Especial Cerrando Exteriores - Aluminio, noticias y empresas

Comentarios

Transcripción

Especial Cerrando Exteriores - Aluminio, noticias y empresas
nº 48
noviembre - diciembre
2O10
D
E
S
T
A
C
A
Especial
Cerrando Exteriores
D
O
EXTRUSIÓNA N O D I
Z A D O L acadoc a r p i
nteríadealuminio No
ticiasE S P E C I A L E S
EXTRUSIÓNA N O D I
Z A D O L acadoc a r p i
nteríadealuminio No
t i c ia s E S P E C I A L E S
Sumario
Sumario de publicidad ............................................................................................ 4
Especial Cerrando Exteriores
SCUBA, un nuevo modelo de cubierta de Abrisol ............................................................ 16
ACM, múltiples soluciones en todo tipo de cerramientos ............................................... 17
Trenza Metal Área presenta tuna nueva chapa MICROTRENZADA® de aluminio
para distintas aplicaciones arquitectónicas .................................................................... 18
PÁG. 54
Sistema de correderas Schüco ASS 32 SC ...................................................................... 20
CORTIZO presenta su nuevo sistema de Techo Móvil ..................................................... 21
Carpintería
de aluminio
Nuevas soluciones...
Sistema para verandas CR 120 de Reynaers .................................................................. 22
Pérgola Solisysteme ........................................................................................................... 24
Tecnología y diseño en sistemas plegables ..................................................................... 26
Comercializadora de Techos Móviles, múltiples soluciones en cerramientos............... 28
Nuevo toldo plano CRETA .................................................................................................. 30
EMBO STEEL TOP de Paneles Embo ................................................................................. 32
Espai Sistemas, soluciones de alta calidad con todas las garantías ............................. 34
Aquasol Medioambiente instala 4 pérgolas RENSON® Lagune® en la terraza
del hotel Puerto Sherry, en el Puerto de Santa María (Cádiz) ........................................ 36
Persianilla ScreenLine® de Blind Glass, la solución que estabas buscando ................. 38
Para disfrutar de la terraza todo el año Home Motion by Somfy .................................... 40
InGnio de Grupo 77: El mejor software, con el mejor servicio para el mejor cliente .... 41
Gesfácil®: software para diseño y cálculo de cerramientos interiores y exteriores....... 42
Carpintería de aluminio
PÁG. 76
Cortizo en el Hotel Husa Abad de San Antonio:
Espacio Sapa.
Una ventana al mercado
Confort, estética y adaptación al entorno ........................................................................ 44
Sistemas de muro cortina
Sapa y nuevos desarrollos
contribuye a la sensación “al aire libre” en el Aer bar de Bombay................................. 48
3DUDFDGDVLWXDFLyQODÀMDFLyQDGHFXDGD ........................................................................ 47
La barandilla de vidrio sin marco marco con SentryGlas® de DuPont™
El grupo FROMM ha presentado sus últimas novedades en maquinaria ...................... 50
Fluidos de corte sin bactericidas y sin crecimiento bacteriano ...................................... 52
Nuevas soluciones... .......................................................................................................... 54
KAWNEER y ESPINET, innovación y funcionalidad con un aire sencillo ......................... 56
Amplitud de miras .............................................................................................................. 59
Rauvolet, el sistema de persianas para armarios de Rehau .......................................... 60
Reynaers Aluminium impartió una jornada técnica en el COAC
&ROHJLR2ÀFLDOGH$UTXLWHFWRVGH&DWDOXxD ...................................................................... 62
Panel STACBOND® .............................................................................................................. 64
Soluciones Schüco en el desarrollo del nuevo Hospital Universitario La Fe
de Valencia ......................................................................................................................... 66
PÁG. 78
Soluciones Technal en la reforma de la Universidad de Magisterio de Valencia .......... 70
Noticias
Manuel Del Pino,
nuevo director general
de Schüco Iberia
Fachada modular en planos verticales quebrados de Wicona....................................... 72
Röchling Plásticos Técnicos, el complemento ideal para la carpintería de aluminio ... 74
0DQLOODFRQWHFODGRGLJLWDOLQWHJUDGRSDUDXQFRQWUROGHDFFHVRVVLPSOH\HÀFD] ....... 75
Espacio Sapa. Una ventana al mercado
Sistemas de muro cortina Sapa y nuevos desarrollos .................................................... 76
Noticias
Manuel Del Pino, nuevo director general de Schüco Iberia ............................................ 78
SEVASA estrena web www.sevasa.com ............................................................................ 80
Edita
New Day Comunicación, S.L.
