;; generándose así una conversación interactiva. 3) Viralización de la campaña en youtube A partir de la masificación de la banda ancha, notamos que youtube había triplicado su audiencia, y que más del 40% de los internautas ingresaba al menos 1 vez al mes, en búsqueda de publicidades. Por tal motivo, se subieron todas las piezas publicitarias de la campaña. 4) Prensa digital Como complemento a la estrategia de prensa en medios audiovisuales y gráficos, se desarrolló un plan de comunicación específico para los medios digitales, mediante un sistemático envío de press releases (tanto del programa como del web site), como así también la generación de notas en blogs relacionados con la temática. 5) Campaña on line Observamos que Internet como medio arrastraba un crecimiento sostenido en los últimos años, convirtiéndose en algo popular, a partir de la masificación de la banda ancha y acceso en todos los niveles socioeconómicos a través de los locutorios y cybers. Asimismo, Internet era uno de los 3 medios con mayor penetración en el target (80%), como así también representaba una importante afinidad (120%). Por lo tanto, era un medio que no podíamos dejar de considerar. Es por ello, que definimos como estrategia escapar de los formatos de publicidad tradicionales, realizando una campaña de rich media, con el objetivo de buscar la interacción con el target y generar mayor impacto. Elegimos los portales de mayor penetración en el target: Clarín, para generar el efecto noticia y novedad;; Yahoo!, para lograr mayor cobertura y masificar el mensaje. 6) Sembrado en blogs y sitios relacionados Adicionalmente, para complementar la campaña on line, desarrollamos una acción de sembrado en blogs y sitios relacionados a través de la red de contenidos de Google y Ad Funky, con el objetivo de captar a WRGRV DTXHOORV ³GRJ ORYHUV´ TXH EXVTXHQ DOJR UHODFLRQDGR FRQ VX SDsión (temas relacionados con la campaña o con mascotas en general). 7) Acciones de mantenimiento Para darle continuidad al programa, más allá de la etapa de lanzamiento, se desarrolló: Calendario actividades en facebook con distintas propuestas y temáticas: Día del niño: se invitó a los consumidores a subir la foto de sus cachorros, y que cuenten sus travesuras. Día del amigo;; se invitó a subir la foto de su mejor amigo, y al final de la acción, se realizó un video con las fotos enviadas por los consumidores y se posteó en la fan page. Durante las fiestas y las vacaciones, semanalmente se postearon tips de tenencia responsable. Se publicaron historias de adopción del programa: testimoniales. Día del animal: por cada nuevo fan en facebook, PEDIGREE® dóno 1 ración de alimento para aquellos refugios que se encuentran en situación de riesgo (MAPA, Refugio Feliz, Una Mascota para vos) y que no forman parte del programa Adopción PEDIGREE®. Desarrollamos un blog, para que la gente que adoptó pudiera contar su experiencia. Se sistematizó el envío de newsletters, con tips de tenencia responsable, actualización de resultados del programa de adopción y novedades de la marca. 8) Integración de la página de Internet con Youtube y Facebook. Con el objetivo de tener integrada la comunidad dog lover, se invitó a los visitantes del web site, a seguir las novedades del programa en Youtube y Facebook. b) Ajustes que se introdujeron durante su implementación No existió la necesidad de introducir ajustes durante la implementación del plan. c) Dificultades encontradas y solución La principal dificultad fue la falta de recursos de los refugios y el desconocimiento del manejo de herramientas informáticas. Para ello, designamos un líder de proyecto por refugio, y se les dio un entrenamiento específico respecto del manejo del back end del web site (se les creo una cuenta de correo del programa, se les explicó la forma de recepcionar solicitudes, update de status de postulaciones, reportes hacia PEDIGREE®). Evaluación / pruebas a) Identificación, análisis y cuantificación de los resultados Resultados Web Site Más de 250 perros adoptados / Récord de visitas al web site: +309.000 visitas desde el lanzamiento del programa. Pasando de un promedio previo al lanzamiento de 1.130 visitas a un promedio de 20.650 visitas mensuales / Récord de tiempo de permanencia en el sitio: 5 min. 6 segundos / 83% de los usuarios TXHLQJUHVDQDOVLWLRVRQQXHYRV8VXDULRV~QLFRV6HFFLRQHVPiVYLVLWDGDV³)LFKDGHSHUURV´
³$FHUFDGHO3URJUDPD´³+RPH´3iJLQDVYLVWDV Resultados Fan Page en Facebook 42.236 fans / 1.510 fotos y 36 videos posteados por dog lovers / 3.967 comentarios respecto de las fotos posteadas. Resultados Youtube + de 12.000 vistas a los comerciales. Resultados prensa en medios digitales: El sitio web tuvo picos de 2.000 visitas diarias durante el evento de lanzamiento a prensa y la acción del día del animal. Adicionalmente, se lograron más de 20 repercusiones de prensa en medios digitales que representaron $11.360 en términos de valorización monetaria. Resultados campaña on line y sembrado en blogs y sitios relacionados Impresiones: 63.543.359 / Clicks: 191.905 / CTR: 0,30. La campaña obtuvo CTR elevados (0,30), siendo sorpresivo en el caso de los formatos tradicionales, ya que el mismo fue de 0,28%, cuando los niveles promedios de dichos formatos son de 0,15% o incluso menos. Los clicks pautados en blogs y sitios relacionados superaron la cantidad contratada, y a su vez se alcanzó un CTR de 0,28% con formatos tradicionales. La cobertura final que tuvo la campaña fue de 92,80%, según ComScore. Los CTR promedio que reflejó la pauta, hablan de una muy buena receptividad por parte del usuario. Esto se debe a que las piezas creativas que se desarrollaron fueron muy atractivas, más allá de haber varios formatos de alto impacto. Lo evidencia la performance de los formatos tradicionales. Resultados acciones de mantenimiento. Día del animal: el 29/04 el web site recibió un pico de 7.711 visitas. Adicionalmente, sumamos más del doble de fans en una semana, la fan page creció como nunca antes (116%), pasando de tener 16.902 fans a 36.565. Se donaron más de 6 toneladas de alimento para los refugios Una mascota para vos, MAPA y Refugio Feliz. Blog: + de 130 historias de adopción compartidas. Neswletters: Día de los enamorados: 1.371 envios / 5,18% de rebotes / Entregas efectivas: 1.300 / 4.108 aperturas / 814 clicks. Verano: 1.303 envíos / 5,30% de rebotes / 1.234 entregas / 881 aperturas / 214 clicks. Invierno: 3.388 envios / 5,28% de rebote / 3.209 entretas / 1.718 aperturas / 349 clicks. Otros: + de 90 cartas con felicitaciones espontáneas del público / + de 200 solicitudes de voluntariado / + de 70 postulaciones de refugios para formar parte del programa. PREMIOS EIKON 2010 Categoría: Internet/Social Media &DVR&DPSDxDHGXFDWLYDGHFRPXQLFDFLyQGLJLWDOHQODVUHGHVVRFLDOHV³9LYtVLQPRQy[LGR´ Empresa: Gas Natural Argentina Agencia de PR: Llorente & Cuenca Integrantes: Por Gas Natural Argentina: María Bettina Llapur, Directora de Comunicación y Relaciones Institucionales;; Fernando Ponasso, Jefe de Comunicaciones Externas;;. Por Llorente & Cuenca: Daniel Felici, Socio y Director general;; Laura La Torre, Directora de Asuntos Públicos;; Gustavo Ripoll, Gerente Regional de Comunicación Online Introducción Breve descripción de la compañía Gas Natural BAN es una de las nueve distribuidoras de gas natural por redes de la República Argentina. Fundada en diciembre de 1992, su ámbito de actuación abarca 15.000 km2 en 30 partidos del norte y oeste de la Provincia de Buenos Aires, una de las zonas más pobladas del país, con importantes parques industriales. El accionista mayoritario de la empresa es Gas Natural Fenosa, una de las compañías multinacionales líderes en el sector del gas y la electricidad, que está presente en más de 23 países y cuenta con más de 20 millones de clientes. Desde el inicio de su operación Gas Natural BAN incorporó al servicio a más de 510 mil familias. Hoy brinda el servicio a más de 1,4 millones de clientes (7 millones de personas) a través de casi 23.000 kilómetros de redes de distribución. Es la segunda distribuidora en Argentina por cantidad de clientes, con 17,2% de participación en el mercadoresidencial ± comercial. Punto de Partida Un lugar: El V Encuentro de Directores de Comunicación en Madrid, España. Una persona: Jordi García Tabarnero, Director de Comunicación y Gabinete de Presidencia de Gas Natural Fenosa. Una propuesta: ³5RPSDPRV FRQ OD FRPXQLFDFLyQ WUDGLFLRQDO H LQQRYHPRV´ 6yOR HVWDV WUHV FRVDV KLFLHURQ IDOWD SDUD TXH
Gas Natural BAN decida optimizar su tradicional campaña de comunicación de alta notoriedad pública. 6LQPiV\FRQODD\XGDGHWRGRHOHTXLSRVHFRPHQ]DURQDGHILQLUORVOLQHDPLHQWRVHVWUDWpJLFRV³'HEHPos FUHDU PHQVDMHV VLPSOHV FHUFDQRV FUHtEOHV´ SURSXVR XQ YDOLHQWH SLRQHUR³(QWRQFHV GHEHPRV EXVFDU OD
UHWURDOLPHQWDFLyQ GH QXHVWURV JUXSRV GH LQWHUpV \ UHVSRQGHU D VXV GHPDQGDV´ OR VHFXQGDURQ³(V
fundamental ser menos verdes y dar más servicios con beneILFLRVGLUHFWRVDQXHVWURVFOLHQWHV´FRQFOX\yHO
tercero.Ya todos conocían la situación actual. Un cambio de siglo representaba obligatoriamente la necesidad de innovar. Hoy en día no se puede NO comunicar y vamos a ver que este axioma comunicacional se aFHQW~DHQODHUDGLJLWDO$XQTXHODLQIRUPDFLyQSXEOLFDGDQRVHD³RILFLDO´ODVHPSUHVDV
tienen mucha presencia en las redes sociales y consecuentemente generan influencia sobre la marca. No hacía falta mencionar la creciente audiencia online. Ya estaba todo decidido. Con la primera investigación se detectó que tan sólo el 28% de todas las empresas en el mundo utilizan las redes sociales y la mayoría carece de estrategias de comunicación. Entonces ¿por qué Internet?, ¿por qué involucrarnos en las redes sociales? Lo que todos se imaginan es lo primero: los medios tradicionales de comunicación están perdiendo audiencia mientras que Internet gana cada vez más fuerza. Está certificado que el empleado promedio pasa más tiempo en Internet que frente a la suma de la TV, la Radio, los diarios, las revistas y el cine. Las redes sociales y el impacto de la Web 2.0 generan conversación, interrelación, cercanía, cultura y sentido de pertenencia. ¿Hacen falta números? Se estima que ya hay más de 1.733 millones de usuarios en todo el mundo. Que son más de 20 millones los argentinos que navegan en Internet y que la tasa de penetración de acá es del 49%. No sólo eso sino que el 61% de los usuarios entran más de una vez por día a Internet y es Facebook el medio más visitado después de Google. Uso de las redes sociales: Entonces surge una nueva pregunta: ¿Cómo no estar en Internet? Con estos fundamentos se comenzó con la organización de la primera campaña online de educación en redes sociales. Se concretó el objetivo de la campaña: durante los meses invernales, la compañía lanzaría mensajes clave que buscaran cuidar la seguridad de los clientes alertándolos sobre el correcto funcionamiento de las instalaciones. Con esto se cumplirían los dos requisitos iniciales, comenzar a difundir beneficios y hacer una campaña online promocionada principalmente por las redes sociales y como complemento los distintos medios de comunicación tradicionales. Como principal medio de difusión, Gas Natural BAN potenciaría sus mensajes clave en los canales digitales tradicionales y en las Redes Sociales, que se retroalimentarían entre sí. A raíz de un estudio de influencia de las redes sociales y reconociendo a Facebook, Twitter y YouTube como las redes de mayor alcance se realizó la página instituciRQDO³9LYtVLQ0RQy[LGR´FRQHOVRSRUWH\HOUHGLUHFFLRQDPLHQWRGHOWUiILFRGHVGH
XQD SiJLQD GH IDFHERRN ³9LYt 6LQ 0RQy[LGR´ XQ XVXDULR GH 7ZLWWHU #YLYLVLQPRQR[LGR \ XQ FDQDO GH
<RX7XEH³9LYtVLQPRQy[LGR´ Todos los perfiles mantendrían la misma identidad y nombre para darle coherencia y uniformidad. La página contaría con links a sitios de interés tales como el Sitio Corporativo de Gas Natural BAN, Defensa Civil, Policía Federal y el Ministerio de Salud, entre otros estratégicos. Objetivos generales de la campaña Con los canales definidos faltaba tan sólo delimitar los objetivos generales de la campaña: Generar conciencia en los usuarios acerca de las medidas de seguridad necesarias para reducir el riesgo de muertes por monóxido de carbono. Difundir un mensaje clave principal, desde una línea de comunicación SRVLWLYD\GHSUHYHQFLyQ³7RGRVORVDFFLGHQWHVSRUPRQy[LGRGHFDUERQRVRQHYLWDEOHV´ Utilizar los distintos canales de comunicación on line para posicionar los mensajes y complementar a las campañas de monóxido en medios tradicionales de la Argentina. Sitio Institucional: www.vivisinmonoxido.com Social Media: Facebook, Twitter y Youtube. Construir alianzas estratégicas que generen valor de marca a la compañía. Alcanzar al público joven (adolescente), para sembrar conciencia en las generaciones futuras y fomentar el cambio desde las nuevas generaciones. Posicionar a Gas Natural BAN como auspiciante/sponsor/patrocinador de la campaña, mostrando el interés FRUSRUDWLYRSRUODWHPiWLFD\GHVOLJDQGRODLQIRUPDFLyQGHOD³YR]RILFLDO´GHODHPSUHVD Se hizo hincapié en la interactividad de la campaña para generar el diálogo planteado, es por eso que se establecieron 4 líneas temáticas mensuales diferentes que se desarrollarían paralelamente en los 4 canales de comunicación online (www.vivisinmonoxido.com). Facebook, Twitter y Youtube). Cronograma Mes 1: Qué es el monóxido de carbono Mes 2: Qué no hacer para evitar accidentes Mes 3: Qué hacer como medidas de prevención de seguridad Mes 4: Cuáles son los síntomas para estar atentos y prevenidos Diseño e Identidad visual Tras planificar las etapas y definir los públicos surgió el desafío de crear una identidad visual atractiva para que se convierta en nexo entre las distintas redes sociales y el sitio. Se decidió generar la imagen en cartoon de un Gasista Matriculado, para convertirlo en el validante de las recomendaciones sobre el cuidado frente al monóxido de carbono. Dada la relación de auspicio planteada entre la compañía y el sitio, se buscó diferenciar la identidad visual de GasNatural BAN con la planteada para la campaña. Tras planificar las etapas y definir los públicos surgió el desafío de crear una identidad visual atractiva para que se convierta en nexo entre las distintas redes sociales y el sitio. Se decidió generar la imagen en cartoon de un Gasista Matriculado, para convertirlo en el validante de las recomendaciones sobre el cuidado frente al monóxido de carbono. Dada la relación de auspicio planteada entre la compañía y el sitio, se buscó diferenciar la identidad visual de Gas Natural BAN con la planteada para la campaña. Estrategia de comunicación Cada mes se desarrolla una línea temática a través de la difusión de mensajes clave, videos y la adaptación del Look & Feel de la página institucional www.vivisinmonoxido.com.ar a la temática que se está tratando. El color del diseño comienza con un tono rojo representando la llama con mala combustión y finaliza el último mes con un azul puro que representa la buena combustión del gas.Estructura y Temáticas El sitio institucional de Viví sin monóxido esta guiado por el Gasista Matriculado Mario (imagen visible de la campaña) quién es el encargado de dar Tips para Cuidarse. La web consta de 4 secciones que hacen alusión a las 4 temáticas a introducir mes a mes: 1) ¿Qué es el monóxido?, 2) Tu casa un lugar seguro, 3) Tips para cuidarte y 4) Los Síntomas. Además, hay una sección de Documentos de interés para descargar información, Links de Interés y un correo electrónico [email protected] para que los visitantes puedan realizar preguntas, las cuales serán remitidas a un especialista ambiental de la compañía para que formule las respuestas. Canales El plan en las redes sociales contempla 4 canales centrales: La táctica en los diferentes canales fue planteada luego de haber estudiado cada una de las redes sociales y de haberlas relacionado para que se redireccionen entre sí: ¿Por qué Facebook? Es la red social de mayor crecimiento en los últimos años y en la Argentina hay más 10 millones de usuarios. Se la utilizó como plataforma de lanzamiento y principal medio de comunicación. Se creó el dominio /vivisinmonóxido en el que se postean mensajes clave, videos, fotos. Además, se realiza la administración de comentarios y se recomienda el sitio central como centro de documentación, en el que se incluirá toda la información. Toda consulta es respondida por un especialista ambiental designado por la compañía para esa función. Ejecución del plan: El enfoque táctico + Puesta en marcha ¿Qué pasa con Twitter? Cuenta con más de 105 millones de usuarios en el mundo y la ventaja de la interacción constante e inmediata. A través de este canal se postean mensajes clave continuamente para informar y prevenir. El SULQFLSDO PHQVDMH TXH VH SXEOLFD HV ³WRGRV ORV DFFLGHQWHV SRU PRQy[LGR GH FDUERQR VRQ HYLWDEOHV´ (VWR
implica la repetición 4 veces por día de este claim. Para conseguir más followers se utiliza una base de datos que se desarrolló previamente a través de la clasificación mediante listas de Twitteros interesados en la temática, de periodistas, de medios y de líderes de opinión. En el caso de las consultas, se utiliza el mismo protocolo de actuación que en Facebook. ¡Qué bien se te ve Youtube! Se estima que acceden a este sitio 73 millones de personas por día, es por eso que en este canal se publicarán 5 videos que se irán subiendo en la página web progresivamente. Se relaciona directamente con la interactividad y las nuevas formas de relación de los usuarios con los medios: menos lectura y PD\RULPDJHQ7RGRVVRPRVFRQRFHGRUHVTXH³XQDLPDJHQFRPXQLFDPiVTXHFLHQSDODEUDV´ Posicionamiento en buscadores y registro de dominios El tráfico y posicionamiento SEO de la campaña se realiza a través de Google y sus herramientas para webmasters. Una vez definidos el título, las palabras clave y la descripción del sitio, luego de la medición del tráfico que genera cada término, se procede a incrementar el ranking de los canales en los buscadores, para posicionarlos dentro del Top 10. Además, con Google Analytics se analiza los datos del sitio, para conocer la procedencia del tráfico, el éxito de los contenidos y el alcance de la campaña. 6H GHFLGLy XWLOL]DU HO GRPLQLR QDFLRQDO ³FRPDU´ SDUD GDUOH LGHQWLGDG DUgentina a la campaña. De todas IRUPDVVHUHJLVWUyHOGRPLQLR³FRP´SDUDHYLWDUSRVLEOHVVXSODQWDFLRQHVGHLGHQWLGDG Puesta en Marcha de la campaña La campaña comienza con la publicación simultánea de la página web, la página de Facebook, el perfil en Twitter y el canal de Youtube. Todos los canales promueven simultáneamente los mismos mensajes claves y cuentan con el mismo diseño web. Algunos ajustes sobre la marcha A raíz de la vorágine de la difusión de la campaña y teniendo en cuenta que la época más fría en el invierno termina en Agosto se decidió realizar las 4 etapas de la campaña de manera quincenal en vez de mensual. De esta forma, se logra una mayor difusión de mensajes clave en menor tiempo, un incremento en la publicación de videos y por consecuencia mayor interacción con los seguidores e interesados. Dadas las gestiones continuas para incorporar a más validantes en la campaña, se sumaron más DXVSLFLDQWHVORVFXDOHVLUiQDJUHJiQGRVHWDQWRHQHODSDUWDGR³DXVSLFLDQWHV´FRQVXVUHVSHFWLYRVLVRlogos FRPRHQODVHFFLyQ³/LQNVGHLQWHUpV´OLVWDQGRVXVGLUHFFLRQHVZHE Por otra parte y como una manera de contabilizar los interesados en la página web www.vivisinmonoxido.com independientemente de Facebook se colocó un botón de Me Gusta en el cuadrante inferior derecho de la página web. Promoción tradicional + online + Relaciones institucionales: Medios masivos + nuevos medios + Instituciones Para llegar al público objetivo y lograr compromiso en el público interno, se lanzaron en paralelo cuatro líneas de difusión: 1) Acciones de prensa en medios tradicionales, 2) Acciones de comunicación interna, 3) La campaña online, 4) Relaciones institucionales 1) Se gestionó un desayuno con periodistas de medios gráficos, agencias, radio y TV. Se enviaron las invitaciones al evento, anunciando el lanzamiento de la campaña y proponiendo la participación en los diferentes canales online. Se desarrolló un Press kit en formato pendrive, con el logo corporativo de Gas Natural, que incluye el sitio web completo para poder navegarlo sin conexión, las imágenes utilizadas, el comunicado de prensa con el lanzamiento de la campaña, los videos del concurso sobre monóxido organizado por el ENARGAS y el INCAA y la presentación en PPT que se utilizó en el evento para explicar la estrategia. Se distribuirán comunicados de prensa posteriores al desayuno para darle mayor relevancia. Se gestionaron pautas institucionales con medios target de alcance nacional. 2) Se participó al público interno mediante el desarrollo de piezas gráficas para distribuir mediante carteleras en el edificio central y 11 sucursales, a través del mailing corporativo, en la Intranet de los países en los que opera la compañía en Latinoamérica y Europa, se agregó en la factura un insert y la dirección de la web , mostrando la identidad visual de la campaña y familiarizando a los colaboradores y usuarios de Gas Natural Ban con los soportes en los que se está desarrollando la campaña. Se desarrollaron flyers para ser repartidos en todos los eventos institucionales de la compañía y a los colaboradores para que lo difundan fuera de la empresa. Además, se pautaron avisos institucionales de media página y un cuarto de página en medios zonales de los partidos del conurbano bonaerense. 3) Se realizó publicidad en Facebook a través de 4 anuncios. Dos de ellos se plantearon a través de una HVWUDWHJLD GH ³FRVWR SRU LPSUHVLyQ´ FRQ HO REMHWLYR GH ORJUDU OD PDVLYLGDG GH OD FDPSDxD \ GDUOD D
conocer a la mayor cantidad de gente posible. Una vez conocida, se implementó la promoción mediante ³FRVWR SRU FOLFN´ SDUD ORJUDU PHQRV LPSUHVLRQHV \ XQD WDVD GH FRQYHUVLyQ PD\RU TXH LPSOLTXH XQ
incremento en el número de fans. Además, se realizó publicidad relacional a través de Google AdWords, con dos anuncios que se publicaban cuando los usuarios buscaban las palabras clave relacionadas con la campaña. Además, se pautó publicidad tradicional a través de un banner en sitios de noticias locales de las comunidades en las que opera la compañía. 4) Se realizaron gestiones institucionales para lograr el auspicio de la campaña a diferentes entidades que añaden valor a la compañía. Se están llevando a cabo encuentros formales con ellas para sumarlos a la misma y lograr la mayor difusión de la temática en sus ámbitos de actuación. Aún no se alcanzó el primer mes desde que se lanzó la campaña y rápidamente se notó la demanda de información que había sobre este tema en la sociedad. Esto fue evidenciado no sólo a raíz de la cantidad de usuarios que se obtuvieron sino a través de los comentarios realizados por los usuarios de Facebook. El perfil de Facebook cuenta con más de 11.000 fans Aproximadamente 400 fans por día genera la mayor interactuación con más de 300 comentarios semanales Hasta ahora no ha habido ningún comentario negativo sobre la campaña El perfil de Twitter consiguió más de 200 followers El perfil de Twitter fue retwitteado o mencionado más de 30 veces desde que comenzó la campaña. Los videos de YouTube recibieron más de 500 visitas El video más visto ha sido el de Cuidando a Simón. Cabe destacar que según la estrategia de la campaña estaba estipulado que éste sea el video más promocionado de la quincena, dada la dureza del contenido de las otras piezas La Página Web fue visitada más de 1400 veces El mayor redireccionamiento proviene de la página de Facebook y en segundo lugar figuran los buscadores de Google Más del 95% del tráfico es de público argentino Evaluación/ pruebas Motivo de uso de las Redes Sociales Invitación a la Presentación Viví Sin Monóxido ³/OHJDPRVDPiVGHPLOORQHVGHFOLHQWHVGHODFRPSDxtDPLOORQHVGHKDELWDQWHV´ Comunicado de Prensa Viví Sin Monóxido Distribución informativa diaria en las redes sociales. PREMIOS EIKON 2010 Categoría: Internet/Social Media Caso: Docentes Innovadores.net Empresa: Microsoft Latinoamérica Agencia de PR: Foro 21 Integrantes: Por Microsoft: Analia Satorres, Gerente de la división Alianza por la Educación Por Foro 21: o Silvio Gruber, Director;; Diego Manusovich, Director Introducción Microsoft Latinoamérica Microsoft inició operaciones en Latinoamérica y el Caribe en 1986 y ha extendido su presencia a 46 países. Desde el principio, hemos tenido el fuerte compromiso de generar oportunidades sociales y económicas en toda la región, y aquí es donde nuestros socios demuestran ser el centro de nuestro negocio. Actualmente, el ecosistema de servicios y distribución de Microsoft cuenta con 66.000 socios que emplean a más de 1,1 millones de profesionales de las Tecnologías de la Información en la región;; de hecho, más del 46% de los empleados de TI proviene del ecosistema Microsoft. En Latinoamérica y el Caribe, por cada dólar que vende Microsoft, nuestros socios generan US$ 12.-­. Esta es la comunidad que nos ayuda a hacer posible proyectos como Alianza por la Educación, un programa que desde su lanzamiento en el 2003 ha brindado capacitación en tecnología y beneficiado a más de 2 millones de docentes y 70 millones de estudiantes en 19 países en Latinoamérica y el Caribe, con una inversión de más de US$ 30 millones. Misión y Visión La misión corporativa de Microsoft es habilitar a las personas y las empresas alrededor del mundo para que puedan desarrollar su máximo potencial Microsoft quiere extender su poder digital a todas las personas porque sabe que puede ayudarlas a cambiar el curso de sus vidas. Aquí radica el poder de la tecnología y la importancia que representa contar con las habilidades para utilizarla. Un poder que todos merecen, pero al que no todos tienen acceso. En Microsoft creemos que una de nuestras contribuciones más importantes es ayudar a hacer realidad ese deseo. Por eso, Microsoft se asoció con gobiernos, comunidades, universidades y escuelas de 46 países de América Latina y el Caribe para compartir un compromiso continuo con la promoción de la inclusión digital, ayudando a ampliar el acceso a las herramientas e innovaciones tecnológicas. Con nuestros socios hemos creado y expandido diversas iniciativas para educar en informática a chicos y jóvenes, impulsar la innovación de cada comunidad y capacitar a la gente para habilitarla a acceder a empleos y hasta para ayudarla a desarrollar sus propios proyectos mediante la colaboración tecnológica. Docentes Innovadores El programa mundial Docentes Innovadores de Microsoft permite a los maestros y profesores de Latinoamérica convertirse en participantes activos en su profesión. Y de esta manera, trabajar en red dentro de una comunidad global interesada en el aprendizaje y ser reconocidos por su esfuerzo ejemplar preparando a los estudiantes para que sean ciudadanos productivos del Siglo XXI. Foro Latinoamericano de Docentes Innovadores Este evento anual nacido en 2008 reúne a docentes latinoamericanos, organizaciones no gubernamentales, socios de negocios y autoridades de los sectores público y privado para intercambiar conocimientos, compartir experiencias y mejorar las prácticas pedagógicas haciendo uso de los últimos avances tecnológicos en el área de educación. Docentes Innovadores.net FORO 21 fue elegido por Microsoft Latinoamérica para generar Docentes Innovadores.net, un Sitio Web 2.0 que apuesta fuertemente al desarrollo de una comunidad virtual para que los maestros y profesores de Latinoamérica compartan experiencias y potencien sus proyectos pedagógicos con el uso de las Tecnologías de la Información y la Comunicación (Tics). Esta plataforma potente y novedosa les ofrece a los docentes de la región un espacio compartir sus experiencias sobre el uso educativo de las nuevas tecnologías, potenciar sus proyectos pedagógicos a partir de los recursos más novedosos de la red y disfrutar de un recreo virtual a través de las secciones de Entretenimiento y Tiempo libre.El objetivo es construir la comunidad docente más potente de la región. Visión Estratégica Ser el sitio en donde los Docentes Innovadores de Latinoamérica se encuentran para compartir experiencias usando TICs y a la vez, entretenimiento, juegos y todo aquello que hace a la actividad profesional y humana de una comunidad activa. Fundamentación Partiendo de la creencia de que se aprende de y con los otros, el sitio apuesta cada día a convertirse en una verdadera comunidad de aprendizaje y en un espacio colaborativo, donde los docentes sean los verdaderos protagonistas e inspiradores de su tarea pedagógica. La profesión docente se nutre de distintas fuentes y tipos de conocimientos, de suerte que resulta importante proporcionarles recursos que potencien su tarea en tanto profesionales, pero también es sustancial ofrecerles alternativas vinculadas a lo lúdico y al entretenimiento para enriquecer su tiempo libre. Los contenidos y recursos disponibles a través del portal, involucran un amplio espectro que incluye tanto contenidos formales (vinculados a la profesión docente), como de esparcimiento (en relación al disfrute personal del profesor). Ejecución Modalidad de creación de contenidos del sitio Sección: Se seleccionan diariamente los mejores recursos disponibles en la web y se ofrecen a los docentes el link a partir del cual pueden acceder junto a una reseña sobre el contenido específico del cual se trate. Creación: Producción de nuevos contenidos propios con especial atención en formato audiovisual sobre temáticas afines a los docentes y que usualmente se encuentran en soportes gráficos. La producción de clips de imágenes son una de las herramientas más atractivas para todos los públicos. Estructura y organización de la Web Para ingresar sus experiencias y participar de los foros de discusión los docentes deben registrarse gratuitamente en la página. Pero cualquier persona, sin la necesidad de registrarse, puede acceder a leer los contenidos de la web. Secciones El sitio de DocentesInnovadores.net está divido en dos grandes áreas de contenido: Matrix Académica y Tiempo libre. Matrix Académica incluye la subsección Docentes protagonistas, adonde pueden verse las distintas experiencias subidas por los docentes. Sistematizar las propias vivencias constituye, a la vez, un ejercicio propio de consolidación de aprendizajes y un disparador de enseñanza para otros. Con la convicción de que se aprende de los demás y también con ellos, esta sección constituye un pilar fundamental de la comunidad: recopilar, documentar y difundir las iniciativas de docentes innovadores que integran las TICs a sus proyectos educativos. Para facilitar la búsqueda de experiencias educativas subidas por los propios usuarios, se las dividió por niveles educativos, áreas de conocimiento y recursos tecnológicos. 2WUD VXEVHFFLyQ HV 0LFURVRIW /LYH # (GX ³/DV KHUUDPLHQWDV GHO IXWXUR´ $TXt VH LQFOX\HQ QRWLFias sobre novedosos recursos tecnológicos que pueden implementarse en la educación o están relacionados con ella. Recursos y dispositivos es una selección de los mejores contenidos web que los docentes pueden convertir en recursos educativos para enriquecer las propuestas didácticas en el aula. En el espacio de Tutoriales se ofrecen guías detalladas con instrucciones para dominar dispositivos y aplicaciones, y desplegar así el potencial educativo de la web en el aula. Dentro del área Tiempo libre, hay distintas subsecciones que pretenden proveer recursos para los momentos de óseo de los docentes. Diviértete en la web incluye una serie de contenidos más divertidos y novedosos de Internet, para que los docentes se entretengan durante la navegación y pongan una pausa recreativa a sus tareas. Cine y libros ofrece distintos sitios web relacionados. Se incluyen bibliotecas online y sitios de críticas literarias y cinematográficas. Spa docente es un espacio dedicado a la salud de los docentes en pos de su cuidado y bienestar. La subsección Viajes y turismo incluye propuestas novedosas en Internet que ayudan a planificar y disfrutar los viajes. Otras secciones Los miembros de Docentes Innovadores pueden crear Foros de discusión para compartir opiniones y experiencias con sus colegas. Además, hay un Ranking de docentes que subieron más experiencias por semana y también de los comentarios realizados. La última experiencia subida tiene un lugar destacado en la página principal. Docentes innovadores también organiza concursos para que sus usuarios ganen notebooks, proyectores de pantalla gigante para la escuela, video cámaras para crear proyectos pedagógicos y otros premios que estimulen su conocimiento y su aprendizaje continuos. ¿Y tu qué opinas? Es un espacio de encuestas simultáneas de respuesta abierta, para generar debates en torno a preguntas que motivan el pensamiento y la reflexión. Fortalezas del portal Protagonismo Docente 2.0 Los Docentes suben sus propias experiencias utilizando TICs, publican sus propios contenidos, blogs, videos, mp3, opinan sobre temáticas diversas, responden encuestas, participan en foros, etc. Contenidos multidimensionales (docente y ser humano a la vez) Material pedagógico, vida sana, ocio, gadgets tecnológicos, sorteos y mucho más en el mismo sitio. PREMIOS EIKON 2010 Categoría: Internet/Social Media (Regional) Caso: EARTH siembra el futuro Empresa: Universidad EARTH Agencia de PR: Comunicación Corporativa Ketchum Integrantes: Por Ketchum: Carmen Mayela Fallas;; Marcela Alfaro;; Olman López;; Cynthia Castillo, Ana María Álvarez y Jackeline Jiménez Introducción La Universidad EARTH es una Institución internacional privada y sin fines de lucro, fundada en 1986 por ley del Gobierno de la República de Costa Rica. Este centro académico forma profesionales en ingeniería agronómica de manera integral, con misión de liderazgo, conciencia ambiental, ética, mentalidad empresarial y compromiso con el bienestar del planeta y sus habitantes. EARTH nació hace 20 años con la visión de renovar la educación universitaria alrededor del mundo y en respuesta a este llamado, ha sido líder en la promoción de un desarrollo sostenible que permita a las comunidades del trópico húmedo mejorar su calidad de vida sin comprometer el medioambiente. El programa académico integra la sostenibilidad como un pilar fundamental para asegurar que los estudiantes tengan una visión de bienestar ambiental. De manera consistente con su filosofía, la Universidad procura que su operación sea sostenible y cuenta con un programa para uso el racional de los recursos que vela por el uso adecuado de la energía, la gestión del recurso hídrico y el manejo integrado de desechos sólidos. En el 2007 EARTH se constituyó carbono neutral y así se convirtió en el primer campus de Costa Rica neutro en emisiones de CO2. Posteriormente desarrolló un sistema de gestión para brindar consultoría a otras organizaciones en este campo. En la actualidad tiene la meta de convertirse en Institución Certificadora de Carbono Neutro. En el marco de su XX Aniversario la Universidad EARTH se planteó el reto de llevar a cabo una acción de gran visibilidad para su proyección global como una institución líder en sostenibilidad ambiental, vinculando a graduados, donantes y amigos. El proyecto se desarrolló bajo la premisa de realizar una acción concreta para mitigar el calentamiento global e inspirar al mundo a actuar a favor de la conservación y uso racional de los recursos. La iniciativa sería liderada desde el campus principal en Guácimo de Limón, Costa Rica, dada su amplia experiencia en el desarrollo y puesta en marcha de programas a favor de la sostenibilidad ambiental, en coordinación con graduados de la Institución en otros países. De esta forma, EARTH Siembra el Futuro se definió como un evento global con la meta de plantar 200.000 árboles de manera simultánea en 26 naciones donde residieran graduados de EARTH. La fecha elegida fue el 5 de junio de 2010, dentro del marco de la celebración del Día Mundial del Ambiente. Los objetivos planteados se dividieron concretamente en: Objetivo del proyecto: ‡ Sembrar 200.000 árboles de manera simultánea en 26 países. Objetivos institucionales: ‡ Incrementar la conciencia ambiental alrededor del planeta. ‡ Involucrar a nuevos y antiguos amigos personales y corporativos de EARTH al evento. Objetivos de comunicación: ‡ Incrementar la conciencia acerca del impacto que la Universidad EARTH ha tenido a través de sus graduados, en sus 20 años de historia. ‡ Generar cobertura positiva de prensa en medios nacionales e internacionales acerca de la Universidad EARTH y sus graduados. EARTH Siembra el Futuro se dirigió a dos diferentes públicos con mensajes especializados para cada uno de ellos: a. Donantes potenciales (personas, organizaciones y gobiernos): ‡ Mensajes: i. A lo largo de 20 años la Universidad EARTH ha respondido a la urgente necesidad de atender la destrucción ambiental y el cambio climático, acción en la cual los graduados han sido claves en la introducción de la sostenibilidad en sus trabajos y comunidades. ii. La Universidad EARTH es un líder global entre instituciones de educación superior por sus iniciativas ambientales, sociales y de sostenibilidad. iii. Con su apoyo el próximo 5 de junio podremos brindar un respiro al planeta sembrando árboles que mitiguen el calentamiento global. b. Ciudadanía del mundo (personas de todas las edades, géneros, niveles socioeconómicos, etc.) ‡ Mensajes: i. En el Día Mundial del Ambiente, la Universidad EARTH lo invita a apoyar y participar en la siembra simultánea de al menos 200.000 árboles en 26 naciones. ii. Juntos podemos detener el calentamiento global. Sembrar árboles es una acción concreta para mitigar las emisiones de gases de efecto invernadero. Para comunicarse de manera efectiva con cada uno de estos públicos, se seleccionaron diferentes canales de comunicación: ‡ /LVWDV GH FRUUHR HOHFWUyQLFR D WUDYpV GH +70/¶V GLVHxDGRV HVSHFtILFDPHQWH SDUD SURPRYHU HO
proyecto a nivel de bases de datos generadas por la Universidad. ‡ Página web: sitio en Internet diseñado especialmente para el proyecto, con actualizaciones constantes de países comprometidos, empresas participantes, árboles alcanzados y artículos sobre la iniciativa. ‡ Bosque Virtual: Dentro de la página Web se integró una aplicación llamDGD³%RVTXHYLUWXDO´FRQHO
fin de integrar a la población, especialmente joven, a la iniciativa y, sobretodo, mantener un flujo constante de visitantes al sitio web del proyecto. En el primer ingreso las personas se registraban en el bosque, obteniendo de esta manera una importante base de datos, a partir de ahí iniciaba el proceso de siembra que incluía la selección del bosque y la especie a sembrar (15 especies de árboles para trópico seco y trópico húmedo, las mismas especies que se plantarían el 5 de junio en los distintos lugares, siendo este un importante componente de educación), así como el mantenimiento semanal de sus árboles (riego y fertilización), para lo cual, se enviaban recordatorios periódicos a los usuarios de tal forma que estos lograran evolucionar su especie al siguiente nivel, seis en total. Para el bosque virtual se gestionaron patrocinios que permitieran sembrar un árbol real por cada 20 árboles sembrados en el bosque virtual. Es importante destacar que las especies utilizadas para el sitio eran las reales, diferenciadas en Bosque Tropical Seco y Bosque Tropical Lluvioso). ‡ Redes sociales: utilización de Facebook, Twitter, Flickr, YouTube y Wikipedia para dar a conocer los avances y sumar seguidores a la iniciativa. ‡ Promocionales: YLGHRVEURFKXUHVYRODQWHV+70/¶V\DILFKHVSDUDGLYXOJDUODLQLFLDWLYD ‡ Concursos internos: venta de árboles por parte de estudiantes y colaboradores de la Universidad, construcción de un árbol con materiales reciclados. ‡ Publicidad: publicación de una página completa en un periódico de circulación nacional (La Nación) para invitar al público a integrarse. Pauta de un comercial de 30 segundos en CNN Internacional y a través de YouTube. ‡ Relaciones con la prensa: desarrollo de una estrategia con medios de comunicación para dar a conocer la Universidad, su aniversario y su iniciativa de una siembra global. Todos los esfuerzos de comunicación estuvieron soportados por las siguientes acciones: ‡ Desarrollo de la plataforma de comunicación compuesta por mensajes clave, comunicados de prensa, sitio web y plataforma de cooperación individual y empresarial. ‡ Desarrollo de una estrategia de mercado y promoción para obtener patrocinadores globales y en Costa Rica, la cual incluyó preparación de propuestas, reuniones, negociación de términos de vinculación y promoción conjunta. ‡ Identificación clara de los públicos clave que interesaban a la Universidad capturar. ‡ Seguimiento constante a cada una de las tácticas propuestas para lograr la divulgación del proyecto y la captura de seguidores. Ejecución del plan La implementación del plan de comunicación se desarrolló de la siguiente manera: a) Visita a graduados de países involucrados: visita del rector y la coordinadora del proyecto a los graduados líderes del proyecto en los países participantes para exponerles el proyecto y definir su labor en el proceso. b) Activación de redes sociales: previo al lanzamiento de la página Web se activaron redes sociales como Facebook, Twitter, Flickr, YouTube y Wikipedia. Facebook y Twitter se implementaron con una frecuencia creciente, que iba desde 5 hasta 10 publicaciones por semana durante el primer mes, hasta 5 a 10 por día en los meses posteriores. Los temas eran variados, desde motivación a visitar el sitio web, conocer su huella de carbono en el contador que incluía la página y sembrar árboles virtuales, hasta publicación de actualizaciones, avances en la gestión de árboles, alianzas y patrocinios en los distintos países. Se creó una entrada en Wikipedia con información del evento y de la Universidad, YouTube se utilizó como canal para subir el comercial y otros videos producidos y Flickr se alimentó a partir del día del evento con fotografías de la siembra mundial. c) Lanzamiento de la página web: lanzamiento del sitio web dedicado al proyecto junto con cada una de las acciones de cooperación individual como el bosque virtual, las redes sociales y la compra de árboles reales*. d) Gira de medios de comunicación: como parte del plan de prensa se estableció una gira con medios de comunicación tanto para promover la divulgación del evento así como para que asumieran un rol de aliados. Se gestionaron reuniones del rector de EARTH, Dr. José Zaglul, con directores de medios de comunicación clave: las dos cadenas de televisión comercial (Teletica y Repretel), la periodista de radio con mayor influencia en la opinión pública (Amelia Rueda, Programa Nuestra Voz) y el principal grupo de prensa escrita del país (Grupo Nación). Con todos se logró una reunión que permitiera explicar el proyecto y se obtuvo una respuesta muy positiva: amplia cobertura en todos los medios y el voluntariado de Grupo Nación el día de la siembra. En el ámbito internacional, se aprovechó la buena relación que EARTH mantiene con CNN en español para gestionar una entrevista con Glenda Umaña, para el programa Nuestro Mundo (tras esta entrevista, se incrementó en más de mil seguidores el grupo de Facebook de EARTH Siembra el Futuro). De igual manera los graduados fueron motivados a replicar esta iniciativa en sus distintos países. e) Celebración interna del aniversario: el 26 de marzo de celebró internamente el aniversario número 20 de la Universidad, se dio a conocer el proyecto EARTH Siembra el Futuro a la comunidad inmediata y se presentó el concurso de venta de certificados (árboles) para involucrarlos. f) Búsqueda de Patrocinios y Aliados: identificación de empresas privadas con posible interés en formar parte del proyecto, elaboración y envío de propuestas de patrocinio ajustadas a las posibilidades y necesidades de cada empresa. g) Conferencias virtuales: Con el fin de motivar a los graduados, mantenerlos informados del avance y obtener retroalimentación del proyecto, se programaron varias conferencias web a través de UStream. Los encargados de interactuar con los graduados fueron el rector y preboste de EARTH, por ser ellos claves en el proceso de mantener a los graduados vinculados a la Institución. La participación siempre superó las 