Sumario de publicidad
Director Revista
Carmelo Aladro de Frutos
Director Técnico
Roberto Ayala
Redactor Jefe
Carmelo Aladro de Frutos
Comité Técnico Asesor
D. Rafael Fuertes (ANEXPA)
D. Miguel Iragui Lizarraga (ASESAN)
Publicidad
Delegación Barcelona:
Rodrigo Rodríguez Soler
93 410 29 04
Delegación Madrid:
91 799 15 93
Diseño y Maquetación
Eduardo Muñoz Lobo
New Day Comunicación, S.L.
la revista del sector
Producción
Roberto Ayala
Administración y Suscripciones
Roberto Ayala
Imprime
*UiÀFDV0RQWHUUHLQD6$
D.L.: M-11631-2003
A
I
ADAPTA COLOR .......................................5
ITTALUM ................................................33
AKZO NOBEL...........................................7
ALUGOM ................... INTERIOR PORTADA
ASELAC.................................................8-9
ASESAN .................................... 12-13, 14
ATIE UNO .................................................3
B
BLIND GLASS........................................39
F
FÁCIL INGENIERÍA ..................................1
Edición Bimestral
FLIFECA .................................................61
Es una publicación de:
New Day Comunicación, S.L.
Carretera de Húmera, 63 Chalet 32
28224 - Pozuelo de Alarcón (Madrid)
Tel.: 91 7991593 - Fax: 91 3517177
[email protected]
www.revistaaluminio.com
G
New Day Comunicación S.L
no se hace responsable de las opiniones
emitidas por los autores, colaboradores
y anunciantes, cuyos trabajos publicamos, ni comparte necesariamente las
opiniones expresadas en los artículos
ÀUPDGRV4XHGDSURKLELGDODUHSURGXF
ción parcial o total, sin autorización expresa, de los originales publicados.
GRUPO 77 ...............................................4
GRUPO AYUSO ........... INTERIOR CONTRA
M
MONTICELLI ..........................................29
P
PANELES EMBO ....................................43
PERSAX .................................................31
S
SAPA ......................................................25
SOMFY ..................................................71
SOUDAL .................................................55
STAC ......................................................51
SUPERAN .....................CONTRAPORTADA
T
GRUPO CRISTALES VENTASOL.............23
TECNISPAI .............................................27
TRENZA METAL .....................................19
TRENZAMETAL ...........................PORTADA
H
V
HENKEL ................................................73
VBH .......................................................69
Extrusión
Empresas pertenecientes a ANEXPA
la revista del sector
www.anexpa.org
A.V. COTEVAL, S.A.
Tel: 91 616 47 27- Fax: 91 616 57 50
HYDRO ALUMINIUM MIRANDA, S.L.U.
Tel: 947 027 300 - Fax: 947 331 934
ALUMINIOS CÁNDIDO, S.A. (ALUCAN)
Tel: 922 500 223 - Fax: 922 500 166
ISOPERFIL, S.A.
Tel: 921 181 850 - Fax: 921 181 526
ALUMITRAN, S.A.U.
Tel: 902 474 777 - Fax: 902 474 888
ITESAL, S.A.
Tel: 976 166 491 - Fax: 976 166 472
ALUVAL, S.L.
Tel: 961 594 380 - Fax: 961 592 263
METALES EXTRUIDOS, S.L.
Tel: 983 361 350 Fax: 983 361 360
EURALEX, S.L.
Tel: 952 70 32 43 - Fax: 952 70 37 31
SOPENA METALES, S.L
Tel: 961 300 900 - Fax: 961 394 238
EXTRUSIONES DE TOLEDO, S.A.
Tel: 925 353 946 - Fax: 925 353 129
TECALUM, S.A
Tel: 972 687 512 - Fax: 972 687 263
HYDRO ALUMINIUM EXTRUSION SPAIN, S.A.
Tel: 937 078 200 - Fax: 938 422 027
SAPA HOLDINGS SPAIN, S.L.
Tel: 948 507 100 - Fax: 948 507 102
Patrocinadores
ALCOA EUROPE, S.A. (ALCOA INESPAL)
Tel: 914 068 218 - Fax: 914 068 245
HYDRO ALUMINIO METAL PRODUCTS
Tel: 949 100 400 - Fax: 949 100 410
Adheridos
AIMEN
Tel: 986 344 000 - Fax: 986 337 302
TECHNOFORM BAUTEC IBÉRICA, S.L.