100 personas, a pesar de realizarse durante el día. h) Transmisión en vivo: El 5 de junio se transmitió en vivo vía UStream el evento de siembra en la sede central de la Universidad, en Guácimo de Limón, Costa Rica. * Luego del lanzamiento de la página web del proyecto, motor del proceso de divulgación, se identificó la necesidad de generar nuevas formas de atracción de visitantes a raíz de que la cantidad de visitantes, seguidores y participantes en el bosque virtual crecía lentamente. Se da un giro en la formalidad de la comunicación y se comienza a distribuir a nivel de redes de contactos la información del proyecto para generar cadenas fundamentales en círculos de amigos que contribuyeran a dar a conocer la iniciativa, a participar y unirse. Evaluación / Comprobación El proyecto se dio a conocer a través de múltiples medios, lo cual permitió que el liderazgo de EARTH, así como la conciencia ambiental generada por esta iniciativa, hicieran alcanzar las metas propuestas del proyecto. El resultado conseguido fue casi 6 veces mayor a lo proyectado, sembrando un total de 1.195.371 árboles en 31 países. Tan solo en el campus de EARTH en Guácimo y en su segundo centro académico en Liberia, Guanacaste, se sembraron 33.000 árboles y participaron más de 2.000 personas. Uno de los mayores logros mediáticos se dio a través de la alianza con CNN, desde el primer momento, EARTH Siembra el Futuro se concibió como un proyecto que requería un socio mediático. CNN se identificó como el socio ideal por su impacto y alcance como conglomerado de medios. Tras buscar la forma de llegar a casa matriz, se iniciaron conversaciones con CNN Internacional, que transmite en inglés para toda Latinoamérica, y la cadena se mostró muy interesada en el proyecto. Al final de la negociación se logró una pauta del comercial de EARTH Siembra el Futuro a una frecuencia diaria de tres, durante tres semanas (27 emisiones en total). El principal beneficio del patrocinio fue el respaldo que la imagen de CNN brindó como patrocinador global. En Costa Rica se logró la participación y presencia de la Presidenta de la República durante el evento de siembra en Guácimo, lo que aportó aún mayor cobertura mediática. A continuación un cuadro resumen con la cuantificación de los resultados: Acción Cantidad Árboles comprometidos 1.195.371 Árboles virtuales comprometidos 15.779 Países unidos 31 Empresas patrocinadoras 28 Empresas aliadas 65 Seguidores en Facebook 5.836 Seguidores en Twitter 513 Publicaciones en Costa Rica 89 ($118.784 aproximado) Publicaciones en otros países 46 ($21.910 aproximado) Número de personas incorporadas en la base de datos (para seguimiento del proyecto) 3256 La Universidad EARTH generó una modificación en la percepción de la gente al demostrar que basta con una buena intención para generar un cambio. La cantidad de personas y empresas involucradas demostraron el éxito del proyecto, el interés por contribuir a mejorar el futuro de todos y la necesidad de que este tipo de procesos sean gestados por instituciones o empresas con alta credibilidad y liderazgo. PREMIOS EIKON 2010 Categoría: Internet/Social Media (Regional) Caso: Programa consumo inteligente Empresa: MasterCard Agencia de PR: PersonAlly Asesores en Comunicación Integrantes: MasterCard: Fernando Arango Introducción A lo largo de los años, MasterCard ha sabido caracterizarse como una compañía que ha sabido anticipar las tendencias, y de esta forma poder convertirse en un enlace económico vital entre las instituciones financieras, los negocios, los tarjetahabientes y los comerciantes de todo el mundo. En su calidad de franquiciador, procesador y asesor, MasterCard desarrolla y comercializa soluciones de pago, procesa más de 22,000 millones de pagos todos los años y provee innovadores servicios de análisis y asesoría a instituciones financieras y comerciantes. A través de su familia de marcas, entre ellas MasterCard®, Maestro® y Cirrus®, MasterCard provee servicios a consumidores y negocios en más de 210 países y territorios. Tras realizar un estudio en el ambiente económico de América Latina y el Caribe, MasterCard observó que existía un vacío apremiante en la educación financiera de la región y reconoció que los jóvenes ingresantes al mundo financiero se enfrentan a desafíos similares en cuanto a información básica en manejo de dinero, planeamiento de presupuestos y uso de tarjetas de débito o crédito para los cuales no hay suficientes herramientas disponibles simples y de fácil acceso. Reconociendo esta necesidad social, MasterCard Worldwide lanzó para la región de Latinoamérica y el Caribe un programa de educación financiera llamado Consumo Inteligente (www.consumointeligente.org). Inicialmente lanzado en México y Brasil, fue expandiendo su alcance al resto de Latinoamérica y el Caribe al tiempo que aumentó los recursos y las herramientas disponibles. Hoy, Consumo Inteligente constituye una plataforma educacional robusta que ofrece herramientas interactivas fáciles de utilizar y materiales disponibles de temas diversos de finanzas y de actualidad dirigidos al público general para permitirles a los consumidores entender los principios generales de las finanzas personales, fomentar hábitos de gastos responsables y aprender cómo manejar de la mejor forma posible las finanzas personales. Con presencia local en México, Brasil, Costa Rica, la República Dominicana, Puerto Rico y toda la región de manera regionalizada a través de sus recursos y herramientas en línea y fuera de línea, MasterCard se ha comprometido a llegar a los consumidores de todas las edades, entornos socio-­económicos y niveles de concientización financiera a través del programa Consumo Inteligente. El principal objetivo del programa es promover la educación financiera y educar a los consumidores de toda la región a través de herramientas que los ayuden a adquirir conocimientos financieros sólidos y a asumir el control de su futuro económico. El programa propone proporcionar las mejores herramientas para ayudar a los consumidores a tener un mejor manejo de su dinero, desarrollar hábitos positivos de gasto y ahorro y educarlos sobre el uso responsable de los medios de pagos electrónicos. Internet volvió a revolucionarnos con el nuevo fenómeno de Social Media y MasterCard, a la vanguardia en el uso de tecnologías de Internet y medios digitales capitalizó también en esta tendencia utilizando plataformas 2.0 y social media para llegar a través de Internet y medios sociales a cada vez más tarjetahabientes de toda latinoamericana. Para lograr su objetivo desarrolló una plataforma de tecnología con un sistema de administración que le permite la generación y fácil implementación de contenido generado tanto por MasterCard como por los usuarios;; y sobretodo, que dispone de herramientas interactivas para hacer posible un verdadero proceso de retroalimentación. La gente necesitaba herramientas, recursos y guías para controlar y administrar sus finanzas personales de manera más ordenada y MasterCard desarrolló una campaña destinada a capitalizar esa oportunidad. De esta forma, se presentaba en la región una oportunidad única tanto en el área de educación financiera como de Internet. Ejecución del Plan MasterCard apostó a una campaña digital para ayudar a los latinoamericanos a sacarle partido a su dinero a través del uso de las últimas tendencias en tecnología y social media, incluyendo un sitio 2.0, podcasts, presentaciones multimedia online y herramientas interactivas. El desafío fue el de crear una campaña que estuviera disponible las 24 horas, durante los 7 días de la semana en Inglés, Español y Portugués;; y que fuera regionalmente consistente y localmente apropiada. Pero sobretodo que le permitiera a los tarjetahabientes de la región acceder a herramientas y recursos que les provean conocimientos prácticos, útiles y sólidos para ayudarlos a administrar su dinero de forma óptima, a desarrollar hábitos positivos de gasto, ahorro y crédito;; y que los eduque sobre el uso responsable de los medios de pagos electrónicos. Para lograrlo, se desarrolló una plataforma que cuenta con múltiples herramientas interactivas y material disponible con contenido de finanzas y de actualidad dirigidos al público general. Los recursos destinados a ayudar a los consumidores a tomar el control de sus finanzas personales son los siguientes: Universidad Financiera Es un espacio en el sitio con contenido presentado en un estilo How To, de modo que el consumidor pueda fácilmente llevar a la práctica los conceptos aprendidos. El contenido se encuentra agrupado en seis módulos temáticos: haciendo un presupuesto, finanzas familiares, evite endeudarse, maneras de ahorrar, conociendo el crédito y tarjeta de débito. Herramientas Interactivas Fueron diseñadas para ayudar a los consumidores a gestionar sus decisiones de manera más conveniente y para mejorar sus conocimientos en el manejo de las finanzas personales. Algunas de ellas son: ‡3UHSDUDFLyQGHl presupuesto ‡3UXHEHVXFRQRFLPLHQWRVREUHHOFUpGLWR ‡+RMDGHWUDEDMRGHLQJUHVRV\JDVWRV ‡¢4XpWDQELHQFRQRFHVXWDUMHWDGHFUpGLWR" ‡6HxDOHVGHDGYHUWHQFLDGHHQGHXGDPLHQWR Cápsulas Educativas Animadas De acuerdo con un estudio realizado por MasterCard en la región, los consumidores prefieren aprender sobre asuntos financieros por medio de situaciones reales de una familia. Por lo tanto, se representó una familia llamada la familia Consumo Inteligente a través de caracteres virtuales. Estas cápsulas animadas consisten en una serie de módulos de video con una duración aproximada de 2 minutos y medio en donde los miembros de la familia interactúan y resuelven situaciones de la vida real asumiendo consejos prácticos sobre cómo administrar sus finanzas. En uno de los videos incluyen consejos sobre cómo realizar compras seguras por Internet y tiene como objetivo desmitificar el miedo de los consumidores frente a esta situación. Están disponibles en: http://www.youtube.com/user/consuinteligente. Mister/Miss Finanzas En varios países de la región el sitio incluye expertos financieros. Se trata de bloggeros independientes expertos en el ámbito de las finanzas personales en sus países de origen. Para lograrlo, el sitio fue diseñado con una plataforma de blog integrada, donde los Mister/Miss Finanzas pueden subir podcasts, publicar entrevistas, compartir información, consejos útiles y experiencias que han aprendido a lo largo de su vida personal y financiera. Además, para estar actualizados sobre novedades, los usuarios pueden suscribirse al contenido por RSS y escuchar los podcasts en iTunes. Los Mister/Miss Finanzas trabajan en México, Brasil, Costa Rica, la República Dominicana y Puerto Rico y cuenta con experiencia bastante diversa relacionada a las finanzas personales pero sobretodo son apasionados por el tema. También, disfrutan mucho del contacto directo con los consumidores a través de sus blogs locales y su participación en el Panel de Expertos Financieros (descrito a continuación). Ver Apéndice I para más detalles sobre los Mister/Miss Finanzas. Panel de Expertos Financieros Para aquellos países que no cuentan con un Mister o Miss Finanzas exclusivo, MasterCard incluyó un Panel Financiero Regional con expertos financieros provenientes de diferentes países de América Latina. Allí también ofrecen sus perspectivas y consejos con los consumidores de todas partes de la región, y proporcionan una experiencia educacional interactiva y sumamente valiosa. Lanzamiento de la página regional a los medios de comunicación Al momento de lanzar la plataforma, MasterCard decidió realizarlo a través de acciones de PR que incluyeran Social Media. Así, se convocó a los medios a las oficinas de MasterCard, donde se les informó del lanzamiento a través de herramientas 2.0: 1. Web Presentation Richard Hartzell, Presidente de MasterCard para América Latina y el Caribe explicó el programa. Se diseñó una presentación para lanzar la página web regional utilizando el formato de video con la tecnología Flash. 2. Social Media Outreach Se crearon perfiles sociales en Facebook, Twitter, Slideshare, Orkut, Flickr, LinkedIn y YouTube con el objetivo de llegar a mayor cantidad de usuarios y periodistas e impulsar el acceso y la conveniencia de estos sitios. 3. Media Kit Está diseñado y hosteado en Issuu.com que es otro sitio en donde se comparten documentos digitales. Allí se incluye una descripción del crecimiento, los componentes nuevos e interactivos y la visión general del programa acompañado de imágenes y viñetas diseñadas para acompañar la lectura. 4. Social Media News Release Se distribuyó un comunicado de prensa online a los periodistas de la región con contenidos de social media tales como videos y cápsulas en YouTube, hoja de datos en Issuu.com, fotografías e imágenes en Flickr, información de los perfiles sociales, etc. c) Resultados El programa Consumo Inteligente fue diseñado con una visión holística e integrada. A continuación, veremos los resultados online del mismo: El programa de conocimientos financieros de MasterCard ha crecido rápidamente desde su lanzamiento a finales del 2007. Resultados al 31 de Mayo del 2010: ‡ Se han obtenido más de 240 mil visitantes únicos ‡ El promedio de visitas mensuales sobrepasan 10 mil ‡ Con casi 780 mil páginas vistas ‡ El promedio la duración de visitas ha sido de 9 minutos Crecimiento: ‡ Hasta la conclusión del 2009 el número de páginas vistas había aumentado un 96% y un 82% en el número de visitantes únicos ‡ De Diciembre del 2009 hasta la fecha ha habido un aumento consistente en la visibilidad en redes sociales y nuevos medios: o YouTube: 2,431 views o Facebook: 423 fans o 7ZLWWHU&DQDOHVQRDFWLYRVHQ(VSDxRO³VXBGLQHUR´\HQ3RUWXJXpV³VHXBGLQHLUR´-­ se activaran en el tercer trimestre del 2010) PREMIOS EIKON 2010 Categoría: Publicidad Institucional, Campaña General Caso: Bicicleta Empresa: MasterCard Argentina. Agencia de PR: McCann Erickson Integrantes: Por MasterCard:Jorge Colombatti, Vicepresidente de Márketing de MasterCard Cono Sur. Por McCann Erickson: Santiago Van der Ghote, Director del Grupo de Cuentas de McCann Erickson Introducción Sobre MasterCard MasterCard Worldwide adelanta el comercio global al proporcionar un enlace económico vital entre las instituciones financieras, los negocios, los tarjetahabientes y los comerciantes de todo el mundo. En su calidad de franquiciador, procesador y asesor, MasterCard desarrolla y comercializa soluciones de pago, procesa más de 16.000 millones de pagos todos los años y provee innovadores servicios de análisis y asesoría a instituciones financieras y comerciantes. A través de su familia de marcas, entre ellas MasterCard®, Maestro® y Cirrus®, MasterCard Worldwide provee servicios a consumidores y negocios en más de 210 países y territorios. MasterCard hace más GH DxRV TXH YLHQH GHVDUUROODQGR HO FRQFHSWR ³3ULFHOHVV´ HQ VXV FDPSDxDV
vigente en 110 países y traducido a 51 idiomas. Las campañas Priceless tratan temas relacionados con las cosas que las personas consideran importantes como son los amigos, la verdad, la familia y todas esas cosas que el dinero no puede comprar pero hacen que la vida sea verdaderamente rica. La Campaña Familia En 2008 la marca lanzó la campaña Familia, capitalizando los diferenciales propios, sobre la plataforma Priceless. Fue una campaña 360°, con soporte en: ‡ TV: Comerciales Bicicleta (2), Promo Dia del Padre ‡ Radio: Promociones, Dia del Padre, descarga del Ringtone ‡ Aeropuertos: Accion ‡ Sponsoreo: Deportes en familia: Futbol, Polo, Rugby ‡ Internet / Movil: Ringtone Uei Paesano ‡ Gráfica: Receta, Bebe, Mellizas ‡ Comercios: Material Puntos de Venta. ¿Por qué surge la necesidad de comunicar? ‡ La marca estaba pasando por una etapa de revalorización por parte del mercado en general, de tarjetahabientes y bancos en particular. ‡ Era necesario afianzar los valores y desarrollar nuevos en relación a las oportunidades del mercado. ‡ Con la mejora de los ingresos coyuntural, creció el consumo. ‡ 'HVSXpVGHOLQGLYLGXDOLVPRFRQVXPLVPR\KHGRQLVPRGHORV¶ODIDPLOLDYROYLyDVHU³WUHQG\´ ‡ Los ejecutivos dejaron de poner todas sus prioridades en el trabajo para disponer más tiempo libre para disfrutarlo en familia. ‡ Visa y MasterCard comparten una recordación casi universal y comunican en el mismo territorio. Objetivos El REMHWLYRSULQFLSDOGHOD&DPSDxD³)DPLOLD´IXHJHQHUDUUHFRUGDFLyQGHPDUFD$ZDUHQHVVYLQFXODGDD
los momentos emocionales familiares que no tienen precio. Público Objetivo Consumidores actuales y potenciales Hombres ± mujeres de 20 a 54 años. NSE: A,B, C amplio. Estrategia La estrategia de la campaña se centró en acercar la marca a la gente de manera que sea asociada a los valores más altos y reconocida como parte de la vida de todos los días. Se hizo foco en el concepto ³)DPLOLD´ \ FRQFHQWUDU WRGRs nuestros recursos en acciones publicitarias que carguen afectivamente a la marca de valores simbólicos, utilizando fundamentalmente la TV por cable con presencia anual y generando bajadas tácticas con acciones promocionales y de patrocinio que mantengan los niveles de uso \DOPLVPRWLHPSRTXHVXPHQDOSRVLFLRQDPLHQWRVLPEyOLFRµ)DPLOLD¶ (OFRQFHSWR³)DPLOLD´HVUHOHYDQWHHQHOPHUFDGRDUJHQWLQRHVGLIHUHQFLDGRU ±ninguna tarjeta de crédito lo explota-­, es un espacio natural para MasterCard. Vamos GHO DFWXDO WHUULWRULR FRPSDUWLGR µI~WERO¶ DO
QXHYRWHUULWRULRH[FOXVLYR³)DPLOLD¶¶ El Mensaje (OPHQVDMHIXH´4XHVHUSDUWHGHXQDIDPLOLDVHDVHUSDUWHGHXQDJUDQKLVWRULDQRWLHQHSUHFLR´ El mensaje que se transmite con esta campaña utilizando un tono amigable, afectivo y familiar, es que MasterCard es una experiencia. Que a través de la marca (y sus productos), se pueden obtener beneficios tangibles y emocionales (momentos Priceless). MasterCard valora a la familia, estar rodeados de seres queridos es algo que verdaderamente no tiene precio y por tal motivo la marca quiso homenajearla en su comercial. Ejecución del Plan Evento de Lanzamiento Con motivo del lanzamiento del comercial Bicicleta, en marzo de 2008 se realizó un evento en el Museo de los Inmigrantes al que asistieron representantes de los medios más prestigiosos del periodismo publicitario, financiero y del mundo del marketing. El lugar se eligió por la historia que encierra y por la estrecha relación que tiene con todos los recuerdos a los que la publicidad refleja. El museo era antiguamente el lugar al que llegaban los inmigrantes en cuanto bajaban de los barcos hasta el puerto de Buenos Aires. Allí debían registrarse y, si lo deseaban, podían hospedarse en el lugar. El alojamiento era gratuito por cinco días, tiempo que tenían para conseguir un empleo. Todos los inmigrantes que llegaron a nuestro país, pasaron por ahí, y desde allí, comenzaron a construir su propia historia. Comercial de TV Se realizó el comercial Bicicleta, en las siguientes aplicaciones: ‡ Comercial Bicicleta, 89 segundos ‡ Reducción de 36 segundos (con agregado de tomas) ‡ Reducción de 32 segundos ‡ Adaptación a Día del Padre ‡ Adaptación para Promoción Día de la Madre En el comercial, una bicicleta actúa como hilo conductor de las diferentes épocas que se muestran. Comienza en 1930, en un pueblo de Italia, continúa con flashes de diferentes décadas del siglo XX y concluye en la actualidad en la Argentina. Durante la duración del spot, la tradicional canción italiDQD³8HL
3DHVDQR´ DFRPSDxD D HVWD ELFLFOHWD HQ VX UHFRUULGR PLHQWUDV TXH ODV LPiJHQHV UHYHODQ HO SDVR GH ORV
años a través de los paisajes, la moda y las costumbres. Sobre el final, el plano de una familia tradicional que espera que su padre llegue del trabajo montado en esta misma bicicleta produce el momento priceless del comercial, mencionando el tradicional slogan de MasterCard. (O FRPHUFLDO ³%LFLFOHWD´ IXH SURGXFLGR tQWHJUDPHQWH HQ $UJHQWLQD HQ IRUPDWR PLOtPHWURV VH XWLOL]DURQ
cuatro jornadas de filmación, un equipo de rodaje de cuarenta personas y más de ochenta extras. Cine En los cines del país pudo verse la versión completa del comercial Bicicleta. Radio Se produjeron dos radios tácticas, a saber: ‡ Radio MasterCard Familia -­ Ringtone de Bicicleta 45seg: Se invitó a descargar gratuitamente el ULQJWRQHGH%LFLFOHWD³8HL3DHVDQR´SRUVPV\SRULQWHUQHW ‡ Radio MasterCard Familia -­ Día del Padre, apoyando la comunicación en TV sobre la promoción del Día del Padre. Web Se realizó una caPSDxD GH EDQQHUV SDUD GHVFDUJDUVH HO ULQJWRQH GH %LFLFOHWD ³8HL 3DHVDQR´ D ORV
celulares. Mobile Se desarrollo una acción para bajar el tema del comercial a los celulares. Con este fin se hizo una campaña de radio que direccionaba a los interesados al Site de MasterCard o a enviar un SMS. Los resultados fueron muy buenos, en tres semanas se realizaron 9.173 descargas. El interés de la gente dio muestras del alcance y la penetración del TVC Bicicleta en el target. Gráfica La campaña de gráfica de Familia tuvo en cuenta los pequeños momentos de la vida diaria en familia, que KDFHQTXHVHUSDUWHGHXQDIDPLOLDQRWHQJDSUHFLR/DVSLH]DVIXHURQ³%HEp´³0HOOL]DV´\³5HFHWD´ Patrocinios Deportivos La marca continuó patrocinando clubes y torneos relacionándolos con el disfrute en familia. Fue Sponsor del Torneo Abierto de Polo, de River y Boca, y a la URBA (Rugby). Resultados Según Gallup (2008) tuvo excelente repercusión en público, generando gran awareness, con grandes niveles de reconocimiento (43% en el Comercial Bicicleta) y asociación de marca (66% en la campaña de gráfica, 51% en le comercial de TV y 46% en Radio. El comercial recibió distintos premios en la región para Latinoamérica, como el prestigioso Lápiz y suma más de 20.000 vistas en youtube. En cuanto al evento de Lanzamiento a Prensa, asistieron más de 60 invitados, entre ellos Asistieron 26 periodistas especializados en Marketing y Publicidad así como las autoridades del Consejo Profesional de RRPP y del Consejo Publicitario Argentino. Jorge Colombatti, Vicepresidente de Marketing de MasterCard Cono Sur, dio la bienvenida a los presentes junto a la protagonista del comercial, la bicicleta, y a la fachada del antiguo Hotel de fondo. Luego de adelantar ciertas características de lo que los periodistas, miembros de instituciones y autoridades del museo iban a ver, invitó a los presentes a pasar al micro cine donde se proyectó la publicidad.. Una vez concluido el evento, se entregaron los press kits que contenían el comunicado de prensa y un CD con información, la publicidad y el backstage. Los medios representados fueron: ‡$GODWLQD ‡ÈPELWR)LQDQFLHUR ‡%DFDQDO ‡5HYLVWD%X]] ‡'LDULR&ODUtQ ‡'HVWHIDQR%L] ‡(GLWRULDO'RVVLHU ‡,QIREDH3URIHVLRQDO ‡/DWLQ6SRWV5HYLVWD ‡0DxDQD3URIesional ‡3ODQHWD8UEDQR ‡5HSRUWH3XEOLFLGDG ‡5HYLVWD(QODFH ‡5HYLVWD2KODQGD ‡5HYLVWD:DWW ‡6LWH0DUFDFRP ‡(O6KRZ&UHDWLYR ‡5HSRUWH3XEOLFLGDG ‡5DGLR$PpULFD 6H UHJLVWUDURQ PiV GH FOLSV UHIHULGRV DO DQXQFLR GHO ODQ]DPLHQWR GHO FRPHUFLDO ³%LFLFOHWD´ FRQ XQ $G