Tel: 932 386 438 - Fax: 934 154 037
COMPES, S. p. A.
Tel: +39 030 681 5011 - Fax: +30 030 681 0125
FUNDACIÓN CIDEMCO
Tel: 943 81 68 00 - Fax: 943 81 60 74
Lacado
Empresas pertenecientes a ASELAC
Miembros de pleno derecho
Lacadores
ALAS ALUMINIUM, S.A.
Tel.: 985 98 96 00 - Fax.: 985 66 28 66
ALUCAN, S.A.
Tel.: 922 50 02 23 - Fax: 922 50 01 66 / 57 73 90
ALUCOLOR LACADOS MURCIA, S.L.
Tel.: 968 88 91 34 - Fax: 968 88 91 29
ALUEUROPA, S.A.
Tel.: 91 895 58 00 - Fax: 91 895 61 02
la revista del sector
ALUMINIOS Cortizo, S.A.
Tel.: 981 80 42 13 - Fax: 981 80 42 12
EXTRUIDOS DEL ALUMINIO, S.A. (EXTRUAL)
Tel.: 967 21 66 62 - Fax: 967 21 80 48
EXTRUSIONADOS GALICIA, S.A. (EXTRUGASA)
Tel.: 986 55 72 50 - Fax: 986 55 71 74
EXTRUSIONES DE TOLEDO, S.A.
Tel.: 925 35 39 46 - Fax: 925 35 31 29
GALIMETAL, S.A.
Tel.: 986 65 13 67 - Fax.: 986 65 23 95
ALUDECOR MEDITERRANEO
Tel.: 961 341 054 - Fax: 961 341 272
GUILLERMO PORTILLO ARCOS, S.L.
Tel.: 950 64 04 16 - Fax: 950 64 07 99
ALUMINIOS Cortizo MANZANARES S.A.
Tel.: 926 64 70 50 - Fax: 926 61 16 75
HIDRO BUILDING ALUMAFEL
Tel.: 947 33 19 30 - Fax: 947 33 19 34
ALUMINIOS INALUM, S.L.
Tel.: 968 88 13 14 - Fax: 968 88 12 50
ALUMINIOS PADRÓN, S.A.
Tel.: 981 80 30 11 - Fax: 981 80 30 26
ALUMITRAN, S.A.
Tel.: 91 874 53 88 - Fax: 91 874 22 49
ALUVAL, S.L.
Tel.: 96 159 43 80 - Fax: 96 159 22 63
ANODIZADOS DE LEVANTE, S.A.
Tel.: 96 124 08 50 - Fax: 96 124 08 33
ANODIZADOS EBRO, S.A.
Tel.: 976 10 20 94 - Fax: 976 10 22 12
HYDRO ALUMINIUM ESTRUSSION SPAIN, S.A.
Tel.: 977 16 91 18 - Fax: 977 68 90 65 – 68 91 15
INDALSU,S.A.
Tel.: 902 14 55 41
INDUSTRIAS DEL LACADO, S.A. (INDULACSA)
Tel.: 941 25 51 21 - Fax: 941 25 63 84
INGALZA, S.A.
Tel.: 976 10 72 80 - Fax: 976 10 78 91
ISOPERFIL, S.A.
Tel.: 921 18 18 50 - Fax.: 921 18 15 26
ANOVAL, S.L.
Tel.: 96 132 12 70 - Fax: 96 132 35 10
ITESAL LACADOS, S.L.
Tel.: 976 16 50 53 - Fax: 976 16 56 40
APLIBAND, S.L.
Tel.: 91 642 24 45 - Fax: 91 642 23 48
JOSE VIOLA RIBA (VIDRES VIOLA)
Tel.: 973 10 81 08 - Fax: 973 10 81 18
DECORACIÓN Y TRATAMIENTOS DEL ALUMINIO, S.L.
Tel.: 925 84 10 36 - Fax.: 925 84 11 73
DESARROLLO INDUSTRIAL DEL ALUMINIO, S.L(DIAL)
Tel.: 968 89 56 98 - Fax: 968 89 56 99
EMILIANO MADRID E HIJOS, S.A.
Tel.: 925 86 62 99 - Fax: 925 86 65 02
EURALEX S.L.
Tel.: 952 70 32 43 - Fax: 952 70 37 31
EUROCOLOR ACABADOS METALICOS, S.A. ALICANTE
Tel.: 965 10 45 30 - Fax: 965 10 17 77
EUROCOLOR LOGROÑO LACADO DE ALUMINIO,S.A.