Value (VAP) de $130.000. PREMIOS EIKON 2010 Categoría: Publicidad Institucional, Campaña General Caso: Campaña publicitaria Green Dot Empresa: Deloitte. Integrantes: Por Deloitte: Virginia Gatti Introducción Reseña de la compañía Una Firma Global Deloitte Touche Tohmatsu (DTT) es una organización dedicada a prestar servicios profesionales y de asesoramiento con la excelencia como diferencial, con una estrategia global ejecutada localmente en cada una de sus oficinas alrededor del mundo. Integrada por Firmas miembro y con aproximadamente 168.000 personas en 140 países, brinda servicios en cuatro áreas profesionales: Auditoría, Impuestos, Consultoría y Corporate Finance. Las Firmas miembro atienden a más de la mitad de las compañías más grandes a nivel mundial, así como a grandes e importantes empresas nacionales y de crecimiento global e instituciones públicas. En Argentina cuenta con más de 2000 profesionales. Actualmente, desde las oficinas de Buenos Aires, Córdoba, Mendoza y Rosario, atiende a las principales empresas locales e internacionales que operan en el país. Mantiene una posición de liderazgo en la prestación de servicios a clientes en los sectores del papel, agropecuario, agroindustrial, generación y distribución de energía eléctrica, petróleo y gas, industrias automotriz, petroquímica, láctea, de neumáticos y salud, medios, telecomunicaciones, y servicios financieros, así como también a empresas y organismos del sector público. La relación entre la firma internacional y la firma local La firma argentina ha tenido siempre una posición preponderante en la organización internacional que se origina tanto por su antigüedad, como por el talento de sus profesionales. La organización internacional da soporte técnico a cada una de las operaciones locales, lo que les permite brindar servicios profesionales que son homogéneos a nivel mundial. Por otra parte, la activa participación de la firma argentina en la organización internacional permite desarrollar una relación personal y profesional con las principales oficinas en el mundo, asegurando un rápido acceso a la experiencia y recursos profesionales de toda la organización para beneficio de sus clientes. LATCO (Latinamerican Countries Organization) A partir del 1° de junio de 2005 las oficinas de Argentina, Bolivia, Colombia, Costa Rica, Ecuador, El Salvador, Guatemala, Nicaragua, Honduras, Panamá, Paraguay, Perú, República Dominicana, Uruguay, Venezuela pasaron a formar una sola Firma: Deloitte LATCO. Bajo esta nueva organización, las firmas locales se unificaron alienando estrategias a través de la región, expandiendo sus capacidades de servicio y compartiendo recursos humanos y tecnológicos para satisfacer las necesidades de los clientes, generando mayores oportunidades para la firma local y expandiendo el horizonte de la carrera profesional de su gente. La excelencia en los servicios A fin de satisfacer y superar las expectativas de los clientes, DTT ofrece servicios de calidad en todo el mundo. Por ello, todas sus oficinas han adoptado políticas, metodologías y programas de entrenamiento que son diseñados, promulgados y controlados a nivel internacional. De esta manera DTT puede brindar a los clientes que operan en forma global, servicios de altísima calidad en todos los lugares en los que éstos se encuentren establecidos. Este enfoque y compromiso, combinado con la extensa red mundial de oficinas, garantiza a los clientes que reciban un servicio de idéntica calidad en todo momento y lugar. La organización combina los beneficios de un fuerte liderazgo global y local con valores, políticas y estrategias que les son comunes. El por qué de la campaña Una marca es la esencia de una organización y lo que la diferencia de otras frente a los clientes o cualquiera de sus grupos de interés. Una marca reside en la mente de la audiencia y ofrece un marco o un contexto que ayuda a guiar todas las acciones y decisiones basadas en la estrategia. La publicidad es una de las expresiones más importantes de nuestra marca y es imprescindible que transmita cómo estamos siempre un paso por delante. Por ello se planteó la necesidad de crear una campaña quebrara parámetros y fuera diferenciadora, de uso exclusivo para publicidad externa, que nos asegurara a todas las firmas miembro de Deloitte una poderosa y eficaz comunicación en todos sus puntos de contacto. Los anuncios son algunas de las expresiones de más alto perfil de nuestra marca. Ya sean creados para hacer frente a una situación determinada o para ser parte de una campaña de sensibilización mayor, es fundamental que representen las mejores cualidades de Deloitte. La campaña Green Dot surge ante la necesidad de una comunicación global que, de una manera poderosa y decidida, exprese el punto de vista de la firma sobre los problemas y oportunidades que enfrentan nuestros clientes y nuestra gente. Conceptos de la campaña Green Dot como héroe de las comunicaciones ‡ El Punto Verde es el símbolo del punto de vista de Deloitte ‡ Se utiliza para apelar a la inteligencia, al humor, generar intriga y un compromiso emocional en la comunicación ‡ Es un símbolo instantáneamente identificable y de orgullo para la organización ‡ Es rápidamente adaptable a todas las situaciones Objetivos ‡ Crear un "paraguas" basado en el nuevo posicionamiento de marca. ‡ Permitir a todas las firmas miembro utilizar bajo un mismo criterio efectivas campañas de marketing que puedan ser adaptadas a los diferentes mercados. ‡ Incrementar la visibilidad de la compañía externamente. ‡ Identificar al punto verde rápido y únicamente con Deloitte, diferenciándose así del resto. ‡ Poner a Deloitte siempre un paso adelante en la mente de las audiencias. ‡ Generar un estilo visual atrevido y llamativo, con el punto verde como el héroe contra un fondo negro para captar perfectamente la claridad, liderazgo y dirección de la Firma. Lapsos La campaña se implementó a partir de junio del 2009 y, dado el éxito logrado, se planea seguir utilizándola a largo plazo. Públicos -­ Clientes/ proveedores -­ Formadores de opinión -­ Medios de comunicación -­ Periodistas -­ Comunidad académica -­ Gobierno -­ Comunidad empresaria -­ Opinión pública Canales de comunicación utilizados: -­ Revistas -­ Diarios -­ Folletería entregada en eventos -­ Vía pública -­ Páginas Web -­ Merchandising Acciones realizadas y ejecución del plan Pasos y Procesos del Plan Ante la necesidad de un cambio de imagen a nivel global se contrató a una agencia de publicidad que trabajó en conjunto con los equipos de Marketing y Comunicaciones y Brand. Se mantuvieron reuniones periódicas con los involucrados en el proyecto lo que permitió definir el concepto de la campaña. A continuación transcribimos los brief que dieron origen a algunas de las piezas que se muestran en el anexo: ¿A quiénes les hablamos? A altos ejecutivos de empresas de todos los tamaños, con un énfasis en las grandes y medianas. ¿Cuál es nuestra percepción de ellos? Son conscientes de toda la prensa negativa sobre el ambiente de negocios, pero también pueden ver algunas de las oportunidades de posicionamiento posible que ellos pueden crear. ¿Cuál es el punto de vista de Deloitte? Nubes: En Deloitte, entendemos que los entornos de mercado difíciles crean más oportunidades, si están dispuestos a buscarlas. Medalla: Con una planificación cuidadosa, se puede tener éxito incluso en un entorno difícil. Sin cabeza: Cuando todo el mundo está entrando en pánico, es especialmente importante tener la cabeza en claro. Reflector: Tiempos difíciles para los líderes crean oportunidades para brillar. Despertador (1): El momento de actuar es ahora. Despertador (2): El mundo ha cambiado. Es hora de repensar su estrategia de negocio. ¿A quiénes les hablamos? A altos ejecutivos de empresas de todos los tamaños, con un énfasis en las grandes y medianas, específicamente al CFO. ¿Cuál es nuestra percepción de ellos? La aplicación de las Normas Internacionales de Información Financieras (NIIF) se convertirá en un problema importante en el próximo año o dos. Algunos líderes ya incluyen a las NIIF en sus agendas, reconociendo el valor de la planificación anticipada y la necesidad de la posición competitiva de la organización para el futuro. ¿Cuál es el punto de vista de Deloitte? Abacus : El cambio está llegando. El tiempo de prepararse para las NIIF es ahora. ¿A quiénes les hablamos? A altos ejecutivos de empresas de todos los tamaños, con un énfasis en las grandes y medianas. ¿Cuál es nuestra percepción de ellos? Son conscientes de la enorme cantidad de información que existe de cuestiones tales como el cambio climático, pero pueden no percibir el importante valor que les puede proporcionar a su negocio, ni ser conscientes de un flujo constante de nueva legislación en torno a este ámbito. ¿Cuál es el punto de vista de Deloitte? Semilla/ Globo: Aplicando una política ambiental al corazón de su negocio, puede sacar una ventaja competitiva. ¿A quiénes les hablamos? A estudiantes y recién graduados. ¿Cuál es nuestra percepción de ellos? Pueden conocer la firma, pero es poco probable que tengan conocimiento acerca de por qué Deloitte es diferente de otras grandes empresas de servicios profesionales. ¿Cuál es el punto de vista de Deloitte? Luna: Somos la compañía ideal para personas brillantes y ambiciosas, porque ofrecemos una trayectoria profesional flexible. Puerta: Somos la compañía ideal para personas brillantes y ambiciosos, porque ofrecemos unatrayectoria profesional flexible que puede llevarte a donde quieres ir. Se desarrolló una cartera inicial de 12 anuncios. A medida que la campaña fue avanzando exitosamente, cada uno de los países fue generando sus propias piezas de acuerdo a sus necesidades específicas. Siempre respetando la coherencia y el concepto general de la misma. Para ayudar en la implementación local de los anuncios, se crearon guías de uso, se realizaron tele-­
conferencias periódicas y se creó un sitio Web destinado para tal fin. Por estos canales se plantearon a nivel mundial las directrices y el estilo de la campaña que se debía respetar. Algunos de los medios en los que pautamos: Diarios y Revistas: Diario Clarín (Suplemento IECO) -­ Diario Perfil ± Diario El Cronista Comercial -­ Anuario Perfil ± Revista Fortuna -­ Revista Mercado ± Revista Imagen -­ Revista AFA (Asociación del Fútbol Argentino) -­ Revista CUBA (Club Universitario de Buenos) -­ Revista Club Champagnat -­ Revista Colegio Champagnat -­ Revista Ex alumnos Champagnat ± Revista Colegio Michael Ham -­ Revista Newman ± Revista Polo Jockey Club ± Revista CASI (Club Atlético de San Isidro) -­ Anuario inmobiliario -­ Anuario The Georgian ± Revista Perspectiva Rosario -­ Revista Ergo ± Revista Pap Mendoza (Especial Consultoras) ± Revistas y folletería entregada en eventos: Partido Argentina/Canadá (Cancha River Plate) -­ Coloquio IDEA -­ 11º Simposio sobre Legislación Tributaria Argentina -­ Colegio Göethe (Rosario) -­ Cena anual Fundación Endeavor ±-­ Tiflonexos Asociación Civil -­ AAEF (Asociación Argentina de Estudios Fiscales) -­ Asociación Civil Diagonal -­ Web: Banners digitales en Bumeran.com ± Página oficial de Deloitte en Facebook -­ Vía Pública: Estática en el partido Argentina/Canadá (Cancha de River) -­ Subtv ± Acción Día de la Escarapela (reparto de escarapelas por la calle Florida en el día de este símbolo patrio) ± Afiches en Universidades -­ Televisión: TyC Sport (Zócalo) Merchandising: Pins obsequiados a socios, directores, gerentes, clientes y periodistas. Buzos utilizados en acción vía pública y obsequiados a clientes/contactos/periodistas. Evaluación Los resultados obtenidos fueron sumamente positivos y superaron las expectativas. El estilo visual atrevido y llamativo de la campaña, con el Punto como el héroe sobre un fondo negro, captó perfectamente la claridad y el liderazgo de Deloitte de una manera única e inolvidable. Nos puso un paso por delante en la mente de nuestro público. Impacto en el público externo: Algunos comentarios de las audiencias: ‡ Claridad ´(VWR FRUWD HO DEDUURWDPLHQWR \ OD PRQRWRQtD TXH VH HQFXHQWUD HQ WRGDV ODV GHPiV FRPXQLFDFLRQHV (O
UHVWRHVLQGHFLVR\SRFRFODURSHUR'HORLWWHYDPiVDOOi´ ‡ Intriga ´'HORLWWHLQYLWDDOFRPSURPLVRFRQXQGHEDWHLQWHOLJHQWHJUDWLILFDQWH\FRQGXFHQWHKDFLDHOSURJUHVR´ ‡ Optimismo ³6LPSOHV SRGHURVRV SXQWRV GH YLVWD HPRFLRQDOPHQWH JUDWLILFDQWHV 'DQ OD HVSHUDQ]D GH TXH VH SXHGHQ
tomar decisiones y llevar adelante acciones que permiten HOSURJUHVR´ ‡ Seguridad ´'HORLWWHHVFRQILDEOH\FODUDPHQWHVDEHTXpHVWiKDFLHQGR´ PREMIOS EIKON 2010 Categoría: Publicidad Institucional, Campaña General Caso: Piero, Sponsor Oficial del Sueño Argentino Empresa: Piero Integrantes: Por Piero: Ezequiel Fourcade, Gerente Comercial;; Marina Castro, Jefe de Marketing. Introducción Acerca de PIERO PIERO, empresa líder Argentina en la industria del descanso, inició sus actividades en la década del 60.En un principio, la tarea era fabricar sillas de madera en un pequeño taller de Buenos Aires, sobre la calle Estomba. Con los años fue creciendo e incorporando productos,fabricando muebles, sillas y sillones, constituyendo una clásica empresa familiar. Hoy, en una planta que abarca una superficie total de 100.000 m2, constituidos por un gran parque que rodea aproximadamente 38.000 m2 cubiertos, ubicada en Pacheco, Provincia de Buenos Aires, PIERO mantiene la misión de actuar de manera rentable en las actividades de la industria del colchón, del poliuretano, de las almohadas y de las estructuras de resortes;; satisfaciendo las necesidades de sus clientes mediante una fuerte imagen de marca sostenida con la calidad de sus productos y servicios. Propio de una empresa que continúa siendo familiar, las actividades de PIERO se fundan en una sólida base de valores. Trabajo en equipo, flexibilidad, orientación a resultados, orientación al cliente, respeto a la persona, responsabilidad, iniciativa, humildad e innovación son los pilares de una cultura corporativa presente en cada tarea realizada por las personas de la empresa. Situación: contexto del plan presentado PIERO es líder en el mercado de colchones y sommiers. Cada año representa un nuevo desafío para la empresa, a la hora de justificar, mantener e incrementar ese liderazgo. Para el sector de Marketing, el desafío es doble, tener que comunicar piezas efectivas frente a un producto de compra planificada y a la vez, tener que destacarse de todas las marcas líderes de otros rubros del mercado con tanto bombardeo en la comunicación. En el año del Campeonato Mundial de la futbol, el desafío es aún mayor. Algunas empresas tienen al mundial como eje de su plan anual de comunicación, explotando al máximo los recursos para vincularse con él de la manera más creativa. 3LHURXQDYH]PiVVHDGXHxDGHVXWDQUHFRUGDGRFODLP³6SRQVRURILFLDOGHO6XHxR $UJHQWLQR´XWLOL]DGRHQHOPXQGLDO Objetivo Elaborar una campaña integral de comunicación entorno al Campeonato Mundial de Fútbol, bajo el claim ³6SRQVRURILFLDOGHO6XHxR$UJHQWLQR´UHIRU]DQGRVX%UDQG$ZDUQHVV Estrategias ‡$FHQWXDUHOOLGHUD]JR$FHUFDUVHDOFRQVXPLGRU\DWRGDVODVHPRFLRQHVTXHYLYH durante el mundial. ‡3DXWDUHQPHGLRVPDVLYRVGHFRPXQLFDFLyQSDUDHVWDUSUHVHQWHGRQGHFRPXQLFDQ los líderes de otros rubros. ‡6HULQQRYDGRUHVHQODXWLOL]DFLyQGHPHGLRVGHFRPXQLFDFLyQQRFRQYHQFLRQDOHV entre las empresas del rubro. ‡$SOLFDUHOFRQFHSWRHQPHGLRV\SXQWRVGHYHQWDVEXVFDQGRTXHHOFRQVXPLGRU reciba la mayor cantidad estímulos posibles. Ejecución Primer paso: Concepto Piero habiendo desarrollado un claim con alta recordación, vuelve a hacer sus apuestas bajo un concepto puramente emocional, buscando la identificación con el público. Con este concepto amplio y cercano, la empresa une a todos los argentinos bajo un mismo sueño, Argentina otra vez campeón del mundo! PIERO no sólo comparte este deseo sino que lo transmite en una campaña 360º Con el concepto bien claro, PIERO se pone en marcha con el fin de reflejarlo en distintas piezas y aplicaciones. Segundo paso: estar donde están los líderes Como dice el subtítulo, PIERO tenía que estar donde están los líderes. Pero además, debía hacerlo de manera contundente, creativa y coherente. Por eso, se planificó una estratégica pauta en TV cable (ESPN +, TyC Sports y los principales noticieros), radio AM y FM y vía pública, y para cada medio realizó piezas que funcionan muy bien individualmente, pero logran complementarse entre sí. Para TV cable, se adaptaron 3 spots de 15 segundos cada uno (Barrera, Canten Amargos y No toques) en donde vemos a distintos protagonistas soñando;; y de la forma en que viven el mundial en estos meses. Barrera: Vemos a una pareja durmiendo placenteramente. El hombre se encuentra sumergido en un profundo sueño, en el cual se proyecta a si mismo jugando un partido de futbol con el equipo Argentino. De repente comienza a moverse hacía la izquierda, hacía el lado en el que duerme su mujer, tratando de encontrar la posición correcta para armar una barrera, mientras el equipo rival se prepara para patear un tiro libre. Canten Amargos: Nuevamente vemos a la pareja durmiendo. El hombre soñando que está alentando al equipo Argentino desde la tribuna, ahora comienza a moverse dentro de la cama y empuja a su mujer, escuchamos como e[FODPD³&DQWHQ$PDUJRV´PLHQWUDV]DPDUUHDDVXPXMHUODFXDO
lo mira y vuelve a dormirse rápidamente. No Toques: Vemos a la misma pareja durmiendo. Ahora quien se mueve es la mujer, tratando de acercarse a su marido. Cuando ella consigue pegarse a él, vemos como HOVHPXHYHKDFtDDWUiVOHYDQWDQGRODVPDQRV\H[FODPDQGR³(K-XH]1RWRTXHV´ mostrando que el no hizo la falta al tocar al contrincante. 3DUDYtDS~EOLFDVHGLVHxRODJUiILFD³%HEH´UHODFLRQDGDFRQHOGHVFDQVRHOVXHxR y el mundial. Bebé: Es una gráfica de gran impacto. Es un primer plano de un niño recién nacido durmiendo placenteramente, con todo lo que ello implica como sus sueños a futuro;; la vida por delante, con sus mejillas pintadas con los colores de la bandera Argentina. En el caso GH UDGLR VH UHDOL]y XQ MLQJOH ³9HUVLyQ 0XQGLDO´ HO FXDO IXH XQD DGDSWDFLyQ GHO MLQJOH
institucional. Esta versión toma su forma y base en la canción oficial del mundial, con un ritmo sudafricano y voces de cancha. Tercer paso: nuevos medios Además de los medios masivos de comunicación convencionales, PIERO se enfrenta al desafío de encontrar nuevos canales de comunicación, para demostrar su liderazgo QRVyORGHVGHHO³TXp´VLQRWDPELpQGHVGHHO³FyPR´ 3RUHVRHQHOPHVGHPD\RODHPSUHVDODQ]D³/D0iTXLQDGHORV6XHxRV´XQDSLH]DGHPDUNHWLQJYLUDO
on line interactiva (véase en www.pierosponsor.com), convirtiéndose así en la primera empresa del sector en aprovechar los beneficios de la comunicación on line y de las redes sociales. La Máquina de los Sueños busca generar una interacción con el usuario haciéndolo protagonista de su propia historia. La experiencia lo sorprende con un recorrido virtual por el material que tiene en su cuenta de Facebook (fotos, comentarios, grupos de fans, amigos) y otras sorpresas más, como un sorteo para JDQDUHO³&ROFKyQGHWXVVXHxRV´ Para apoyar a esta acción y traccionar más personas al site, se armó una pauta en medios digitales tales como: Facebook, Yahoo e Infobae. Cuarto paso: comunicación 360 grados Para complementar las acciones detalladas previamente, PIERO decide cerrar el círculo de la comunicación 360º llegando a dos espacios o momentos del consumidor. Lo primero fue llevar el concepto al punto de venta, con el fin de estar presentes en el momento de la decisión de compra. ‡6HSORWHDURQYLGULHUDVGHORFDOHVH[FOXVLYRVGH3,(52DGDSWDQGRODJUiILFD³%HEp´ ‡6HGHVDUUROODURQ%HGWRSSHUVSDUDDSR\DUVREUHODVFDPDVH[KLELGDVHQHOSXQWR de venta. El mismo consistía en la foto del bebe de un lado y en la foto del chico del otro, acompañados SRUODIUDVH³6SRQVRURILFLDOGHO6XHxR$UJHQWLQR´ ‡6HGHVDUUROOyXQ)L[WXUHDFRPSDxDGRGHODIRWRGHO³%HEp´\GHO³&KLFR´ORVFXDOHV fueron repartidos a clientes en el punto de venta. ‡6HGHVDUUROODURQPRWLYRVGHDILFKHV³%HEH´\³&KLFR´SDUDTXHVHFXHOJXHQ en el punto de venta. Por otro lado, se desarrolló una campaña de prensa para la difusión de la campaña viral. La búsqueda constante de la innovación en la comunicación, generó que Piero logre un lugar muy especial para todos los argentinos utilizando un concepto muy fuerte. A la vez mostró estar a la altura de los líderes de rubros de consumo masivo, al llevar a la comunicación del sector a un nivel superior, optimizando los recursos disponibles. Dificultades y ajustes Como lo mencionamos anteriormente, la decisión de lanzar una campaña de marketing viral on line fue un gran desafío, con muchas dudas en el camino, fue una apuesta muy grande que enfrentó el equipo de marketing. Este tipo de piezas suelen tener mucha repercusión cuando el anunciante es una multinacional, pero tratándose de una marca de colchones y almohadas, la respuesta resultaba imprevisible, pero a la vez motivadora para todo el equipo. Evaluación La apuesta de comunicación propuesta por Piero motivó mucho a los sectores involucrados, sabiendo que los resultados son a largo plazo. De todos modos, hoy el consumidor cree y apuesta a Piero, viéndose reflejado en la participación de mercado y la trayectoria que logro con el tiempo esta empresa familiar. Repasando algunos números, en el primer mes desde su lanzamiento, La Máquina de los Sueños fue YLVLWDGDSRUSHUVRQDVFRQXQDDOWDWDVDGHSDUWLFLSDFLyQHQHOVRUWHR³3DUDGRUPLUPHMRU´ En cuanto a la prensa, hubo muchas menciones en medios digitales, gráficos y radiales, e incluso propuestas comerciales surgidas a partir de la difusión de la gacetilla. Dormí bien. Viví mejor. PIERO.