Tel.: 941 26 06 48 - Fax: 941 26 06 51
EURO-GLASS SYSTEM S.L.
Tel.: 902 40 40 49 - Fax: 977 66 68 33
EXL-QUINTAGLASS, S.L.
Tel.: 981 803 011 - Fax: 981 803 026
KAYE ALUMINIUM TANGER
Tel.: 0021 267 308 18 15
LACADO DEL ALUMINIO, S.A. (LADAL)
Tel.: 973 20 41 00 - Fax: 973 20 57 17
LACADOS TERUEL
Telf.: 978 82 66 26 - Fax: 978 82 66 26
LACADO Y ANODIZADO DEL ALUMINIO,S.A. (LANOAL)
Tel.: 91 616 17 63 - Fax: 91 616 57 50
LACADOS ALACANT, S.L.
Tel.: 965 48 35 31 - Fax.: 965 48 35 75
LACADOS DEL VALLES, S.A.
Tel.: 93 864 59 25 - Fax: 93 864 86 87
LACADOS INDUSTRIALES DE OCAÑA, S.A.
Tel.: 925 13 03 90 - Fax: 925 12 04 65
Lacado
PROTECCIONES Y LACADOS, S.L. (PROYLAC)
Tel.: 95 563 01 38 - Fax: 95 563 00 69
LACALUM, S.L.
Tel.: 925 84 10 38 - Fax.: 925 84 10 32
METAL PINTURA, S.L.
Tel.: 976 140 700
QUINTAGLASS, S.A.
Tel.: 981 80 30 26 - Fax: 981 80 30 94
METALES EXTRUIDOS VALLADOLID
Tel.: 983 361 550 - Fax: 983 361 551
RECUBRIMIENTOS ORGANICOS, S.A.
Tel.: 945 22 87 97 - Fax: 945 22 78 12
PINTURAS INDUSTRIALES TOLEDO, S.A. (PINTOSA)
Tel.: 925 35 53 50 - Fax: 925 35 52 94
SISTELAC,S.L
Tel.: 91 871 36 27 - Fax: 91 871 62 92
SUMTEC, S.L.
Tel.: 981 63 30 30 - Fax.: 981 63 32 85
POLIESTER-COLOR, S.A.
Tel.: 96 530 22 43 - Fax: 96 674 02 67
SUPERFICIES ANODICAS, S.L (SUPERAN).
Tel.: 93 544 65 20 - Fax: 93 574 06 79
PRIMALUM CANALES, S.L.
Tel.: 968 476 004 - Fax: 968 476 004
V.I.V. ALUDECOR ESPAÑA, S.A.
Tel.: 96 134 10 54 - Fax: 96 134 12 72
PROCESOS DEL ALUMINIO, S.A. (PROALSA)
Tel.: 925 80 50 42 - Fax.: 925 81 62 41
TECALUMINIO,
Tel.: 928 181 081 - Fax: 928 799 825
Pintores
AKZO NOBEL INDUSTRIAL PAINTS
Telf: 93 680 69 23 - Fax: 93 680 69 46
INDUSTRIAS TITAN, S. A
Telf: 93 479 74 94 - Fax: 93 479 74 95
CUBSON INTERNACIONAL
Telf: 91 492 08 60 - Fax: 91 615 01 60
NABER RECUBRIMIENTOS EN POLVO, S.L.
Telf: 96 121 95 10 - Fax: 96 121 32 34
RECUBRIMIENTOS TECNICOS, S.A.
Telf: 93 860 49 70 - Fax: 93 879 39 36
DUPONT POWDER COATINGS IBERICA, S. L.
Telf: 985 124 695 - Fax: 912 725 006
ROHM AND HAAS ESPAÑA, S.A.
Telf: 96 450 44 14 - Fax: 96 450 45 07
4XtPLFRV
ALVAREZ-SCHAER, S. A. (ALSAN)
Telf: 96 134 30 33 - Fax: 96 132 35 29
HENKEL IBÉRICA, S. A
Telf: 93 290 40 00 - Fax: 93 290 47 35
CHEMETAL
Telf: 938406786
PROCOAT TECNOLOGÍAS
Telf: 93 875 61 50 - Fax: 93 875 61 55
QUIMICOAT INTERNACIONAL
Telf.: 902 20 50 05
Miembros colaboradores
4XtPLFRV
PROQUIMIA, S.A
Telf: 93 882 23 53 - Fax: 93 883 20 50
COQUINESA
Telf: 94 456 75 00 - Fax: 94 456 74 62
ESTUDIOS DEL ALUMINIO Y SUPERFICIES, S.L
Telf: 973 249 664 - Fax: 973 232 674
QUIMIAL (QUÍMICA DEL ALUMINIO)
Telf.: 902 020 532 - Fax: 902 020 531
MAC DERMID ESPAÑOLA, S. A
Telf: 936 341 380 - Fax: 936 341 351
SIDASA
Telf: 93 447 98 22 - Fax: 93 447 98 20
Otros
CIDESTAL, S.L.U.