PREMIOS EIKON 2010 Categoría: Publicidad Institucional, Campaña General (PYME) Caso: Similitudes Empresa: SAMSA. Servicios de Aguas de Misiones S.A. Integrantes: Por SAMSA: Luis Ariel Meyer ;; Christian Hilbert. Introducción Naturaleza de la compañía El plan de comunicación ha sido ejecutado por la empresa SAMSA (Servicios de Aguas de Misiones S.A.). Brinda, desde 1.999, los servicios de agua potable y cloacas en las ciudades de Posadas y Garupá, Provincia de Misiones. La empresa, perteneciente al Grupo español ACS, ganó una licitación internacional luego de ofrecer el mayor plan de inversiones y reducir la tarifa del servicio en un 30% con respecto al anterior operador estatal. Problema de la campaña, sus causas y consecuencias Desde sus inicios y hasta el año 2008 la empresa ha tenido niveles de imagen institucional muy bajos, alternando entre los últimos lugares en el posicionamiento de servicios públicos. Ha sido continuamente cuestionada por ser una empresa privada de origen extranjero. Actualmente samsa es la única empresa de capitales extranjeros que brinda este tipo de servicios en el país luego de la crisis argentina de 2001. Por otra parte, la imagen de samsa también se vio afectada durante la ola estatizadora en Latinoamérica, lo que creó en la opinión pública la percepción de que las empresas extranjeras con concesiones o privatizaciones no hacen inversiones, prestan un pésimo servicio, llevan sus ganancias al exterior, etc. A pesar de eso, samsa se mantuvo en el mercado, no sin tener que sortear exitosamente varias crisis de distintas magnitudes, tanto internas como externas. Aunque samsa continúa aplicando tarifas que se encuentran desactualizadas, desde el mes de noviembre de 2007 el Ente Regulador viene reconociendo paulatinamente los incrementos en los costos operativos de la empresa, de acuerdo a lo establecido en el Contrato de Concesión, con lo que se aprobaron algunos incrementos tarifarios que afectan la imagen institucional. A lo anterior se le suma un problema muy complejo y que da origen a la campaña: la baja valoración por parte del XVXDULR DO VHUYLFLR EiVLFR ³VHUYLFLR GH DJXD SRWDEOH´ $XQTXH HVWD VLWXDFLyQ QR OH FRUUHVSRQGH
solo a samsa sino que ocurre de igual forma en todo el país y hasta podríamos extenderlo a toda Latinoamérica. El usuario NO le otorga el valor real que representa la gran cantidad de recursos necesarios para brindar este servicio eficientemente. Tampoco valora los beneficios que tiene este servicio en la salud de toda la comunidad. En algunos casos se duda sobre la calidad del agua suministrada, aunque en el caso de samsa este tema es una importante fortaleza, ya que el agua potable que produce supera estándares nacionales y posee la calidad más controlada de la región. Partiendo de los problemas enumerados, se generó un Programa de Marketing para revertirlos paulatinamente, si bien los resultados hasta el momento superaron las expectativas continuamos con el Programa en su segunda instancia, la Campaña de Comunicación SIMILITUDES. De la experiencia de más de 10 años de gestión en el servicio, samsa ha tenido entre sus políticas el estudio permanente de la conducta de sus usuarios. A partir de ahí es que detectamos una serie de hipótesis en las que basamos los ejes de la presente campaña SIMILITUDES: Hipótesis nro. 1. El usuario no conoce la complejidad y tecnología que interviene en el servicio: Ejemplo A) piensa que el agua se saca del río y se bombea a la casa, desconoce aplicaciones de tecnología de avanzada, equipos de alta precisión, grandes inversiones o el proceso muy complejo y costoso para captar, producir y distribuir agua potable. Ejemplo B) El usuario acepta pagar más de $100 por telefonía celular y se resiste a pagar $ 40 por el servicio de agua potable y cloacas. Así es que el usuario valora tanto el equipo como el servicio de telefonía mucho más que el del agua potable, aún sin saber el costo de brindar cada uno, siendo las inversiones en saneamiento de las mayores en magnitud ejecutadas en todo el mundo. * Para la participación en los Premios EIKON 2010 SAMSA presentará la primer etapa de la campaña, con la correspondiente medición y presentación de los resultados obtenidos, esta primer parte ha sido ejecutada prácticamente en su totalidad. Estructura de la campaña: La campaña está basada en una serie de anclajes, cada uno de ellos focalizados a resolver las situaciones de hipótesis que se plantearon. Ejecución de la campaña: La campaña SIMILITUDES se inició el 1 de febrero de 2010 con la referencia al SULPHUHMH³7(&12/2*,$´HOPLVPRWHQGUiYXHORKDVWDHOPHVGHMXQLRGH Objetivos generales del programa de comunicación: 1. Formar en el usuario un nuevo concepto de VALOR sobre el servicio de agua potable, focalizando en la TECNOLOGIA APLICADA y la COMPLEJIDAD de la prestación del servicio. 2. Fortalecer los aspectos positivos en el servqual de la empresa y disminuir los negativos. 3. Lograr impactos de gran asimilación y recordación del mensaje en la audiencia meta. 4. Mantener el índice de Imagen Positiva de la empresa por encima del 70%. Públicos a los que se dirigió el plan: En el área de concesión, ciudades de Posadas y Garupá, samsa brinda servicios a 80.000 usuarios. De acuerdo con los objetivos y estrategias planteadas, la comunicación se dirigió a un multitarget compuesto por todos los usuarios de la empresa, conformado por personas de todos los estratos sociales y culturales residentes en las ciudades de Posadas y Garupá, provincia de Misiones. Canales de comunicación utilizados: -­ Televisión -­ Diarios -­ Vía pública -­ Radios ± Internet -­ POP -­ Gigantografía -­ Agenda de Información cultural. Ejecución del Plan Descripción de pasos y procesos. En primer lugar se presentaron a la agencia publicitaria los objetivos y lineamientos estratégicos de la empresa. Durante dos semanas se mantuvieron varias reuniones con la Agencia buscando el enfoque creativo que samsa necesitaba para esta ocasión, se analizaron ideas, se debatieron conceptos y se realizaron pruebas sobre los mismos. Finalmente llegamos a la selección del concepto SIMILITUDES. El concepto de la campaña se basa en la comparación directa del servicio de agua potable con objetos o situaciones a los que el usuario le otorga una ALTA VALORACION. En cada situación se plantea una comparación a partir de una afirmación inicial (que la audiencia tiene asimilada por seguro). En la primera parte de la campaña el título es: ACÁ HAY TECNOLOGIA acompañada por un celular de última generación (ver avisos para diarios). Luego cierra el aviso otra frase con una segunda afirmación: ACA TAMBIÉN acompañada de un vaso de agua potable (de acuerdo al medio se aclara el porque de tal comparación (siendo la TV y Diarios la estructura central de la campaña y los demás medios funcionando como refuerzo de los anteriores) Justificación del 1er. eje de campaña. Para aumentar el valor que el cliente le otorga al servicio de agua potable, creemos fundamental sacarlo del lugar de simpleza que tiene (El Ing. José Luis Guarch, ex *HUHQWH *HQHUDO GH $JXDV GH 6DOWD KD OOHJDGR D GHILQLU DO VHUYLFLR GH DJXD SRWDEOH FRPR ³OD KHUPDQD
pobre dHORVVHUYLFLRV´ (QHVWDFDPSDxDHQSULPHUOXJDUVHEXVFDGHVWDFDUOD³7HFQRORJtDDSOLFDGDHQHOVHUYLFLR´(VWHHVXQR
de los conceptos principales que necesitamos estructurar en el usuario. Se necesita de tecnología de avanzada e investigación permanente para ofrecer un servicio de Calidad como el de samsa. Cuando el usuario lo asimile valorará más el servicio, se sentirá más satisfecho porque estará pagando algo que cree que lo vale, será menos reticente a incrementos tarifarios, etc, etc. Por todo lo anterior elegimos la palabra TECNOLOGIA para la primer etapa. Con respecto al objeto para realizar la comparación, Para la comparación se eligió el TELEFONO CELULAR porque es un producto que todos conocen, se usa y se lo valora mucho. El celular se reinventa permanentemente y sorprende al público. Por medio de la observación se puede destacar que para las clases sociales más bajas es casi el único objeto de lujo, en general este segmento adquiere los más caros como forma de ostentación. En el otro extremo, las clases sociales más altas también son tentados por la última tecnología, pero en general por los servicios que son utilizados como herramientas con fines profesionales, mail, mensajería instantánea, etc. Los usuarios de telefonía celular aceptan pagar tarifas mucho más elevadas que por el servicio de agua potable, sencillamente nadie sabe como funciona, nos imaginamos altísimos costos para su prestación, el servicio nos sorprende y por lo tanto aceptamos las tarifas correspondientes. Definidos los ejes de campaña se inició la producción de las diversas piezas publicitarias que se comentan a continuación. Piezas de la campaña: Piezas Gráficas: Se efectuaron diseños gráficos exclusivos para cada etapa de la campaña, no se utilizó Image bank a fin de evitar dificultades en el diseño y costos de derechos de imagen. Cada pieza fue diseñada por profesionales reconocidos del medio. 1. Diarios: Se diseño un aviso formato horizontal, 32 x 21 cm. En las variantes full color y blanco y negro, el mismo fue publicado en los tres diarios más importantes de la Provincia. Se publicaron 3 avisos por semana en cada medio. También se adaptó al estilo de la campaña un aviso sobre el día del trabajador sanitarista. 2. Agenda Curiosa: se pautaron avisos en la tapa de esta agenda cultural y social, con distribución gratuita en bares y restaurantes de la ciudad. Se efectuaron 4 publicaciones quincenales. Se entregaron 1.000 ejemplares quincenales en el salón de atención al cliente de samsa (sector de cajas y atención personal) 3. POP: Se diseñó la gráfica para todos los soportes disponibles en el edificio comercial de la empresa. Radio: Se utilizó una Banda de Música Original, compuesta por Osvaldo De La Fuente y voz en off del locutor Alejandro Battalla. En el caso del audio de la campaña vale la pena hacer un comentario ya que se editó la Banda de Música de la campaña publicitaria anterior (ganadora de 2 EIKON DE ORO 2008) y que ya es reconocida como parte de la marca samsa. Para comunicar TECNOLOGIA, EXACTITUD, etc. se editó con estilo de MUSICA TECNO. Televisión: 1. Spot: Se produjo un spot de 30 segundos. Utilizando recursos de animación y efectos especiales este spot se destaca de otras piezas televisivas locales. Este trabajo genera en la audiencia una atracción extra, ya que rompe con el estilo publicitario tradicional desarrollado en las pequeñas ciudades, en general con muy pocos recursos de producción para publicidad televisiva. La pauta en Tv fue uno de los pilares de la campaña, pautando en 3 canales locales y en los programas de mayor audiencia con un pase por emisión. 2. Micros televisivos: Se realizaron micros de 3 minutos de duración para el programa Tecnología para Ganar, se publicaron dos micros por semana durante dos meses, se presentaron informes sobre la incorporación de un nuevo laboratorio de Micromedición, de gran aporte tecnológico para el servicio de agua potable. Cine: Durante los últimos dos meses de la campaña se pautó en las 4 salas del cine local, con más de 500 pases mensuales. Vía Pública: 1. Se diseñó una gráfica que se ubicó en 8 pantallas backlight situadas en las principales avenidas y en la Costanera de Posadas. 2. Se diseñará una gigantografía para el predio de la empresa, incluyendo todos los ejes de la campaña y se instalará para finalizar la campaña a modo de sostener la recordación de la misma. Internet: Se generaron avisos tipo "sin fin" animados, producido en formato de banner y que fue pautado en los portales de noticias más importantes a nivel local. Gestión de Prensa: Para reforzar la campaña publicitaria se produjeron gacetillas de prensa, las cuales se publicaron en los 4 diarios de mayor circulación y se realizaron notas periodísticas, entrevistas personales y telefónicas en los más importantes canales de Tv. y radios locales. Se focalizó la gestión de prensa en la incorporación del nuevo banco de pruebas de medidores y el desarrollo del nuevo sitio web de samsa, incorporando servicios al cliente. También se publicaron notas sobre esos temas en el house organ mensual de la empresa. *Se realizó el pautado en los medios seleccionados en el plan y se lanzó la primera parte de la campaña el 01 de febrero de 2010. Ajustes que se introdujeron durante la implementación, dificultades encontradas y soluciones implementadas Dificultad 1. El primer problema tuvo que ver con el "cómo" estructurar un mensaje de valoración del servicio y aporte institucional que tenga llegada a un público universal, con tanta diversidad socioeconómica y conductual. Solución 1. Para dar correctamente el primer paso, llamar la atención de todos los micro segmentos, se generó un paquete de varias opciones visuales y de contenido. Así se pensaron cuatro alternativas (etapas de la campaña) en donde todos los integrantes del target pueden verse identificados en algunas de ellas. Dificultad 2. Luego de definido el concepto, se necesitaba contar con la seguridad de que los objetos a seleccionar para hacer las comparaciones sean efectivamente muy valorados por el usuario y que dicha comparación resulte positiva para el servicio de samsa. Otro problema en esta etapa era no contar con recursos suficientes para solicitar un estudio de mercado para esta situación particular. Solución 2. para resolver esta cuestión se realizó un estudio con el personal de la empresa. En samsa trabajan 241 personas, de todos los niveles sociales y culturales, por lo que prácticamente sin costo efectuamos un estudio representativo de nuestro multitarget. Se consultó sobre el posicionamiento de objetos relacionados a Tecnología, Calidad, Exactitud, Inversión, etc., para las situaciones planteadas en las hipótesis de la campaña. Dificultad 3: Se presentó al momento de decidir el vuelo de cada etapa de la campaña. El estudio general de Imagen de samsa se efectúa cada 6 meses y no era posible adelantarlo tanto tiempo. Solución 3: Finalizando el segundo mes desde el lanzamiento del primer eje de la campaña se realizó un muestreo sobre la tendencia de la campaña a través del call center de samsa. De esta forma medimos alcance e impacto y tuvimos una orientación que nos permitió establecer el vuelo de esta primer etapa. Evaluación y pruebas. Efectuamos dos estudios para evaluar los resultados de esta primera etapa Uno realizado a través del Call Center de Samsa, en el mes de abril. La metodología empleada fue entrevistas telefónicas. La muestra no probabilística estuvo conformada por 100 casos (usuarios con nro. de teléfono registrado en la base de datos de samsa). El objetivo fue detectar la tendencia de los resultados parciales de la campaña. El otro estudio fue realizado por la consultora especializada Decisiones Empresariales. (Datos en sección ANEXOS). Se realizó entre los días 3 y 7 de junio de 2010. La metodología empleada fue entrevistas personales domiciliarias. Se tomó una muestra polietápica estratificada por áreas, de niveles socioeconómicos, edad y sexo. La muestra probabilística estuvo conformada por 315 casos efectivos y se realizó la supervisión telefónica del 20% de los casos. * Ofrecemos en esta presentación los resultados del estudio realizado por la Consultora debido a que cumple con el rigor científico en su procedimiento. Identificación, análisis y cuantificación de los resultados. Beneficios producidos por la puesta en marcha del plan comunicacional Del estudio de medios hemos detectado impacto con recordación de la campaña en el 43.8% de la población, por lo que el plan de medios ha sido efectivo;; fundamentalmente por la dificultad de llegar a segmentos tan disímiles y en tan poco tiempo de ejecución. En el gráfico anterior se aprecia que se ha logrado que la mayoría de los usuarios recuerde y relacione la comunicación de la empresa con la tecnología que se utiliza para la prestación del servicio. En segunda instancia relacionado a la pureza o calidad del agua, lo cual es eje fundamental del servicio. Precisamente, tecnología aplicada y calidad de agua son los fundamentos de la primer etapa de la campaña. En el gráfico anterior se aprecia el verdadero impacto de la campaña, se observa como se modificó la percepción del usuario sobre la aplicación de tecnología en el servicio básico. Sumando a los que creen que el servicio tiene un muy alto y alto nivel de tecnología llegamos al 73%, con lo que la valoración ha cambiado favorablemente. Esta pregunta está orientada a conocer lo que el usuario percibe sobre las incorporaciones de tecnología que samsa ha realizado en el servicio. En el gráfico se aprecia claramente el impacto de la campaña publicitaria sobre la opinión del usuario, este direcciona su opinión en sentido a la información que brinda la Campaña. Imagen Institucional. En este caso se cumplió el objetivo planteado para toda la gestión general de comunicación de samsa, mantener el nivel de Imagen positiva sobre el 70%. Hay que destacar 2 aspectos muy negativos que afectaron últimamente a este indicador, los aumentos de tarifa y las condiciones climáticas del último verano (el más caluroso de los últimos 40 años) por lo que la campaña ha logrado influir y sostener el objetivo de imagen positiva. Servqual del servicio. Uno de los aspectos más importantes en la Imagen de la empresa está formado por la calificación que le asigna el usuario al servicio que recibe en su hogar. Podemos observar en el último estudio que mientras que el servicio no ha tenido mejoras estructurales en su prestación (y como mencionamos antes, hemos vivido un verano con récord de temperatura y consumo), el usuario calificó con 7 puntos al servicio que recibe en su hogar, mientras que en años anteriores esta puntuación nunca superó el 6,6. El Servqual del servicio de samsa está compuesto por 20 indicadores que representan los ítems más importantes para los usuarios con respecto al servicio de agua potable. De acuerdo al último estudio podemos observar que 11 ítems tuvieron mejoras en su puntuación, sobresaliendo los siguientes 3 indicadores que fueron sustento de la campaña SIMILITUDES. 1. La empresa cumple con las inversiones necesarias para el servicio. 2. Los equipos y maquinarias de la empresa son modernos (se logró el mejor índice desde que se inició esta medición en junio de 2006) 3. El agua suministrada es 100% potable (se logró el mejor índice desde que se inició esta medición en junio de 2006) Conclusiones generales de los resultados. 1. La campaña SIMILITUDES ha cumplido los objetivos propuestos, se aprecia una modificación en la valoración del servicio de agua potable por parte del usuario, se incorporó el concepto de servicio con tecnología aplicada. 2. El usuario percibe que samsa cumple con la incorporación de tecnología necesaria para la eficiente prestación del servicio;; además afirma su convicción en la calidad del agua potable, pilar fundamental para la continuidad en la gestión del servicio. 3. Se logró mantener la Imagen Positiva de samsa por encima del 70% (muy cerca del mejor registro histórico de la concesión), aún luego de pasar un verano muy caluroso y con aplicación de incrementos tarifarios. 4. La mayoría de los indicadores del Servqual han evolucionado favorablemente, sobre todo los que tienen relación directa con el mensaje de la campaña. 5. La calificación al servicio que presta samsa ha llegado a la mejor ubicación desde el inicio de la concesión, inclusive con lo mencionado en el punto nro. 4. 6. Los aspectos negativos originados por aumentos tarifarios de 2009 han sido amortiguados por la correcta prestación de los servicios, el desarrollo del plan de marketing y la ejecución de la actual campaña publicitaria "SIMILITUDES". PREMIOS EIKON 2010 Subcategoría Publicidad Institucional Gráfica Caso: Molinos, lo mejor de nosotros Empresa: Molinos Río De La Plata Agencia de PR Liebre Amotinada Estudio Wallace Integrantes: Por Molinos Río De La Plata: Adela Sáenz Cavia, Verónica Gené Por Liebre Amotinada: Fabián Albinatti, Mariano Pasic, Diego Bertagni Por Estudio Wallace: Juje Rodriguez, Eduardo Wallace Introducción Molinos Río de la Plata S.A., fundada en 1902, es una de las empresas líderes de la industria alimenticia de Sudamérica. Además es uno de los actores clave en el procesamiento de soja y comercialización de sus derivados. La Compañía basa su estrategia en dos pilares: el desarrollo de sus marcas tanto en el mercado local (a través de marcas tan reconocidas como Lucchetti, Matarazzo, Vieníssima, Patitas, Granja del Sol, Preferido, Exquisita y Gallo) como en el internacional y su creciente participación en el complejo oleaginoso mundial. Molinos Río de la Plata cuenta con 21 Plantas Industriales, 7 Centros de Distribución, una dotación de 5.000 colaboradores y cotiza en la Bolsa de Comercio de Buenos Aires bajo el símbolo MOLI. Situación y contexto 'H³DxRVHQODPHVDGHORVDUJHQWLQRV´D³/RPHMRUGHQRVRWURV´ Desde el año 2002, cuando Molinos cumplió 100 años, la compañía contaba con la misma campaña publicitaria basada eQHOOHJHQGDULRFODLP³DxRVHQODPHVDGHORVDUJHQWLQRV´ Entrando a su segundo siglo de vida, Molinos ingresaba en una nueva etapa y era clave mostrar su visión de futuro e innovación desde la comunicación corporativa. Esta actualización debía, sin embargo, mantener los principios escritos en su visión, que rigen a Molinos desde sus inicios: compromiso con el país, confiabilidad, innovación y crecimiento. Con esta visión, en mayo de 2009 se realizó el lanzamiento de la nueva identidad corporativa de Molinos. A partir de este acontecimiento, el área de Relaciones Institucionales decidió desarrollar una nueva FDPSDxDJUiILFDGHFRPXQLFDFLyQ&RUSRUDWLYDHQODFXDOVHYLHVHUHIOHMDGDODQXHYDLGHQWLGDG\FODLP³/R
PHMRUGHQRVRWURV´ ³/R PHMRU GH QRVRWURV´ WDO FRPR VH GHVFULEH PiV DEDMR WUDQVPLWH HO FRQFHSWR GH TXH 0ROLQRV HV HQ
definitiva, un grupo de gente que aporta talentos, entusiasmo y dedicación, dando lo mejor de cada uno para ofrecer los mejores productos, con el compromiso y la firme visión de seguir nutriendo a las generaciones actuales y futuras. Lo mejor de nosotros Molinos es un equipo de gente que aporta talentos, entusiasmo y dedicación en favor del desarrollo del país. Molinos es cada una de las personas que hacemos e hicieron su historia. Cada comunidad en la que nos establecemos. Cada consumidor. Cada socio, colaborador y amigo. Estamos orgullosos de nuestro origen, porque lo que nos hace grandes es nuestra historia, nuestra cultura y los valores que nos diferencian y nos guían. En Molinos ofrecemos lo mejor de nosotros, lo mejor del campo argentino, ofrecemos los mejores productos con el compromiso y la firme visión de seguir nutriendo a las generaciones actuales y futuras. Objetivos El objetivo de la campaña es transmitir eVWHFODLP\VX³EDMDGD´SHURFRQWDGRHQ3ULPHUD3HUVRQD(QHVH
sentido, la mejor forma de darle fuerza y transparencia a la campaña era que los protagonistas de las diferentes áreas de Molinos, fueran los protagonistas de la campaña corporativa. El objetivo final de esta estrategia era lograr cercanía de los públicos de interés expresada a través de los empleados de las diferentes áreas de la empresa. La idea era mostrar cómo, con su trabajo diario cada empleado está siendo parte de la historia y futuro de Molinos y de la vida diaria de cada consumidor por medio de los productos que la Compañía ofrece. Audiencias Como toda campaña institucional el foco estuvo puesto en los stakeholders de la compañía. Especialmente inversores, bancos, medios de comunicación, clientes, proveedores, competidores, líderes de opinión y áreas de decisión política. Canales: Medios de comunicación: ‡ Diarios nacionales ‡ Revistas de negocios ‡ Publicaciones del sector social ‡ Asimismo se adaptó una pieza para utilizarla como placa en TV y radio Los medios de comunicación mencionados son los vehículos utilizados para acercar la campaña a las audiencias detalladas. El Proceso de trabajo Para el desarrollo de la campaña se convocó a la agencia de publicidad (Liebre Amotinada) y a un reconocido estudio de fotografía (Estudio Wallace) con el cual se realizó una producción fotográfica especial para la realización de los avisos institucionales. Primera etapa: Planificación En conjunto con la agencia se definió la realización de 9 piezas gráficas, de las cuales 8 representaban a áreas clave de la compañía y una agrupaba a un conjunto de colaboradores. Las áreas que fueron parte de cada una de las piezas fueron definidas por su importancia estratégica para los diferentes stakeholders: ‡ Investigación, Calidad y Desarrollo ‡ Inversiones (Planta San Lorenzo y Planta Granja del Sol) ‡ Recursos Humanos ± Capacitación ‡ Responsabilidad Social Empresaria ± Programa de Voluntariado ‡ Seguridad, Higiene y Medio Ambiente ‡ Originación de Materias Primas ‡ Marketing Segunda etapa: Desarrollo de Avisos Institucionales Imposible de incluir los 5000 empleados que integran Molinos, estos avisos consiguieron condensar la enorme diversidad de la fuerza de trabajo en un grupo de nada más que 8 colaboradores. La selección se ocupó de contener hombres y mujeres, jóvenes recién ingresados y personas de mucha antigüedad, personal jerárquico y operarios, trabajadores del campo e investigadores, representantes de áreas corporativas y de las plantas industriales. Con la ayuda de Recursos Humanos, se convocaron a cuatro gerentes (Marketing, Planta San Lorenzo, Investigación y Calidad, Refrigerados y Congelados), dos supervisores (uno agrícola y otro industrial), a una joven analista y a una empleada voluntaria del programa de Responsabilidad Social Empresaria. A pesar de su número reducido, el grupo resultó una muestra representativa de una empresa que posee 21 plantas industriales, 9 marcas líderes del mercado nacional y presencia en toda la geografía argentina. Para cada una de las situaciones se redactó un título (intentado que fuera atrayente y divertido) y un texto más descriptivo del porqué de la selección de esa área o tema. Unidos entre sí, este grupo de microrrelatos conformaba una suerte de primera semblanza del conjunto de la compañía. Tercera etapa: Producción Fotográfica y Diseño Durante 5 jornadas se realizaron las tomas fotográficas en las diversas locaciones de Molinos. La producción contó con un vestuario para cada protagonista, maquilladora y asistentes de luces. Una vez finalizada esta producción, la agencia de publicidad realizó el diseño de los diferentes avisos institucionales de la campaña. Cuarta etapa: Comunicación de la Campaña La campaña gráfica se pautó en diversos medios, dirigidos a diferentes audiencias clave para Molinos, pero haciendo especial foco en medios de negocios, de interés general, tercer sector y RSE, Recursos humanos y diarios nacionales. También, toda la campaña, es decir las 8 piezas gráficas, fueron parte de la Memoria y Balance Anual 2009, que tuvo esta historia como hilo conductor. Este último material es entregado a líderes de opinión, periodistas e inversores. Logros alcanzados La campaña logró el objetivo de dar cercanía a la compañía, mostrDQGRD0ROLQRV³GHVGHDGHQWUR´(QHVH