Telf: 902 20 50 05 - Fax: 973 23 26 74
NEURTEK, S.A
Telf: 943 82 00 82 - Fax: 943 82 01 57
MAB INDUSTRIAL,S.A.U
BARCELONA
VERNICIATURA INDUSTRIALE VENETA, deleg.ESPAÑA
Telf: 00 39 04 57 63 91 35 - Fax: 00 39 04 57 63 91 90
MENPHIS, S.P.A
Telf: 914 920 860
SUBLIK, S.R.L.
Telf: 00 39 02 96 82 971 - Fax: 00 39 02 964 80 03 34
la revista del sector
GOVESAN, S. A.
Telf: 91 846 60 - Fax: 91 846 33 03
ADAPTA COLOR, S.L
Telf: 964 467 020
Anodizado
Empresas pertenecientes a ASESAN
Anodizadores
* Anodizadores con Marca de Calidad QUALANOD
EXTRUGASA*
Tel: 902 457 250 - Fax: 986 556 439
www.extrugasa.com
ALAS ALUMINIUM, S.A.*
Tel: 985 989 600 - Fax: 985 989 601
www.alasaluminium.com
EXTRUIDOS DEL ALUMINIO, S.A. (EXTRUAL)*
Tel: 967 216 662 - Fax: 967 218 048
www.extrual.com
ALUCAN, S.A.*
Tel: 922 500 223 - Fax: 922 500 166
www.alucansa.com
EXTRUSIONADOS Y TRATAMIENTOS DEL COLOR, S.A.
(EXTRUCOLOR)
Tel: 968 684 001 - Fax: 968 684 128
www.extrucolor.es
ALUMINIOS CORTIZO CANARIAS, S.L.*
Tel: 922 392 532 - Fax: 922 392 289
www.cortizo.com
EXTRUSIONES DE TOLEDO, S.A.
Tel: 925 234 466 - Fax: 925 233 302
www.extrusionesdetoledo.com
ANDEVAL, S.L.
Tel: 961 502 958 - Fax: 961 513 835
GALIMETAL, S.L.
Tel: 986 652 395 - Fax: 986 652 395
ANODIZADOS EBRO, S.A. (ANESA)*
Tel: 976 102 094 - Fax: 976 102 212
www.inalsa.net/anesa
HYDRO ALUMINIUM EXTRUSION SPAIN, S.A.*
Tel: 977 169 118 - Fax: 977 689 065
www.hydro.com
ANODIAL ESPAÑOLA, S.L.*
Tel: 941 486 260 - Fax: 941 486 270
www.anodial.com
INGALZA, S.A.*
Tel: 976 107 280 - Fax: 976 107 891
ANODIZADOS AYUSO, S.L.*
Tel: 902 102 885 - Fax: 902 102 878
www.grupoayuso.org
LACADO Y ANODIZADO
DEL ALUMINIO, S.A. (LANOAL)*
Tel: 916 161 763 - Fax: 916 165 750
www.Alugom.com
ANODIZADOS CORTIZO, S.A.*
Tel: 981 804 213 Tel: 981 804 212
www.cortizo.com
LAMINEX GRANADA, S.A.
Tel: 958 420 570 - Fax: 958 421 173
www.grupolaminex.es
ANODIZADOS DE LEVANTE, S.A.*
Tel: 961 240 850 - Fax: 961 242 870
METALES EXTRUIDOS, S.L.*
Tel: 983 361 550 - Fax: 983 361 551
www.metal-air.com
ANODIZADOS LA CAROLINA, S.A.*
Tel: 953 685 989 - Fax: 953 661 824
www.anocarsa.com
MUGAPE, S.A.
Tel: 943 174 850 - Fax: 943 174 854
www.mugape.com
APLIBAND, S.L.*
Tel: 916 422 445 - Fax: 916 422 348
www.grupoandalucia.org
CROMOXAL, S.A.*
Tel: 937 192 800 - Fax: 937 187 212
PRODUCTOS BALUMCO, S.A. (ANODI-COLOR)*
Tel: 936 534 001 - Fax: 936 532 179
www.balumco.com
DECORAL, S.A.*
Tel: 935 730 351 - Fax: 935 730 226
www.decoral.es
PROTECCIONES ANODICAS, S.A. (PROANSA)
Tel: 972 865 136 - Fax: 972 864 805
HYDRO BUILDING SYSTEMS, S.L.*
Tel: 941 234 133 - Fax: 941 253 732
www.eural.es
SOPENA METALES, S.L.*
Tel: 961 321 270 - Fax: 961 399 187
www.gruposopena.com
EXL QUINTAGLASS, S.L.*
Tel: 981 803 026 - Fax: 981 803 094
www.exlabesa.com
SUPERFICIES ANODICAS, S.L.*
Tel: 935 446 520 - Fax: 935 740 679
www.superan.com
Colaboradores
ATOTECH ESPAÑA, S.A.
Tel: 944 803 000 - Fax: 944 803 012
www.atotech.com
ALVAREZ SCHAER, S.A.
Tel: 961 343 033 - Fax: 961 323 529
www.alsan.es
CHEMETALL, S.A.
Tel: 938 406 786 - Fax: 938 490 617
www.surfacetreatment.chemetall.com
CUBSON INTERNATIONAL CONSULTING, S.L.
Tel: 914 920 860 - Fax: 916 150 160
www.cubson.com
FISCHER INSTRUMENTS, S.A.
Tel: 933 097 916 - Fax: 934 850 594
ZZZKHOPXWÀVFKHUFRP
HENKEL IBERICA, S.A.
Tel: 932 904 000 - Fax: 932 904 735
www.henkel.es
PROQUIMIA, S.A.
Tel: 938 832 353 - Fax: 938 832 050
www.proquimia.com
TRACTAMENT MEDIAMBIENTAL
INTEGRAL, S.L. (TMI)
Tel: 934 324 200 - Fax: 934 324 258
www.tmimedioambiente.com
SIDASA
Tel: 915 064 911 - Fax: 915 277 590
www.sidasa.com
la revista del sector
ALESPRI, S.A.
Tel: 964 467 228 - Fax: 964 467 229
www.alespri.com
Especial Cerrando Exteriores
CUBA, un nuevo modelo de cubierta
de Abrisol
/D ÀUPD $EULVRO SUHVHQWD VX QXHYR PRGHOR GH FXELHUWD
CUBA. Una práctica cubierta que permite proteger y disfrutar de una piscina al máximo. Debido a la gran altura
que ofrece la estructura, permite que la piscina incorpore
juegos acuáticos como trampolines. La cubierta ofrece
una gran iluminación y transparencia, así como una sencilla manipulación, debido a que sus módulos se abren
enteros o simplemente por un lado.
dimensiones. Su experiencia les permite desarrollar tanto
proyectos para piscinas públicas de la más alta complejidad, como soluciones para particulares con la máxima
garantía de profesionalidad. Abrisol, cubiertas 5 estrellas.
Las cubiertas Abrisol se caracterizan por su diseño personalizado, adaptándose siempre al gusto, necesidades y
presupuesto del cliente.
la revista del sector
Abrisol cuenta con el mayor catálogo de cubiertas del mercado, bajas, altas, intermedias, apoyadas o de grandes
más información
Tel.: 965 67 09 09
Fax: 965 66 01 11
PÁG. 16
ABRISOL
www.abrisol.net
Especial Cerrando Exteriores
ACM, múltiples soluciones
en todo tipo de cerramientos
ACM- Auxiliar de Construcciones Metálicas, S.A. es una empresa especializada en el diseño, fabricación y
montaje de cubiertas, cerramientos,
techos y cobertores para piscinas,
polideportivos o instalaciones en
general. Estos elementos pueden
VHUÀMRVRPyYLOHVWHOHVFySLFRVRUH
tráctiles y en estructura de aluminio
o acero (galvanizado en caliente a
400 ºC).
*$0$ '( SHUÀOHV GH DOXPLQLR
diseñados para cubrir todas las soluciones técnicas que requieren sus
productos y que van evolucionando
de forma que cada 5 ó 6 años se
UHQXHYDODWRWDOLGDGGHODSHUÀOHUtD
adaptándola a las mejoras que se
hayan podido realizar en maquinaULD PiV VRÀVWLFDGD \ HQ SURGXFWRV
de mercado nuevos o mejorables.