sentido tuvo muchísimo apoyo interno, no solo por parte de los niveles gerenciales, sino también de los empleados en general, que se sintieron identificados con el mensaje y la calidad de los avisos. Asimismo, la campaña fue evaluada positivamente por diferentes stakeholders. De hecho hubo numerosos comentarios, especialmente de parte de los medios, respecto a la creatividad y originalidad del enfoque. Como indicador se puede tomar que Molinos fue evaluada por los mismos en el 7mo lugar del Ranking de Prestigio del Diario Clarín versión 2010. Obviamente esta evaluación está influenciada por muchísimas variables que hacen a la imagen de la compañía, pero creemos que la Campaña Institucional colaboró con la construcción de Molinos como empresa fuerte y prestigiosa, pero a la vez cercana. Beneficios producidos por la puesta en marcha del plan comunicacional. La campaña sin dudas está colaborando con el objetivo de reforzar la imagen de la compañía, dando a su vez muestras de su permanente innovación y actualización. PREMIOS EIKON 2010 Categoría: Subcategoría Publicidad Institucional Gráfica Caso: La paz es de los valientes Empresa: Fundación Mundo sin Guerras Agencia de PR: BasevichCrea Integrantes: Por Mundo sin Guerras: Javier Zaldarriaga;; Daniel Tesoriere;; Alicia Ordoñez. Por BasevichCrea: Javier Basevich Introducción La PAZ es de los Valientes El 2 de Octubre de 2009 partió desde Wellington (Nueva Zelanda) la más grande movilización por la Paz realizada en toda la historia. Esta Marcha por la Paz durante 90 días recorrió más de 90 países en los 5 continentes, con un solo mensaje: PAZ. A lo largo de este recorrido se realizaron numerosas acciones con organizaciones locales y gubernamentales para generar un compromiso REAL hacia la búsqueda de la paz y el cumplimiento de un petitorio. Más de 4.500.000 personas participaron de la Marcha en el mundo, y más de 38.000.000 participaron vía internet. A partir de esta Marcha se comenzó a trabajar en la búsqueda de un cambio de actitud concreto respecto a los conflictos bélicos, a las armas nucleares y a la violencia. Hemos trabajado en el desarrollo de una campaña MUNDIAL y otra específica para la Argentina, país donde terminó esta Marcha el 2 de Enero de 2010 en una MOVILIZACION MASIVA a Punta de Vacas (Mendoza), con más de 35.000 asistentes bajo la UNICA BANDERA de la Paz. A nivel MUNDIAL trabajamos en el desarrollo de un concepto potente y diferencial que sea el eje de toda la campaña en el mundo y en delinear una estrategia que permita cubrir toda la Marcha durante su recorrido A nivel ARGENTINA desarrollamos una campaña integral, con una serie de acciones de alto impacto para darle visibilidad a una propuesta orientada a: -­ Concientizar sobre la PAZ como valor fundamental y a su vez REVALORIZANDO este término tan utilizado -­ Convocar al cierre de la Marcha en Mendoza Realizamos más de 24 acciones originales y de alto impacto. Integramos Publicidad + MKT de guerrilla + Televisión + Radio + Multimedia + Marketing viral + Intervenciones urbanas + Prensa + PR. A través de una acción 360º logramos revalorizar el ROL DE CADA INDIVIDUO como PROTAGONISTA en la construcción de una PAZ POSIBLE. Trabajamos sobre un mensaje POSIBLE y REAL y no sobre un mensaje utópico y lejano. Marcha Mundial por la Paz. Llevando la paz a todo el mundo Acerca de la organización: La Fundación Mundo sin Guerras es un movimiento social cuyo objetivo es la creación de una conciencia no-­violenta mundial. A través de su acción promueve e impulsa todo tipo de ideas que contribuyan a eliminar las guerras y la violencia en todas sus formas (económica, racial, religiosa, sexual, sicológica y moral). Mundo sin Guerras surge en 1995 en España. Desde entonces actúa en numerosos países de todo el mundo. En los últimos años ha centrado sus esfuerzos priorizando campañas por el desarme nuclear, la paz mundial y la no-­violencia. Sus puntos básicos de trabajo son: -­ El repudio de la violencia física, cuya máxima expresión son las guerras, y toda otra forma de violencia. -­ La afirmación de la libertad de ideas y la diversidad de creencias para todo ser humano. -­ El reconocimiento de la diversidad personal, de los pueblos y de las culturas. -­ La afirmación de la igualdad de todos los seres humanos. -­ La consideración del ser humano como valor y preocupación central. Trabaja en particular para el cese de las guerras y los conflictos armados en todo el mundo. Su aspiración es aunar al movimiento antibélico, conectando las ramas del pacifismo y de la no-­violencia dispersas geográficamente, y también dar su punto de vista sobre temas aparentemente no relacionados para ir avanzando en una comprensión global de las guerras y la violencia. $GHPiVGHVXVDFFLRQHVHQFDGDSDtV\GHKDEHURUJDQL]DGROD³0DUFKD0Xndial por OD3D]´06*DSR\DODVVLJXLHQWHVFDPSDxDV³(XURSDIRU3HDFH´³0HGLWHUUiQHRVLQ $UPDV1XFOHDUHV´³/DWLQRDPpULFD/LEUHGH*XHUUDV´ Eliminar las guerras representará salir definitivamente de la prehistoria humana y dar un paso de gigante en el camino evolutivo de nuestra especie. Un "mundo sin guerras" es una propuesta que mira al futuro y aspira a concretarse en cada rincón del planeta para que el diálogo vaya sustituyendo a la violencia. Marcha Mundial por la Paz. Llevando la paz a todo el mundo Acerca de la Marcha Mundial por la Paz: La primer Marcha Mundial que recorrió el mundo pidiendo el fin de las guerras, el desmantelamiento de las armas nucleares y el cese de todo tipo de violencia. Una movilización social sin precedentes en la historia. POR QUE LA MARCHA? El hambre del mundo puede resolverse con el 10% de lo que se gasta en armamento. Nos propusimos unir todas las fuerzas y las voces de nos que no quieren guerra y violencia en el mundo. Eliminar las guerras y violencia representa dar un paso gigante en la evolución de la humanidad. Objetivo de la marcha Crear conciencia global de la necesidad de una verdadera PAZ y de repudio a todo tipo de violencia. -­ Implementar en cada lugar del mundo, una propuesta de acciones concretas para llevar a la realidad esa búsqueda de paz y no-­violencia -­ Generar el compromiso de los principales actores sociales y gubernamentales Como fue la marcha? Un equipo base de más de 100 personas recorrió todos los países, sumando gente local a su paso y realizando todo tipo de actividades con organizaciones: foros, encuentros, festivales, conferencias y eventos (deportivos, culturales, sociales, educativos, artísticos, musicales, entre otros) También realizaron encuentros con gobiernos locales para que firmen un petitorio y compromiso por la paz mundial y el desarme nuclear Las propuestas de la marcha mundial Debemos superar la violencia hoy, exigiendo: -­ El desarme nuclear a nivel mundial, -­ El retiro inmediato de las tropas invasoras de los territorios ocupados, -­ La reducción progresiva y proporcional del armamento convencional, -­ La firma de tratados de no agresión entre países -­ La renuncia de los gobiernos a utilizar las guerras como medio para resolver conflictos. Lo urgente es crear conciencia por la Paz y el desarme. Pero también es necesario despertar la conciencia de la No Violencia Marcha Mundial por la Paz. Llevando la paz a todo el mundo Marcha Mundial &DPSDxD3XEOLFLWDULD³/D3D]HVGHORV9DOLHQWHV´ Agencia: BasevichCrea (www.basevich.com.ar) Cliente: Mundo Sin Guerras www.marchamundial.org.ar Concepto: Héroes cotidianos 6ORJDQ³/DSD]HVGHORV9DOLHQWHV´ La PAZ es de los Valientes. Resignificamos el concepto de valentía. Ese lugar que siempre estuvo ocupado por los soldados y poderosos ahora lo ocupa el ciudadano común. Mostramos situaciones cotidianas para convertirlos en héroes por la paz. Transmitimos la idea que cada uno es protagonista y responsable de la Paz a través de la no-­violencia de cada día;; y que ése es un camino para lograr objetivos de paz a nivel mundial. Una verdulería, un taller mecánico, una obra en construcción son el marco para mostrar a esos héroes cotidianos con los que nos cruzamos cada día. Convivir, tolerar, respetar y hacerle el vacío a la violencia es ser un héroe. Cada día, en cualquier lugar. Un mensaje positivo, esperanzador, alegre y comprometido. Yo hago la Paz. Soy Valiente! Somos Valientes! La Propuesta -­ (QQDOWHFHUDORV³+pURHV&RWLGLDQRV´ Buscamos promover a los héroes cotidianos. Gente que se juegue por la paz todos los días a través de hacerle el vacío a la violencia. -­ Buscamos llegar a una PAZ MUNDIAL a partir de la NO-­VIOLENCIA individual No apuntamos a un mensaje utópico y lejano, sino a un mensaje ACCESIBLE, REAL y POSIBLE para cada una de las personas. A partir de lograr sociedades con MENOS VIOLENCIA, eso va a servir para activar sobre cuestiones más grandes en todo el planeta: Desarme nuclear / Retirada de ejércitos -­ Proponemos una ACTITUD ACTIVA frente a la violencia y por la Paz Cada uno es responsable de lograr la Paz. Hacer la Paz requiere de una actitud y acciones todos los días. Marcha Mundial por la Paz. Llevando la paz a todo el mundo -­ La PAZ como un bien propio y de todos. La PAZ puede ser uno de los bienes más valiosos que podemos tener en común toda la humanidad, en todo el mundo. Objetivos creativos -­ Rescatar/Destacar al ciudadano común. Al héroe cotidiano por la paz. -­ Transmitir una PAZ posible y al alcance de cada uno. Hacerle el vacío a la violencia es el camino para construir una paz mundial -­ Mostrar a la gente como protagonista de la paz. -­ Contagiar las ganas de ser valiente. Conceptos a transmitir: -­ Esperanza / Positivo -­ Futuro -­ Unión / Protagonismo de la gente Marcha Mundial por la Paz. Llevando la paz a todo el mundo Una Campaña de Valientes $WUDYpVGH³/D3$=HVGHORV9DOLHQWHV´UHVLJQLILFDPRVHOFRQFHSWRGHYDOHQWtD La valentía está asociada al más fuerte, al poderoso. La valentía remite a las guerras, y la imagen del valiente es la del soldado cargando su arma y conquistando. El que va al frente, a luchar. Una verdulería, un lugar donde se construye la Paz mundial. 7RPDPRVODHVWpWLFDGHORV³JXHUUHURVYDOLHQWHV´-­a través de ángulos contrapicados y ambientes épicos-­ enalteciendo y agrandando la figura humana, y la llevamos a situaciones cotidianas: Una verdulería, un taller mecánico, una obra de construcción. Nos basamos en la imagen de la guerra para construir un mensaje de Paz. Buscamos que la gente se apropie del concepto y asuma su rol de valiente. Que sienta que desde su lugar puede hacer mucho por la Paz mundial, lo que lo convierte en un héroe;; porque el mundo necesita pequeños grandes héroes todos los días. Hacerle el vacío a la violencia es el camino de los valientes por la paz. A través de la campaña promovemos el mensaje de la Marcha Mundial que propone una Paz desde un lugar activo y de construcción diaria. Cada uno desde su actitud personal de no-­violencia en cada lugar;; en el trabajo, en la calle, el su hogar. La campaña se desarrolla poniendo todo el protagonismo en la gente, a partir de la IUDVH³6R\9DOLHQWH´ Soy Valiente! Afirma y pone en lugar de héroe a la gente. Soy Valiente! Es una declaración en si misma, por la paz mundial y la no-­violencia. Soy Valiente! Es hacerse cargo. Somos Valientes! ³5HVLJQLILFDUHOFRQFHSWRGHO³9DOLHQWH´HVHOPi[LPRKDOOD]JRSDUDFRQWDJLDU\ transmitir a la gente esas ganas de ser el protagonista por la Paz. Desarrollamos un concepto original para seguir hablando de algo que se habla mucho, pero que se hace poco. Buscamos un mensaje sencillo y concreto, que contagie las ganas de sumarse. Quisimos hacer entender que cada uno desde su lugar, todos los días, puede hacer mucho por la Paz, simplemente teniendo una actitud de noviolencia. Queremos que la gente se anime a ser valiente, para construir un lugar sin violencia y desde ahí aspirar a una paz mundial. Javier Basevich (Director Creativo BasevichCrea) Objetivo general Concientizar sobre la importancia de la PAZ en todo el mundo. 5HYDORUL]DUHO52/GHO³FLXGDGDQRFRP~Q´FRPRSURWDJRQLVWDSDUD el logro de esa paz, a partir de la no-­violencia individual Mostrar y dar a entender que a través de las acciones individuales de no-­violencia es posible lograr objetivos de paz en cada lugar, hasta llegar a objetivos mayores en todo el mundo. Objetivos de comunicación -­ CONTAGIAR las ganas de Paz &RPXQLFDUODFRQVLJQDPDVLYDPHQWHGH³/D3D]HVGHORVYDOLHQWHV´ Mostrar que la paz es posible desde la acción de cada uno. Y que cada uno puede ser protagonista en ese cambio a nivel mundial. -­ FOCO de atención en cada país Que la gente pueda interesarse en la propuesta y tener ganas de informarse más acerca de las consignas de la Marcha -­ Participar virtualmente y sumarse para el cierre Convocatoria a sumarse en internet a la Marcha y al cierre en Punta de Vacas. Objetivos creativos -­ Rescatar/Destacar al ciudadano común. Al héroe cotidiano por la paz. -­ Transmitir una PAZ posible y al alcance de cada uno. Hacerle el vacío a la violencia es el camino para construir una paz mundial -­ Mostrar a la gente como protagonista de la paz. -­ Contagiar las ganas de ser valiente. Conceptos a transmitir -­ Esperanza / Positivo -­ Futuro -­ Unión / Protagonismo de la gente Marcha Mundial por la Paz. Llevando la paz a todo el mundo La Paz es de los Valientes Los números. El éxito contundente de una acción 360º 90 días 90 países 5 pedidos concretos por la Paz 6 continentes 160.000 km recorridos 160 pasos fronterizos recorridos -­ 1 spot de TV. -­ 2 spots de radio. -­ 18 spots virales. -­ 26 personas participaron de la realización del spot. -­ 162 celebridades argentinas. -­ Más de 120.000 visitas al spot en Youtube. -­ 26 Canales de Radio y TV pautaron el spot. -­ 30 salas de cine. -­ 1092 televisores, en 74 estaciones de subte, emitiendo el spot. -­ Más de 3.080 menciones del tema en radio y TV. -­ 16.100 soportes de comunicación en vía pública y subtes. -­ 82 espacios en estaciones del Ferrocarril Mitre. -­ 250.000 stickers repartidos. -­ Más de 24.000 adherentes en micrositios de Facebook. -­ 5 piezas de e-­mailing enviadas por acción de MKT Viral. -­ Participación en 14 recitales. -­ Más de 16.000 personas en caravana uniendo Plaza de Mayo y el Congreso. -­ 3.862 celebridades y miembros de gobierno del mundo adhirieron. -­ 168 celebridades locales. -­ 1.052 periodistas en todo el mundo siguiendo el tema. -­ Mención permanente en prensa y programas de TV. -­ 500 remeras temáticas entregadas a celebridades argentinas. -­ Más de 35.000 personas participando del cierre al pie del Aconcagua. 1 solo mensaje en todo el mundR³3D]´ 1.800.000 de pesos la inversión lograda como donación en medios para la realización de campaña de convocatoria La Paz es de los Valientes Algunos resultados que reflejan el éxito de la acción -­ Más de 4.500.000 de participantes en el recorrido y eventos relacionados. -­ Más de 38.000.000 de participantes virtuales en todo el mundo. -­ Más de 120 gobiernos en todo el mundo recibieron la Marcha. -­ 3.862 celebridades y miembros de gobierno adhirieron a la marcha. -­ Invitación a presentar el tema en la entrega de los Premios Nobel de 2009. -­ 340 eventos masivos por la Paz generados durante el recorrido. -­ Medios de todo el mundo siguiendo la Marcha y transmitiendo el mensaje. -­ Acción viralizada en todo el mundo. -­ 86 documentos de intención por la paz firmados durante el recorrido. -­ Más de 32.000 personas de todo el mundo en el cierre de la Marcha (Aconcagua, Mendoza). -­ Amplia conformidad por parte de todos los colaboradores. Manifiesta voluntad de volver a colaborar por parte de los medios, productoras y colaboradores para cualquier otro momento en que les sea requerida ayuda por el mismo tema. PREMIOS EIKON 2010 Categoría: Publicaciones Institucionales Caso: Fiat 90 años en la Argentina Empresa: Fiat Auto Argentina Integrantes: Por Fiat Auto Argentina: Cristiano Rattazzi, Presidente;; Gerardo Bovone, Director General;; Javier Vernengo, Director de Relaciones Externas y Comunicación Introducción Fiat Auto Argentina S.A. es parte de Fiat Group Automobiles SpA, sociedad de Fiat Group especializada en la producción y la comercialización de autos y vehículos comerciales livianos de las marcas Fiat, Alfa Romeo, Lancia, Abarth y Fiat Professional. También forman parte del sector automotor del Grupo Fiat, Ferrari y Maserati, casas automotrices focalizadas en la fabricación y comercialización de autos deportivos de lujo. Asimismo en 2009, Fiat suscribió una alianza estratégica global con Chrysler Group LLC, sociedad de la que Fiat tiene una participación -­que se irá acrecentando con el cumplimiento de determinados objetivos-­ , y que prevé sinergias en el terreno industrial, desarrollo de nuevos productos y aprovechamiento de redes comerciales. Fiat es una de las casas pioneras de la industria automotriz del mundo, habiendo producido su primer automóvil en 1899. Desde entonces, lleva producidos más de 90 millones de autos y vehículos comerciales livianos, con un abanico de no menos de 400 modelos desde su fundación en la ciudad de Turín, Italia. Algunos de sus modelos se han convertido en clásicos de la industria automotriz y las marcas del sector DXWRPRWRUGHO*UXSR)LDWFRQTXLVWDURQRQFHYHFHVHOWtWXOR³$XWRGHO$xR´HQ(XURSDHOPiVMHUDUTXL]DGR
reconocimiento atribuido a la industria automovilística del mundo. Actualmente, Fiat Group es un complejo grupo industrial que opera a nivel mundial en el campo automotivo, con presencia en 190 países que desenvuelve actividades productivas y de servicio a través de los siguientes Sectores Operativos: Automóviles [Fiat Group Automobiles + Ferrari + Maserati];; Maquinaria para la Agricultura y la Construcción [CNH Global];; Vehículos Industriales [Iveco];; Componentes y Sistemas de Producción [Fiat Powertrain Technologies, Magneti Marelli, Teksid y Comau] y Otras Actividades, entre las que figuran Editorial y Comunicación [Itedi], sociedades de Investigación y Formación [Centro Ricerche Fiat, Elasis e Isvor Fiat] y actividades de servicios corporativos. Las razones de esta obra En conmemoración de los 90 años de Fiat en Argentina y el ciclo de reposicionamiento que está transitando la marca en el país como correlato del relanzamiento de la fabricación de autos, de la renovación de la gama producto y aggiornamiento de la imagen de la marca tanto en el mercado doméstico como a nivel mundial, la Dirección de Relaciones Externas y Comunicación de la empresa consideró oportuno desarrollar una publicación institucional específica que plasmara una síntesis de la rica historia de la marca y de la empresa en la Argentina en el ámbito social, industrial, empresarial y deportivo, complementada con el análisis de especialistas sobre la contribución de los italianos al desarrollo cultural, social y económico del país, de modo de rescatar uno de los valores esenciales de la marca y de la propia cultura argentina: la italianidad. La obra debía conformar un puente de vinculación entre la corriente cultural, artística, económica y social que une a Italia y Argentina. Del mismo modo debía ser también un homenaje a las generaciones de hombres y mujeres que con sus sueños y su trabajo han contribuido al desarrollo y crecimiento de nuestro país, y a quienes le han permitido recorrer sus primeros noventa años de vida empresaria, plasmando su actual pujanza y desarrollo comercial. En definitiva se trataba de enhebrar la historia de Fiat en el país con el contexto histórico y humano de los argentinos, nutriéndose de sus alegrías y también de los sinsabores. Por esa razón, el público objetivo de la publicación definido inicialmente por Fiat, no debía estar centrado solamente en el clásico fanático de los automóviles sino que debía seducir, entusiasmar y ser valorado también por otros sectores institucionales de la sociedad argentina. El libro, por otra parte, debería estar editado e impreso en el mes de noviembre, de modo de ser utilizado como regalo institucional de fin de año para diversos públicos: concesionarios;; funcionarios gubernamentales;; dirigentes empresarios y gremiales;; periodistas y medios de comunicación;; bibliotecas, entes difusores de la cultura italiana en el país, públicos internos del Grupo Fiat en la Argentina y el mundo, etc. El plan Objetivos Poner en valor y dar a conocer el legado material y cultural de los inmigrantes italianos, y de la propia empresa, en el país, como partícipes de etapas fundamentales de la historia social, cultural y económica de la Argentina. Compendiar y sistematizar la historia de Fiat en el país en el contexto de los ciclos históricos de la Argentina Revalidar a Fiat como protector del patrimonio y difusor de la cultura. Crear un espacio dedicado a explorar tramas de la interrelación entre dos culturas, la argentina y la italiana, correlato de la gravitación de los flujos inmigratorios hacia la Argentina y que han sido determinantes en el surgimiento de una identidad cultural propia. El aspecto clave, según la Dirección de Relaciones Externas y Comunicación a la hora de decidir la WHPiWLFDGHODSXEOLFDFLyQGH)LDWIXHODGHUHVFDWDUOD³LWDOLDQLGDG´FRPRXQYDORUHVHQFLDOTXHKDFHWDQWR
a la cultura argentina y al ADN de la empresa, fomentando el sentido de pertenencia y el orgullo del personal de la empresa que se transmite de generación en generación, así como validar los lazos entre la marca y la sociedad argentina. Públicos Atento que la publicación no se reduce a rescatar la historia de Fiat en la Argentina, sino que, con el aporte de especialistas de diversas disciplinas, procura identificar la contribución de la inmigración italiana y su cultura en el desarrollo de la sociedad argentina, se trata de una obra de interés general. Por lo tanto, la obra no fue pensada para un público determinado, sino que es una contribución de la empresa a la comunidad en su conjunto, si bien como objeto físico, el libro fue pensado como obsequio institucional de jerarquía, de allí el cuidado puesto en su confección desde el punto de vista de la calidad. Por el carácter histórico, ciertamente la publicación tiene un interés especial para investigadores, funcionarios, profesionales y docentes de temáticas afines (entre ellas: patrimonio cultural, patrimonio industrial, ingeniería, historia, políticas públicas y sociología). Vale destacar que aportó documentación inédita a diferentes organizaciones, tanto públicas como privadas, que disponen de libros para consulta. Así es como la publicación reviste un interés especial para investigadores, profesionales, docentes y estudiantes de temáticas afines. Como objeto físico, como obsequio institucional, el libro fue planteado para atender los siguientes públicos: ‡ Públicos externos: o Líderes de opinión y dirigencia: funcionarios gubernamentales del orden nacional, provincial y municipal;; dirigentes empresarios y gremiales;; referentes de la cultura;; periodistas;; legisladores;; dirigentes políticos;; personalidades del mundo académico, etc. o Concesionarios: titulares de los concesionarios;; primera línea gerencial de la red comercial, y clientes referenciales de la red. o Proveedores: titulares y primera línea gerencial de las empresas. o Entes de preservación del patrimonio cultural: bibliotecas;; medios de comunicación e institutos vinculados a la cultura italiana. o Cuerpo diplomático: Embajada y consulados de la República de Italia en la Argentina, y otras representaciones diplomáticas en el país. o Industria automotriz y automovilismo: representantes de empresas colegas;; deportistas del automovilismo vinculados con la marca, como Froilán González y los pilotos de la Fiat Linea Competizione. ‡ Públicos internos: o Fiat Mundo: principales directivos y dirigentes del Grupo Fiat en el mundo y en el Mercosur o Comunidad Fiat: ex directivos del Grupo Fiat en la Argentina o Personal: primera y segunda línea ejecutiva de las empresas del Grupo Fiat en la Argentina;; empleados y operarios con una larga continuidad en la empresa;; empleados y operarios destacados. Equipo Coordinación general: Dirección de Relaciones Externas y Comunicación, Javier Vernengo Coordinación de investigación, textos y entrevistas: Jorge Tartarini Plazos El proyecto se inició en abril de 2009 y se estableció un lapso de ejecución de entre seis y siete meses. La idea era tener la pieza lista para su distribución en noviembre de 2009. Difusión y distribución de la obra La obra se difundió como regalo institucional de fin de año a empresarios, periodistas, altos directivos de la empresa, funcionarios públicos y otros grupos de interés. Se distribuyeron más de 3.500 ejemplares en los primeros dos meses. Ejecución (O OLEUR ³3UHVHQFLD LWDOLDQD HQ HO GHVDUUROOR FXOWXUDO DUJHQWLQR +RPHQDMH GH )LDW HQ VXV DxRV´ VH