Obras grandes o pequeñas, cerramientos para grandes
complejos municipales o cubiertas pequeñas para piscinas privadas. Obras a medida con cualquier tipo de acabado necesario o cubiertas estandarizadas con un coste
económico mínimo. Todo lo que se pueda considerar un
cerramiento está incluido en el catalogo de ACM.
más información
Tel.: 93 864 53 61
Fax: 93 864 59 71
PÁG. 17
ACM
[email protected]
www.acmsa.es
Especial Cerrando Exteriores
Trenza Metal Área presenta
tuna nueva chapa MICROTRENZADA®
de aluminio para distintas aplicaciones
arquitectónicas
Trenza Metal Área ha desarrollado un nuevo tipo de malla
MICROTRENZADA® para utilizar en gran variedad de soluciones arquitectónicas. Puede utilizarse como revestimiento de fachadas, para crear pantallas de ocultación,
cerramiento de huecos, vallas, verjas, etc.
la revista del sector
Las chapas de aluminio MICROTRENZADA® se suministran
a cerrajeros y empresas de transformación en paños debidamente protegidos contra la oxidación. Además de una
gama de productos acabados de alta calidad que se caracterizan por su fácil gestión técnica, suministro y montaje.
Trenza Metal aluminio pone a disposición de los profesionales una extensa gama de soluciones técnicas, sistemas
GH ÀMDFLyQ \ PRQWDMH TXH SHUPLWHQ DPSOLDU OD YLDELOLGDG
de integración en obra.
más información
Debido a su fabricación íntegramente en aluminio, la verja MICROTRENZADA® posee un peso ligero (5,3kg/m2), lo
que facilita su manipulación, así como permeabilidad al
aire, con gran resistencia a la corrosión y larga duración.
$GHPiVHVGHJUDQÁH[LELOLGDG\FXHQWDFRQXQDDPSOLD
posibilidad de acabados, siguiendo siempre los valores
estéticos y la calidad que caracterizan a los productos de
la empresa.
La empresa Trenza Metal Área tiene una larga experiencia en la aplicación de sus productos en obras y ofrece
gratuitamente sus servicios técnicos a arquitectos, ingenieros, constructores, promotores, cerrajeros y técnicos
municipales. Numerosas instalaciones avalan el prestigio
FUHFLHQWHGHHVWDHPSUHVD\ODÀDELOLGDGGHORVSURGXFWRV
y sistemas.
Tel.: 902 114 142
Fax: 980 530 692
PÁG. 18
TRENZA METAL ÁREA
[email protected]
www.tubmetal.com - www.trenzametalarea.com
Especial Cerrando Exteriores
Sistema de correderas Schüco
ASS 32 SC
Renuévese con Schüco ganando en espacio
El sistema de correderas Schüco ASS 32 SC ofrece una
solución inteligente que le permite renovar su hogar ahorrando energía y ganando en espacio.
la revista del sector
*UDQ ÁH[LELOLGDG HQ HVWDQFLDV OOHQDV GH OX] TXH OH SRVL
bilita no sólo estrenar de nuevo su hogar con un diseño
inmejorable, sino también ahorrar en costes de climatización de forma sencilla gracias a sus propiedades termoaislantes.
Una inversión rentable que le permite crear calidad de
vida para siempre mientras contribuye a la protección del
medio ambiente.
La solución inteligente para crear espacio
‡ Óptima utilización del espacio gracias a las aperturas
con tres carriles, de hasta 2/3 del ancho del elemento.
‡ Montaje sobre el muro, se integra de manera armónica
en su hogar.
‡ Máxima comodidad en el accionamiento mediante maneta de una sola mano.
‡ Deslizamiento suave y silencioso.
‡ Alto potencial de ahorro energético gracias al aislamiento térmico.
‡ Variedad prácticamente ilimitada de colores, sus nuevas correderas armonizarán perfectamente con la decoración de su casa.
‡ Sistema compatible con la gama de soluciones Schüco
de aluminio.
Hay muchas razones para elegir Schüco, éstas
son las cuatro más importantes:
‡ Energía: ahorre y genere energía y controle las facturas
de su hogar. Sistemas solares, ventanas o puertas: el
empleo de elementos Schüco no solamente es rentaEOH GHVGH HO SXQWR GH YLVWD ÀQDQFLHUR VLQR TXH WDP
bién protege el medio ambiente.
‡ Seguridad: los productos de Schüco le proporcionan
protección contra intrusos, para que disfrute con tranquilidad.
‡ Automatización: Aumente su bienestar con las numerosas soluciones innovadoras, confortables y de fácil
manejo de Schüco, para alegrarse cada vez que vuelva
a casa.