construyó combinando la investigación histórico documental ±con relatos directos de los protagonistas, para lo cual un equipo de especialistas realizó entrevistas y recogió testimonios inéditos. El proyecto tuvo una fase de discusión y de análisis previo que se inició en el mes de Abril de 2009, con el requerimiento de la Dirección de Relaciones Externas y Comunicación de Fiat que, con la idea general y bajo pautas establecidas, contrató a la consultora SPE que tuvo a su cargo la realización integral de la publicación. Se estableció un cronograma de seguimiento pautado por parte de la Dirección de Relaciones Externas y Comunicación de Fiat, que también se ocupó de la edición y redacción de varias partes de los capítulos referidos a la historia de la empresa y la marca. Asimismo, la elección de los especialistas para la realización de los capítulos referidos a aportes de la cultura italiana en diversas disciplinas fue consensuada entre Fiat y SPE, otorgándoles absoluta libertad ±salvo las limitaciones de extensión de los textos e ilustraciones-­ para explayarse. En ese lapso de aproximación, a lo largo de sucesivas reuniones de trabajo se estructuró el sumario y se identificaron los personalidades para realizar las colaboraciones temáticas, además de establecer quienes serían los invitados a aportar su testimonio. En paralelo a la definición del sumario se propusieron diferentes alternativas de diseño y diagramación, tipo de papel y tamaño, hasta ajustarlos de acuerdo a lo que fue la edición finalmente aprobada. Esta actividad estuvo a cargo del estudio Fontana / Franco. Diseño. La coordinación general de la obra estuvo a cargo del Arquitecto Jorge Tartarini, investigador de CONICET, quien además tuvo a su cargo la investigación histórica de la documentación y las entrevistas a las personalidades que dieron su testimonio. Durante más de tres meses de relevamiento en archivos, bibliotecas y colecciones públicas y privadas ±
dentro y fuera del país, con la colaboración del Centro de Estudios Históricos Fiat de Turín-­ se obtuvo una base documental sólida que permitió estructurar los contenidos del trabajo en torno a etapas y temas fundantes, dentro de la historia de la empresa y también dentro de las distintas áreas en que fue dividido el análisis del aporte italiano a la cultura argentina a través de los años. Para la investigación y el relevamiento de la historia de Fiat se contó con la inestimable colaboración de Carlos Figueras, Director de Motorpress, quien es uno de los periodistas y editores más reconocidos en el ámbito de la industria automotriz. Figueras, además, aportó fotos inéditas de su archivo personal. Los diferentes capítulos referidos al aporte italiano al desarrollo cultural argentino estuvieron a cargo de reconocidos especialistas, de acuerdo al siguiente detalle: La experiencia de los inmigrantes italianos en la argentina -­ Fernando J. Devoto Los inmigrantes italianos y la industrialización (1810-­1980) -­ Bernardo Kosacoff y Guillermo Ondarts El talento italiano en la epopeya del tango -­ Horacio Ferrer Los italianos y nuestro lunfardo -­ José Gobello y Marcelo H. Oliveri Presencia e influencia italiana en la gastronomía argentina -­ Fernando Vidal Buzzi Aportes italianos al teatro argentino -­ Ernesto Schoo La influencia italiana en la literatura argentina -­ Mempo Giardinelli El arte de los italianos en la argentina -­ Laura Buccellato Arquitectos italianos en la construcción del país -­ Jorge D. Tartarini El desarrollo de la obra insumió 4 meses de investigación y redacción, 1 mes de diseño y similar tiempo de impresión. La publicación llegó a manos de Fiat a fines de Noviembre y principios de Diciembre de 2009, momento a partir del cual la empresa comenzó a distribuirlo como obsequio institucional. La tirada total fue de 5.000 ejemplares. Etapas en la realización de la publicación Investigación histórico documental (Duración: 2 meses) ‡ Relevamiento de material edito e inédito, escrito, gráfico y fotográfico ‡ Entrevistas a referentes calificados (antiguos profesionales, técnicos y operarios de Fiat) Redacción preliminar (Duración: 1 mes) ‡ Ajuste y definición de la estructura de contenido. Redacción de originales. Verificación de fuentes y compaginación de entrevistas. Armado preliminar de textos y selección de imágenes. Redacción definitiva (Duración: 1 mes) ‡ Elaboración definitiva de textos, epígrafes, bibliografía y definición de imágenes. Diseño gráfico (Duración: 1 mes) ‡ Definición de la estructura de la pieza, la grilla constructiva y el diseño de página. ‡ Digitalización y retoque de las imágenes de calidad y soportes variados Corrección (Duración: 1 mes) ‡ Conformación de un grupo de referentes internos y autoridades de la empresa, que validó los contenidos de la publicación, contribuyendo así con el rigor documental. ‡ Contratación de una correctora externa para que observara de manera integral la pieza, asegurando de este modo la calidad gráfica y editorial. Esta corrección contempló: ortografía, gramática, sintaxis y diseño editorial. Impresión (Duración: 1 mes) Se imprimieron 5.000 ejemplares en formato vertical de 22 x 32 cm, de 280 páginas. El interior se imprimió a 4 colores más barniz y se utilizó papel ilustración mate de 170 g. Se realizó en tapa dura, entelada e impresa, con sobrecubierta en papel ilustración con laminado brillante. La encuadernación es cosida a hilo y pegada. Para su presentación se desarrolló una caja contenedora, que mostraba en un contexto general el contenido del libro. En el área de diseño intervinieron 3 personas, 2 diseñadores y 1 fotocromista. Se eligió una tipografía contemporánea, la Thesis de Lucas de Groot, que nos permitió desarrollar la parte de autores en su versión de palo seco y la historia de Fiat en la versión Serif. A su vez se optó por darle mayor presencia cromática a la historia de la empresa, de esa manera resulta más sencillo para el lector comprender dónde está situado. Era necesario encontrar un recurso gráfico para destacar 4 hitos de Fiat, que fueron resueltos a partir de desarrollar 4 trípticos desplegables, uno en cada capítulo. Por último y no menos importante, fue fundamental el trabajo de un fotocromista para encontrar la manera de homogeneizar gráficamente las más de 450 imágenes que provinieron de diversas fuentes. Difusión ‡ Distribución de ejemplares a través de un mailing que contemplaba los distintos ámbitos de interés. ‡ Envío de información a la prensa. ‡ Entrega del libro a instituciones culturales, educativas, sociales, cámaras, ONGs, archivos históricos, entidades gubernamentales, etc. Evaluación La concreción de este trabajo, especialmente la investigación realizada a partir de la recopilación de testimonios inéditos, permitió reconstruir un capítulo de la historia de la empresa y la de los italianos en nuestro país. También este trabajo logró posicionar a la compañía como protectora del patrimonio ítalo-­
argentino y difusor de la cultura. El reconocer y destacar el aporte italiano en el desarrollo de nuestro país, como se materializó en esta publicación, permite a las próximas generaciones de argentinos, tender un puente histórico entre sus raíces y su actual idiosincrasia, de esta manera el homenaje de Fiat en sus 90 años logró el reconocimiento de medios de comunicación y de personalidades que han recibido este libro cumpliendo así el objetivo de convertirse en testimonio de una etapa fundamental de la historia de nuestro país. PREMIOS EIKON 2010 Categoría: Publicaciones Institucionales Caso: 1908-­ 2008: Los primeros 100 años de Deloitte en la Argentina Empresa: Deloitte Integrantes: Por Deloitte: Carlos A. Haehnel;; Sergio Berensztein;; Luis Secco;; Diana Saiegh;; Esteban Aranda;; Lucrecia Palacios Hidalgo;; Ma. Belén Olaiz;; Álvaro Villagrán;; Cecilia Lebrero;; Ma. Belén Olaiz;; Juan Cavallero;; Juan Cavallero;; Agustín Haehnel;; Ma. Laura Badauka;; Jorge Burgos;; Virginia Gatti;; Fernando Haehnel;; Alejandra Linares;; Liliana Mereles y Adriana Sotelo. El libro de los 100 años de Deloitte en la Argentina: El legado de una tradición Introducción 100 años no se cumplen todos los días Deloitte Touche Tohmatsu (DTT) es una organización dedicada a prestar servicios profesionales y de asesoramiento con la excelencia como diferencial, con una estrategia global ejecutada localmente en cada una de sus oficinas alrededor del mundo. Actualmente, brinda servicios en cuatro áreas profesionales: Auditoría, Impuestos, Consultoría y Corporate Finance. Las Firmas miembro atienden a más del 80 por ciento de las compañías que integran el Ranking Fortune Global 500. Hoy DTT está integrada por Firmas miembro que operan en 140 países y emplean a 165.000 personas aproximadamente. En 1908 Deloitte fue la primera organización internacional de servicios profesionales en radicarse en el país. Buenos Aires fue la segunda ciudad, después de Nueva York, donde Deloitte abrió sus puertas. Así, la cantidad de miembros ha crecido en forma continua a través de los años, acompañando el desarrollo de los clientes. A fin de satisfacer y superar las expectativas de los clientes, DTT ofrece servicios de calidad en todo el mundo. Por ello, todas sus oficinas han adoptado políticas, metodologías y programas de entrenamiento que son diseñados, promulgados y controlados a nivel internacional. De esta manera DTT puede brindar a los clientes que operan en forma global, servicios de altísima calidad en todos los lugares en los que éstos se encuentren establecidos. Este enfoque y compromiso, combinado con la extensa red mundial de oficinas, garantiza a los clientes que reciban un servicio de idéntica calidad en todo momento y lugar. En Argentina cuenta con más de 1900 profesionales repartidos en las oficinas de Buenos Aires, Córdoba, Mendoza y Rosario, quienes brindan servicios a las principales empresas locales e internacionales que operan en el país. Mantiene una posición de liderazgo en la prestación de servicios a clientes en los sectores del papel, agropecuario, agroindustrial, generación y distribución de energía eléctrica, petróleo y gas, industrias automotriz, petroquímica, láctea, de neumáticos y salud, medios, telecomunicaciones, y servicios financieros, así como también a empresas y organismos del sector público. A partir del 1° de junio de 2005 las oficinas de Argentina, Bolivia, Colombia, Costa Rica, Ecuador, El Salvador, Guatemala, Nicaragua, Honduras, Panamá, Paraguay, Perú, República Dominicana, Uruguay, Venezuela pasaron a formar una sola Firma: Deloitte LATCO (Latin American Countries Organization) Bajo esta nueva organización, las Firmas locales se unificaron alienando estrategias a través de la región, expandiendo sus capacidades de servicio y compartiendo recursos humanos y tecnológicos para satisfacer las necesidades de los clientes, generando mayores oportunidades para la Firma local y expandiendo el horizonte de la carrera profesional de su gente. En este contexto, escribir un libro sobre el centenario de Deloitte en la Argentina no fue una acción más de marketing o comunicación. El motivo que impulsó a que se llevara a cabo este enorme proyecto fue homenajear a todas aquellas generaciones de hombres y mujeres que, a través de su trabajo y compromiso, lograron construir una empresa con 100 años de existencia ininterrumpida en el país. 1908-­ 2008: Los primeros 100 años de Deloitte en la Argentina, es el resultado del esfuerzo de un grupo de personas que sintieron que los 100 años de vida de la Firma no podían pasar desapercibos en la historia de la empresa y de nuestro país. El libro representa un recorrido de la historia de la firma y de la Argentina desde que se instaló en Buenos Aires, aquel 30 de noviembre de 1908. Allí se relatan los principales acontecimientos económicos, políticos, sociales y culturales desde ese año hasta 2008. Según las palabras de sus autores, Sergio Berensztein-­ doctor en Ciencias Políticas, consultor y analista político-­ y Luis Secco-­ economista, analista económico y director de la Firma-­VHKDTXHULGR³HVFULELUXQOLEURTXH no se transforme en un lamento del SDtVTXHQRIXHVLQRHQXQUHODWRGHFyPRKHPRVOOHJDGRDOSDtVTXHHV´ ³&RPR ODV DJXDV GH XQ UtR TXH VLHQGR VLHPSUH GLVWLQWDV FRQVHUYDQ VLHPSUH OD LGHQWLGDG GHO PLVPR
Deloitte es un gran cauce por el que han discurrido muchas generaciones de profesionales a través de este DxRV´ &yPR XQD )LUPD LQWHUQDFLRQDO SXGR OOHJDU D SHUGXUDU \ FUHFHU VRVWHQLEOHPHQWH GXUDQWH HO
correr del tiempo, teniendo en cuenta lo compleja e inestable que es la economía de nuestro país, es uno de los interrogantes que el lector se plantea a lo largo de la lectura del libro. Ejecución del plan Conocer los orígenes para fortalecerse en el futuro El 30 de noviembre de 2008 Deloitte cumplió 100 años en la Argentina. Dado que no son tantas las empresas que cuentan con esta continuidad y permanencia en el país, se buscó, a través del libro, destacar y compartir con la comunidad, los cambios, los éxitos y el crecimiento a lo largo de estos años de trayectoria. Todo comenzó cuando, un año antes de festejarse el centenario de la compañía, Carlos A. Haehnel, CEO GH 'HORLWWH $UJHQWLQD \ /$7&2 WXYR XQ VHQWLPLHQWR PX\ SDUWLFXODU GH ³DVRPEUR \ DJUDGHFLPLHQWR´ DO
advertir la gran cantidad tiempo que llevaba trabajando la firma que él comandaba. Por este motivo, decimos que escribir un libro sobre el centenario de la Firma no fue una acción más de marketing o comunicación. En este sentido, la meta que condujo el trabajo del equipo de profesionales responsables de la realización del proyecto, no fue solo la creación de un texto documental que describiera los hechos más significativos que marcaron la historia de nuestro país, sino que intentaron plasmar los sentimientos de hombres y mujeres que a través de su labor construyeron lo que hoy es Deloitte Argentina, además de dejar un legado para las próximas generaciones de empleados. Descripción de los pasos y procesos: La idea original de escribir un libro que homenajeara los 100 primeros años de Deloitte en la Argentina fue de Carlos A. Haehnel, quien junto con los autores, Luis Secco y Sergio Berensztein, se reunieron para pensar cómo iba a estar narrado el libro. Teniendo en cuenta que la historia de la Firma es a la vez un producto de un ámbito más amplio que el de la comunidad de pioneros que lo construyeron y está inserto en las estructuras político-­ económicas de un país que le exceden pero que funcionaron como ingredientes fundamentales para su crecimiento y desarrollo, se decidió recrear la historia de la Empresa contextualizada con los hechos más relevantes de la historia de nuestro país de 1908 a 2008. Además de los autores, quienes definieron el esqueleto del libro al desarrollar el texto, el proyecto fue posible gracias al esfuerzo conjunto de un grupo importante de personas como Diana Saiegh, quien a través de la coordinación editorial y por su experiencia en el arte, contribuyó a convertir una gran cantidad de ideas en imágenes concretas, aportando al mismo tiempo una estética que forma parte del estilo definido a lo largo de todo el libro. En este punto también fue clave el arte de Juan Cavallero, quien diseñó con talento y minusiocidad página por página. También fue muy importante la labor de investigación, para dar consistencia fáctica a nada menos que cien años de historia argentina e internacional, y la investigación gráfica, la cual tuvo que resumir lo anterior en imágenes concretas, confiriendo al relato una lectura más amena. La realización del libro también contribuyó a: -­ Reforzar el sentido de pertenencia de todos los miembros de la Firma y generar motivación y orgullo por trabajar en una compañía de tan alto nivel de competencia profesional. -­ Dar a conocer al target objetivo el año del centenario de Deloitte, posicionándola como una Firma que, además de su permanencia en el mercado, ha logrado también conservar su posición de liderazgo durante tantos años. -­ Incrementar la visibilidad de la compañía externamente. El proceso de elaboración del libro tuvo una duración de unos largos siete meses aproximadamente y el obstáculo mayor que tuvo que sortear el equipo de trabajo fue la recolección de datos, historias y fotos de los primeros años de la Firma, así como también la incertidumbre que se le planteó a los autores de si sería posible completar un relato de los últimos 100 años de la historia de nuestro país en tan poco tiempo. La estrategia de trabajo que se planteó para desarrollar el proyecto fue la creación de un equipo interdisciplinario de profesionales que trabajara de forma integrada, manteniendo una constante interacción entre los distintos participantes del mismo, con el fin de combinar, en forma armónica, el texto, las imágenes y el diseño gráfico, componentes fundamentales del Libro. Para esto se utilizó como disparador para definir el espacio de desarrollo, el borrador del texto escrito por los coautores. Por último, se pensó como concepto editorial del libro que éste fuera moderno y que contuviera fotografías e imágenes de altísima calidad que ilustraran los textos, y artículos sencillos pero profundos para hacer amena la lectura. El libro: )LQDOPHQWH HOOLEUR ³-­ /RVSULPHURVDxRVGH'HORLWWHHQOD$UJHQWLQD´TXHGyFRQIRUPDGR
como un documento de excelencia, con 160 páginas de 30 cm x 30 cm, protegidas por una tapa y contratapa de color negro, y con diecisiete capítulos y más de ocho subcapítulos que describen la historia de Deloitte inscripta en la historia de nuestro país, además de alguna mención al contexto internacional, plasmados con imágenes del archivo fotográfico de la Editorial Perfil, puestas a disposición por Jorge Fontevecchia, además de gráficos, tablas, cuadros e ilustraciones, que hacen de este ejemplar una verdadera obra de colección. 8QHMHPSORGHORVFDStWXORVTXHVHHQFXHQWUDQHQHOOLEURVRQ³/RVSLRQHURV´LOXVWUDGRFRQXQDUeliquia IRWRJUiILFD GH ORV VRFLRV IXQGDGRUHV HQ ³/D $UJHQWLQD GH OD FULVLV VXV FRPLHQ]RV´ HQ GRQGH VH
SXHGH YHU HQ GHWDOOH OD REUD ³0DQLIHVWDFLyQ´ GHO WDOHQWRVtVLPR GRFXPHQWDOLVWD \ DUWLVWD SOiVWLFR
$QWRQLR %HUQL ³'HORLWWH HQ HO ,QWHULRU´ donde se cuenta de manera breve la historia de las tres oficinas TXH OD )LUPD WLHQH HQ ODV FLXGDGHV GH 5RVDULR &yUGRED \ 0HQGR]D \ ³3ODWD 'XOFH´ HQWUH RWURV FXHQWD
con un prólogo y epílogo del CEO que invita e introduce al lector, quizás ajeno a la historia de Deloitte, a un viaje en el tiempo y a la intimidad de la Firma. También se incluyó la invitación a la apertura de la oficina, firmada en noviembre de 1908, otra joya histórica que el libro comparte a sus lectores. 3DUDPDQWHQHUHOHVStULWXGH³KRPHQDMH\OHJDGRKLVWyULFR´FRQTXHIXHSHQVDGRVHUHVROYLyTXHHOOLEUR
no se pusiera a la venta, ya que ningún valor económico podría representar el sentimiento descripto en cada página, y para conservar su originalidad y exclusividad como ópera prima de la Firma, se decidió que el ejemplar tenga una edición limitada. Una vez ingresado el libro a la imprenta, el equipo de comunicación de Deloitte ideó la estrategia para dar a conocer, a los diferentes públicos targets a los que se quería llegar, el lanzamiento de la obra documental, teniendo en cuenta los diferentes canales y estilos de mensaje que caracterizaba a cada uno de ellos. En este sentido, se podría decir que la creación del libro no sólo fue pensado para compartir con la comunidad Deloitte (sus clientes, proveedores, sus socios y empleados) sino también para la comunidad en general: Sector público, académicos, empresarios, opinión pública, formadores de opinión y periodistas. Los canales de comunicación que se utilizaron para anunciar el lanzamiento e invitar a los empleados argentinos a la presentación del libro fueron: digitales, como comunicados por e-­mail y Deloitte TV (plasmas en las recepciones de las oficinas);; y gráficos, en las carteleras de noticias, ubicadas en lugares estratégicos de esparcimiento en las oficinas. (ver anexo) La comunicación de la noticia al resto de la comunidad internacional de Deloitte se hizo a través del Newsletter regional, Somos LATCO (Revista interna de toda la Región de América Latina) y la Intranet a la cual tienen acceso los 140.000 profesionales de la Firma. La comunicación a los públicos externos se llevó a cabo a través de la distribución y difusión de gacetillas, que se enviaron a la prensa gráfica, radial, televisiva y digital local, y con la mención del acontecimiento en notas y entrevistas que se le realizaron al CEO de la Firma. También se publicó la noticia en la página Web de la firma. La presentación del libro en sociedad: La presentación del libro en sociedad merece un capítulo a aparte. Convencidos de que la publicación del libro se convertiría en un hito en la historia de la firma, se realizó un evento acorde a la relevancia de tal acontecimiento: se invitó a los socios, empleados, clientes y proveedores, empresarios, académicos, miembros de la cultura y funcionarios públicos a la Biblioteca Nacional para presenciar una mesa-­debate con los autores del libro, el Director de la biblioteca, Horacio González, y Carlos A. Haehnel. Para la convocatoria al evento se creó un listado especial con más de cuatrocientos contactos, los cuales asistieron más de la mitad. La invitación les llegó vía e-­mail con un mensaje de Carlos A. Haehnel, y además se realizó un Follow up telefónico. El encuentro se llevó a cabo el lunes 6 de octubre a las 19:00 en el Auditorio Jorge Luis Borges de la Biblioteca Nacional, el cual fue ambientado especialmente. Luego del acto todos los presentes compartieron un vino de honor con los autores. Allí también se repartieron ejemplares a modo de recuerdo. También se repartió el libro como souvenir en el cóctel que se realizó en el Hotel Alvear con motivo del festejo del centenario de la firma, al que asistieron alrededor de 1000 invitados de los sectores más relevantes del país. Además se donaron ejemplares a varias bibliotecas públicas del país, colegios y embajadas. Asimismo, a oficinas internacionales de Deloitte como Madrid, New York y a todas las oficinas del cluster latinoamericano. Evaluación A la hora de hacer un balance acerca de los beneficios y resultados por la creación y lanzamiento del libro de los 100 primeros años de la Firma en la Argentina, los resultados obtenidos fueron sumamente positivos y superaron ampliamente las expectativas: todos los objetivos planteados fueron desarrollados con éxito. El libro logró plasmar a la perfección la evolución y desarrollo de aquella Firma en la que un grupo de profesionales, visionarios y aventureros ingleses apostó en 1908 y que hoy cuenta con 1900 empleados y más de 100 años de vida. Por otro lado, se repartieron más de 1500 ejemplares a personalidades de los sectores más relevantes del país, incluyendo a bibliotecas públicas. La cobertura mediática también superó nuestras expectativas en cuanto a la cantidad de apariciones y a la diversidad en el canal de comunicación ya que formadores de opinión y periodistas de los medios más influyentes del país, que asistieron a la presentación del libro, al coctel del Hotel Alvear, o recibieron un ejemplar por correo, luego publicaron y emitieron notas y entrevistas en medios como La Nación, Clarín, La Razón, Revista Fortuna, Prensa Económica, Radio América, Radio El Mundo y Canal Metro. Además, a lo largo de todo el año del centenario la Firma recibió placas de felicitaciones varias empresas e instituciones. (ver anexo) Por último, estamos convencidos que la creación del libro sobre los primeros años de la Firma es más que la documentación y recopilación de datos históricos. Se trata, de algún modo, de inmortalizar un pasado, de hacer trascender los valores, los sueños, la historia y el esfuerzo de quienes hicieron que esta organización internacional perdure en el tiempo y siga creciendo. El valor que tiene el libro para la Firma es que constituye un testimonio viviente de un camino recorrido, con sus aciertos y tropiezos. Como sLQWHWL]D &DUORV $ +DHKQHO DO ILQDO HO OLEUR ³/D KLVWRULD GH 'HORLWWH
como la de nuestras familias, es la historia de la búsqueda y la realización de las oportunidades que ha ofrecido y todavía nos ofrece la Argentina. Es la historia de un deseo de superación constante y es, en definitiva, la historia de un grupo de personas que a lo largo de estos 100 años han buscado SHUPDQHQWHPHQWHFDGDXQRGHVGHVXOXJDUFRQWULEXLUDOSURJUHVRGHQXHVWUD1DFLyQ´ PREMIOS EIKON 2010 Categoría: Publicaciones Institucionales Caso: Reporte de Sustentabilidad 2009 Empresa: Kimberly-­Clark Integrantes: Por Kimberly-­Clark: Fernando Hofmann, Director de Asuntos Legales y Corporativos de Kimberly-­Clark Región Austral;; Carolina Scarampi, Jefa de Asuntos Corporativos de Kimberly-­Clark Argentina, Uruguay y Paraguay;; y María Laura Salina, Asistente de Asuntos Corporativos de Kimberly-­Clark Introducción Acerca de Kimberly-­Clark Kimberly-­Clark es reconocida en el mundo como la empresa líder en el desarrollo de productos descDUWDEOHV SDUD OD VDOXG OD KLJLHQH \ HO FXLGDGR SHUVRQDO FRQ PDUFDV FRPR +XJJLHV .OHHQH[ 'D\¶V
Scott, Depend Plenitud, Pull-­XSV *RRGQLWHV /LWWOH 6ZLPPHUV /LJKW 'D\¶V /LQD \ .LPEHUO\-­Clark Professional, entre otras. La compañía fue fundada por John Kimberly, Charles Clark, Frank Shattuck y Havilah Babcock en 1872, en Neenah, Wisconsin. Actualmente, Kimberly-­Clark cuenta con un equipo de trabajo de más de 55,000 empleados alrededor del mundo, con centros de producción en 37 países y puntos de venta en más de 150 países. Desde sus comienzos, la innovación fue el eje central del éxito de Kimberly-­Clark. La compañía se ha caracterizado históricamente por desarrollar productos que generaron grandes revoluciones en el mercado de consumo masivo creando categorías totalmente nuevas, en todos los países y en todas las épocas. Todos los días, una de cada cuatro personas alrededor del mundo confía en los productos Kimberly-­Clark para el cuidado de su salud, higiene y bienestar. Kimberly-­Clark Argentina Kimberly-­Clark Argentina comenzó sus operaciones en el país a principios de los años noventa. A mediados de esta década, la compañía comenzó su etapa de crecimiento y expansión a través de la adquisición del paquete accionario de Descartables Argentinos S.A. y otras compañías representantes del sector. En sus 16 años de gestión en la Argentina, Kimberly-­Clark se afianzó como líder en el desarrollo de productos para la higiene y la salud de los individuos dentro del mercado de consumo masivo. El comienzo de sus operaciones significó una de las primeras grandes inversiones de capitales norteamericanos en el país durante esa década. Kimberly-­Clark contribuye al desarrollo económico y social del país. Emplea a más de 1.200 personas y cuenta con oficinas centrales en la Ciudad Autónoma de Buenos Aires. Sus 3 plantas de producción son tomadas como modelo en todo el mundo: poseen tecnologías innovadoras que permiten a la filial local no sólo abastecer al mercado interno sino exportar sus productos a otros países de la región Latinoamericana. En su planta de Pilar (Pcia. de Buenos Aires) produce toallas y protectores femeninos, al igual que apósitos para incontinencia femenina. Cuenta con maquinarias de alta tecnología y recicla casi su totalidad de los residuos generados durante el proceso productivo. En su planta de Bernal (Pcia. de Buenos Aires) fabrica pañuelos descartables, servilletas, papel higiénico y rollos de cocina. En su planta de San Luis fabrica pañales para bebes y pañales para adultos. Es el primer empleador de la provincia, es la sexta planta más grande del mundo en producción de pañales y la primera en Latinoamérica. Cuenta además con el Centro GH'LVWULEXFLyQ³$LUHVGHO6XU´HQODORFDOLGDGGH(VWHEDQ(FKHYHUUtDSURYLQFLDGH%XHQRV$LUHV Sustentabilidad Kimberly-­Clark es una compañía comprometida con todos sus públicos desde sus comienzos. Su visión integral de empresa socialmente responsable atraviesa todo el negocio y abarca sus valores, las políticas de Recursos Humanos, la definición y cumplimiento del Código de Conducta, el compromiso con la calidad de los productos que desarrolla, la implementación de políticas de seguridad, la responsabilidad con el medio ambiente, la ética con los proveedores, las normas legales y el Plan de Acciones con la Comunidad. Kimberly-­Clark entiende este concepto como un modelo de gestión del negocio. La gestión socialmente responsable se convierte en parte de las estrategias de negocios y del sistema de planeamiento interno de la organización, dando como resultaGR HO VXUJLPLHQWR GH XQD YHUGDGHUD ³FXOWXUD GH OD UHVSRQVDELOLGDG
VRFLDOHPSUHVDULDO´ Dentro de las acciones desarrolladas en el marco de su estrategia de RSE, la empresa presentó en 2010 su segundo Reporte de Sustentabilidad, correspondiente a 2009. Kimberly-­Clark entiende que una empresa socialmente responsable debe rendir cuenta ante sus grupos de interés -­ stakeholders-­ sobre sus operaciones y su desempeño organizacional en función de los objetivos de desarrollo sustentable. A través de esta publicación, la empresa comunica cómo es capaz de poner en práctica una visión de negocios que genera valor económico, agrega valor social y contempla el cuidado del medio ambiente. El proceso de elaboración del Reporte de Sustentabilidad se desarrolló entre los meses de noviembre de 2009 y junio de 2010 y tuvo como objetivos: Desarrollar una pieza de comunicación que permita informar sobre la gestión responsable y sustentable del negocio, considerando los temas de mayor relevancia y materialidad para los grupos de interés de la empresa. Posicionar a Kimberly-­Clark como una compañía líder en Argentina en materia de sustentabilidad. Instalar internamente el Reporte de Sustentabilidad como una herramienta de comunicación, gestión y evaluación sobre la aplicación de políticas y actividades de RSE de Kimberly-­Clark. Por definición, un Reporte de Sustentabilidad está dirigido a todos los grupos de interés de la empresa. En el caso de Kimberly-­Clark, se identificaron los siguientes grupos de interés: El plan de trabajo del Reporte de Sustentabilidad incluye también una etapa de comunicación -­detallada a continuación-­ con el objetivo de lograr una mayor difusión y comprensión entre de sus grupos de interés sobre el trabajo integral de RSE desarrollado por la empresa. Kimberly-­Clark sostiene el principio de Comunicación Responsable tanto en la comunicación interna como externa como práctica integrada a la Responsabilidad Social Empresaria, buscando transmitir valores éticos. La compañía está adherida y tiene una participación activa en la Cámara Argentina de Anunciantes y en el Consejo de Autorregulación Publicitaria, del cual incluso su Director de Asuntos Legales y Corporativos forma parte, para contribuir responsable y sostenidamente a extender estos valores al resto de la sociedad. Desde este marco conceptual se encara la comunicación del Reporte, con el objetivo principal de contribuir al establecimiento de una agenda de RSE y de aumentar la conciencia sobre los temas de valor social y ambiental. Sin duda, la comunicación creíble y transparente de las principales actuaciones de Kimberly-­
Clark en RSE impactará en la reputación de la empresa. Este resultado sólo es aceptable si es la consecuencia natural de un proceso de Comunicación Responsable. Ejecución del plan El plan de trabajo se dividió en cinco etapas: Preparación interna: La importancia de esta etapa radicó en lograr el compromiso de los distintos actores internos que participaron a lo largo del proceso de elaboración del reporte, así como la identificación de las instancias de mejora respecto el primer reporte de la empresa. En este sentido, se propuso como desafíos del Reporte 2009, diseñar un set de indicadores de desempeño material que sirva de base para reportar los próximos años así como incorporar más cantidad de datos duros que respalden las políticas y prácticas corporativas. Las tareas de esta etapa incluyeron: Presentación del cronograma de trabajo Definición de las áreas clave para el relevamiento de información. Análisis del Reporte de Sustentabilidad de Kimberly-­Clark-­ Casa Matriz y del Reporte local correspondiente a 2008. Elaboración de una propuesta de trabajo con las mejoras propuestas a la nueva edición. Definición de los contenidos y calidad del reporte. Este es uno de los pasos clave de esta instancia. Se realiza en base a los siguientes criterios establecidos por los lineamientos G3 de Global Reporting Initiative (www.globalreporting.org). Relevamiento de información: el esfuerzo de esta etapa se centró en la recopilación de la información e indicadores de desempeño necesarios para la redacción del reporte, a través de los siguientes pasos: Recopilación de la información: a través de distintas herramientas -­cuestionarios, entrevistas, análisis de información corporativa, etc.-­ se relevan los datos necesarios para la redacción del reporte. Distribución interna de las Tablas GRI G3 con los indicadores a relevar y, en caso que corresponda, los protocolos correspondientes. Redacción y edición del reporte: en esta instancia se procesó toda la información relevada, se estructuraron los contenidos, la tabla de contenidos GRI G3 y se elaboró el documento final. Se siguieron los siguientes pasos: Redacción de los contenidos de la versión preliminar. Aprobación de contenidos: Distribución a cada una de las áreas para la aprobación de los contenidos correspondientes a la órbita de su gestión. Incorporación de modificaciones: se procesó el feedback recibido por parte de las áreas involucradas en el proceso de trabajo. Elaboración de la versión final del reporte Elaboración Tabla GRI G3 con indicación de secciones del Reporte. Verificación externa a cargo de la consultora PricewaterhouseCoopers. Comunicación: esta última instancia se centró en la elección de alternativas de difusión y comunicación para llegar más efectivamente a los grupos de interés de la empresa con el objetivo de contribuir al posicionamiento de Kimberly-­Clark como una empresa líder en Argentina en materia de sustentabilidad. Las tareas desarrolladas incluyeron: Selección de opciones de soporte y su respectivo diseño: se optó por desarrollar una versión impresa y otra digital. La imagen elegida para anclar todo el diseño es un faro ya que, metafóricamente, es la que mejor representa el accionar de Kimberly-­Clark. La transparencia de su trayectoria se refleja, después de 15 años de permanencia y continuo crecimiento en el país, en la calidad de sus productos;; y su visión empresarial trasciende el crecimiento económico de la compañía. Su actividad genera empleo y su producción industrial supera los parámetros establecidos en el mercado, influenciando notablemente en la calidad de vida de los argentinos. Kimberly se presenta así como una empresa social y ambientalmente responsable, que por liderazgo y actitud proyecta el camino a seguir. Armado del plan de comunicaciones externas e internas. Diseño e impresión. Comunicación y difusión: envío a empresas líderes, a ONGs, periodistas del tercer sector y especialistas en responsabilidad social e imagen corporativa. Evaluación/pruebas La publicación del reporte cuenta con dos instancias de evaluación. En primer lugar, el proceso de elaboración del Reporte de Sustentabilidad de Kimberly-­ Clark cuenta con la clasificación C+ de Global Reporting Initiative, avalada por la verificación externa realizada por la empresa PricewaterhouseCoopers. Los procedimientos aplicados para la realización del trabajo de verificación han consistido en: Comprobar que los contenidos básicos recomendados por la Guía para la elaboración de memorias de sostenibilidad del Global Reporting Initiative (GRI), versión 3.0 han sido efectivamente incluidos en el ³5HSRUWHGH6XVWHQWDELOLGDG´ Desarrollar entrevistas con el personal de Kimberly-­Clark Argentina responsable de la recopilación de la información y elaboración de los indicadores objeto de la revisión. Revisar la documentación soporte utilizada para calcular y entrega la información por parte de Kimberly-­Clark Argentina en relación a los indicadores objeto de esta verificación. En base al trabajo realizado, PricewaterhouseCoopers concluyó que: (O ³5HSRUWH GH 6XVWHQWDELOLGDG ´ LQFOX\H ORV FRQWHQLGRV EiVLFRV UHFRPHQGDGRV SRU OD *XtD
para la elaboración de memorias de sostenibilidad del Global Reporting Initiative (GRI) versión 3.0, para el nivel de aplicación C+, de acuerdo a la autodeclaración realizada por Kimberly-­Clark Argentina. Los procedimientos y controles establecidos a los efectos de preparación, recolección y consolidación de los datos relativos a los indicadores objeto de la revisión proporcionan una base razonable para la obtención de los mismos. No se han identificado desvíos significativos en lo que respecta a la razonabilidad y consistencia de los valores de los indicadores objeto de la revisión. En segunda instancia, se ha diseñado una encuesta telefónica para recibir una evaluación de parte de los lectores del reporte sobre los siguientes puntos: puntos: Grado de interés sobre los contenidos Extensión del reporte Claridad y relevancia de la información presentada Temas de mayor interés Consistencia entre la información presentada y el compromiso con la sustentabilidad de la empresa Aspectos a mejorar La encuesta se realizará durante el mes de julio/agosto, motivo por el cual no es posible incluir resultados en esta presentación. PREMIOS EIKON 2010 Categoría: Publicaciones Institucionales (Regional) Caso: Revista Access DIRECTV Latinoamérica Empresa: DIRECTV Agencia de PR HT Contenidos Integrantes: Por DIRECTV: Director Regional: Roberto Valerio;; Directora Editorial: María José Acuña Fuentes;; Directores Argentina: Guillermo Delfino y Fernando Straminsky. Por HT Contenidos: Juan Frenkel y Gonzalo Alvarez Guerrero. Introducción La revista ACCESS DIRECTV funciona, desde noviembre de 2008, cuando se publicó su primer número, como una carta de presentación de DIRECTV en Latinoamérica ante suscriptores, clientes y potenciales clientes. De frecuencia mensual y disponible actualmente en seis versiones diferentes (Chile, Argentina, Ecuador, Venezuela, Perú y Colombia), establece un vínculo efectivo entre ellos y la empresa. No es una una simple guía de canales de promoción de la grilla televisiva, sino que desde el principio se planteó un desafío mucho más ambicioso: convertirse en una revista que pueda competir en información, fotografías y exclusivas con cualquier otra publicación de entretenimiento. El objetivo aspiracional de ACCESS DIRECTV es reflejar la calidad, variedad y el nivel de servicios de DIRECTV. Con un estilo moderno y actual, amplifica la experiencia televisiva de los lectores y les muestra lo que hay detrás de la pantalla, potenciando el capital de DIRECTV como especialista en televisión. Los temas que aborda, de acuerdo a un estudio etnográfico sobre los interéses de sus sucriptores, son series, deportes, cine, cultura y tendencias. Tras 20 ediciones ya publicadas, ACCESS DIRECTV consolidó su propuesta inicial e impactó en las preferencias de los clientes de DIRECTV, quienes, de manera voluntaria, solicitan suscribirse a la publicación. El detalle de que sea de compra opcional y no de entrega forzada demuestra la confianza de la compañía en el producto y el trabajo por convertirla en una publicación verdaderamente competitiva. Hoy, ACCESS DIRECTV es una publicación regional de categoría premium que no tiene competencia en el mercado de las revistas de TV paga en Latinoamérica, ni tampoco entre las publicaciones de entretenimiento. Acerca de DIRECTV DIRECTV Latinoamérica es el proveedor de televisión satelital líder en toda Latinoamérica y el Caribe, con la mejor experiencia de televisión llegando a más de 5.8 millones de clientes. Por medio de una combinación de contenido, tecnología y calidad de servicio, DIRECTV simplemente marca el estándar en entretenimiento. Con la mayor cobertura de contenido en Alta Definición en Latinoamérica, más de 180 canales 100% GLJLWDOHV GLVSRQLEOHV YDQJXDUGLD HQ SURGXFWRV GH JUDEDFLyQ FRPR ',5(&79 3OXVŒ el servicio de HQWUHWHQLPLHQWR DO LQVWDQWH ',5(&79 RQ '(0$1'Œ OD PHMRU FREHUWXUD GH GHSRUWHV OD PiV LQQRYDGRUD
tecnología interactiva y mucho más, DIRECTV es el líder la región. Primeros pasos de ACCESS DIRECTV El trabajo comenzó un año antes del lanzamiento. DIRECTV realizó encuestas telefónicas, por mail y etnográficas en seis países: Chile, Perú, Argentina, Colombia, Puerto Rico y Venezuela. Los resultados mostraron que la mayoría de los usuarios de la señal estaban interesados en conocer más sobre lo que veían en pantalla. Es decir, tenían apetito de más televisión. El paso siguiente fue hacer un benchmark con la revista ACCESS USA. A partir de este análisis, se decidió adoptar para la revista regional sus mejores atributos, en especial los relacionados con el look & feel: la sofisticación en el diseño, la calidad visual y preponderancia de imágenes cercanas y cálidas. Al margen de esta instancia de análisis y comparación, hubo un amplio margen para desplegar la creatividad en la versión latinoamericana, que incluyó desde surgimiento de nuevas secciones hasta acuerdos de provisión de contenidos como el que se estableció con El Gráfico para todo el material deportivo de la revista. La conformación del equipo de trabajo fue otro de los pasos en este camino previo al lanzamiento. Se armó una suerte de redacción mixta y flexible, compuesta por colaboradores de DIRECTV (integrantes del Comité Editorial), una editorial centralizadora (Ocho Libros de Chile), agencias de comunicación externas locales para cada país (HT Contenidos en la Argentina) y un staff de corresponsales en las principales ciudades asociadas al gran espectáculo como Los Ángeles, Nueva York, Miami, México y países como Alemania, Inglaterra, Francia y España. La apuesta de ACCESS DIRECTV La revista apunta principalmente a un público constituido por hombres y mujeres, de entre 22 y 55 años, ABC1, C2 y con dos hijos promedio. En segundo lugar, también se dirige a niños y adolescentes influenciadores en procesos de compra. Para ello, se incluyen secciones especiales como Planeta Teens y Planeta Kids o entrevistas a ídolos adolescentes como Miley Cirus. Ante sus lectores, ACCESSDIRECTV asume el punto de vista de ESPECIALISTA, una posición que le permite: orientar y guiar al suscriptor a sacar el máximo provecho del servicio DIRECTV acercar a los suscriptores hacia el mundo de la televisión y sus historias, ampliar su experiencia televisiva. seleccionar y jerarquizar contenidos de programación con la mirada del que conoce de TV. informar desde la fuente directa tener acceso a directores, actores, deportistas, artistas, celebridades, héroes infantiles, ofreciendo información exclusiva y no lo mismo que se lee en otras revistas o diarios. jugarse por el futuro, liderar tendencias. Ejecución del plan Los desafíos fueron muchos. La puesta en marcha de un circuito efectivo de producción y edición de cada número, la creación de un Manual de Estilo unificado y la coordinación entre un equipo de trabajo muy disperso geográficamente fueron algunas de las tareas que debieron definirse previo al lanzamiento. Asimismo se estableció desde el inicio un sistema de evaluación anual, por medio del cual se analizan en detalle todas las notas y fotografías de cada una de las revistas, que promueve la mejora constante del producto. Los cambios del primer número al último publicado son notorios e incluyen desde entrevistas más logradas en el plano periodístico hasta imágenes de mayor calidad y más potentes a nivel narrativo: imágenes que cuentan una historia o presentan un personaje. El mayor reto fue alinear a seis países bajo un método de trabajo y exigencias editoriales, pues si bien todos son naciones de hablahispana, los estilos de redacción y estructuras periodísitcas varían. Además de no existir en muchos países demasiada especialización en los temas de entretenimiento planteados desde la mirada de ACCESS DIRECTV. Concepto editorial: Luego de casi dos años en el mercado de revistas de TV Paga, ACCESS DIRECTV consolidó una fórmula que la hace única y la diferencia de la competencia. Sostenida en la trilogía opinión-­glamour-­humor tiene una mirada crítica, abierta y entretenida: honestamente subjetiva, además de transversal ya que cubre todos los temas de la TV, desde la el cine y el deporte hasta tendencias y tecnología. ACCESS DIRECTV le da una vuelta a los temas para orientar al lector, congrega datos únicos y expone una voz provocativa, que da cuenta de que quienes escriben son periodistas informados, especialistas absolutos en su campo. Por otro lado, no compite con la inmediatez;; su valor agregado es la interpretación y la exposición de lo que está detrás de la pantalla. Desde su inicio también se planteó mantener un diálogo con el lector a través del editorial, las cartas y los comentarios. Se interesa por saber qué piensan de ella, qué los cautiva. La mayoría de las notas están firmadas y son escritas con una prosa fresca y cuidada por cronistas y periodistas especializados que privilegian lo narrativo. Las historias son contadas para atrapar al lector desde la primera línea, puede ser tanto a partir de una escena o como de una forma original de introducir un personaje ya conocido por los lectores. ‡ El lenguaje de ACCESS DIRECTV: suelto y coloquial, sin gravedad, profundizando los temas cálida, nunca distante, pero tampoco complaciente ágil, amigable, seductora y moderna Línea visual y fotografía: A través de su gráfica y fotografía de primer nivel, ACCESS DIRECTV reproduce en papel la imagen HD que DIRECTV tiene en pantalla. En un nivel narrativo, la línea visual comunica y complementa los contenidos, buscando el equilibrio entre texto, imagen y otros recursos de diseño. Se privilegian las tomas limpias y elegantes, contemporáneas de una forma clásica. Las entrevistas principales suelen contar con un gran fotografía de apertura ²a una o dos páginas² que acercan al personaje a los lectores y lo introducen de una manera cálida, intimista y sofisticada. En sintonía con el objetivo de la revista de mostrar el mundo detrás del cine y de la televisión, las fotografías aluden más a los retratados en su calidad de personas que de personajes y suelen presentarlos en un entorno natural más que en un estudio, reflejando así pinceladas de su vida o su personalidad. En las páginas deportivas, en tanto, se muestra a los protagonistas en movimiento, en acción;; así como sus historias. La tapa: construyendo la primera impresión Si ACCESS DIRECTV es la carta de presentación de la empresa ante suscriptores y posibles suscriptores, la tapa es la primera línea de esa carta. Su construcción, por consiguiente, es uno de las tareas que demanda más tiempo, producción e inversión de toda la publicación. Suele haber dos tipos de tapa: las asociadas con un lanzamiento importante ±una serie o una película exclusiva de algunas de las señales propias de DIRECTV² o las que incluyen un personaje que, por alguna razón, está en un buen momento de su carrera. Se busca que entre las figuras de tapa haya representantes de los universos a los que apela la revista: la televisión, el deporte, el cine, la música y que, a su vez, haya una rotación de los universos y grupos objetivos a los que se orienta reflejados en tapa. Uno de los grandes hitos de la revista ocurrió en 2009 cuando se publicó el primer especial en Deportes. Las portadas exclusivas de Maradona en Argentina y de Kaká, figura futbolística del momento, en el resto de los países, acompañaron el lanzamiento de la sección Mundial Total que un año antes de Sudáfrica 2010 dio cuenta del grado de especialización que la revista ofrece a nivel de contenidos, acceso, exclusivas, especialistas y puntos de vista. Entre los personajes que ya pasaron por la tapa se cuentan, entre otros, Shakira, Marcelo Tinelli, Pablo Echarri, Juan Sebastián Verón, Javier Mascherano, Cecilia Roth, Luciano Castro, Emilia Attias, Leonardo Di Caprio, Miley Cirus, Maradona. ACCESS DIRECTV por dentro Todos los meses la revista ofrece 112 páginas repartidas de la siguiente manera: 32 para contenido regional, 18 para contenido local, 18 para deporte regional y 2 para deporte local y 34 para lo más destacado de la programación del mes, tanto de las señales propias de la empresa (OnDIRECTV, DIRECTVsports) como del resto de los canales. Los ejes: Espectáculos: Entrevistas en estilo directo, listados, notas breves, crónicas. La información no se presenta nunca de la misma manera, sino que se recurre a distintos géneros para expresarla de una manera atractiva y versátil. A su vez, los textos están desplegados en varios niveles de lectura que incluyen destacados, recuadros y foto-­epígrafes. Deportes: Ocupa un lugar destacado en la revista, directamente proporcional a la importancia que tienen las señales deportivas en DIRECTV. Los contenidos deportivos son provistos por El Gráfico, la primera marca en deportes de Latinoamérica y la tercera a nivel mundial. Se privilegian los deportes como el fútbol, el tenis y torneos donde DIRECTV posee derechos exclusivos como las Ligas de España, Inglaterra o la Champions League, pero también se apunta a la diversidad;; entre el resto de los deportes (boxeo, básquet, beisbol) se busca en el calendario internacional eventos que sean atractivos para los lectores-­
suscriptores. Programación: Con un 1/3 de espacio en la revista, está presentada de una manera atractiva y dinámica, que permite a los suscriptores enterarse rápidamente de cuáles son las mejores opciones de contenidos. Para hacer este recorte, DIRECTV c

Documentos relacionados