‡ Diseño: cree su propio estilo y apueste por la variedad
de diseño de Schüco.
más información
PÁG. 20
SCHÜCO
www.schueco.es
Especial Cerrando Exteriores
CORTIZO presenta su nuevo sistema
de Techo Móvil
Se trata de un sistema corredero y automático que permite disfrutar de las estancias en cualquier época del año.
CORTIZO, líder en sistemas de aluminio y PVC para
la Arquitectura y la Construcción, ha lanzado al mercado su nuevo sistema de Techo Móvil corredero y
automático que permite al usuario disfrutar al máximo de las estancias en cualquier estación del año.
El nuevo Techo Móvil de CORTIZO, que cuenta con
una pendiente de 8,5º y una caída máxima de 4.760
mm., presenta una capacidad de acristalamiento de
24 mm., lo que permite integrar vidrios de alta resistencia lumínica, para evitar el efecto invernadero,
así como composiciones de vidrio capaces de garantizar un máximo aislamiento acústico en el interior.
&RQXQDDSHUWXUDPi[LPDGHOGHODVXSHUÀFLH
este sistema proporciona ventilación y una total entrada de luz cenital, presentándose en módulos de
2 ó 3 hojas correderas con múltiples caídas y aperturas motorizadas.
Con una sección de marco de 133
mm, una sección de hoja de 28
PP \ XQ HVSHVRU GH SHUÀOHUtD GH
1,5 mm, el techo móvil de CORTIZO permite llegar hasta los 70 kg
de peso por hoja y alcanzar unas
dimensiones máximas de 1.595
mm de alto por 1.200 mm de anFKRVLODVXSHUÀFLHHVGHYLGULRR
de 2.300 mm de ancho, si la suSHUÀFLH HV GH SROLFDUERQDWR R SD
nel sándwich.
Con el objetivo de adaptarse a la
estética de cada proyecto arquitectónico, el sistema de techo móvil
de CORTIZO se presenta con múltiples opciones de acabado que
van desde el lacado clásico, que
SHUPLWHODFDUODSHUÀOHUtDHQFXDO
quier color de la carta RAL, hasta
acabados especiales como los lacados moteados y rugosos, lacado
imitación madera, lacado antibacteriano y anodizado.
más información
Tel.: 902 313 150
PÁG. 21
CORTIZO
www.cortizo.com
Especial Cerrando Exteriores
Sistema para verandas
CR 120 de Reynaers
Las verandas de aluminio proporcionan luz y espacio a
los hogares durante todo el año gracias a una delicada
combinación de aluminio y vidrio. La nueva veranda con
rotura de puente térmico CR 120 logra mucho más ofreciendo una versatilidad única. Las recientes mejoras han
hecho que la nueva CR 120 sea más sencilla de construir
e instalar, lo que permite al fabricante un ahorro de tiempo considerable, tanto en el taller como en la obra.
la revista del sector
Se han mantenido tres diseños de verandas, la sencilla
pero elegante, Funcional, la Victoriana y los estilos constructivos románticos de la Renacimiento.
Funcional
Victoriana
El sistema CR 120 puede construirse simplemente con
tornillos, con piezas de unión o con topes de unión regulables. A través de combinaciones entre estos métodos
de construcción, pueden crearse tanto verandas sencillas
FRPRFRPSOHMDVGHXQDIRUPDPX\HÀFLHQWH
Este sistema es compatible con todos los sistemas ReyQDHUV SDUD FRUUHGHUDV YHQWDQDV \ SXHUWDV \ RIUHFH LQÀ
nitas posibilidades creativas para la construcción de verandas, incluida la utilización de claraboyas, ventanas de
techo y construcciones adosadas.
más información
Tel.: 93 721 95 59
Fax: 93 721 31 59
PÁG. 22
REYNAERS
[email protected]
www.reynaers.es
Renacimiento
Especial Cerrando Exteriores
Pérgola Solisysteme
Optimice y aumente su espacio habitable, creando un ambiente íntimo, cálido y acogedor.
El techado móvil Solisysteme es un sistema de cobertura
para terrazas que combina sombra, luz y estanqueidad
para un mejor aprovechamiento de estos espacios, mejorando su confortabilidad.
Acabados: estándar en RAL 9010 y RAL 1015. Cualquier
color de la carta RAL bajo pedido.
Más información en: http://www.solisysteme.es
la revista del sector
Solisysteme es un dispositivo solar de lamas orientables
que nos permite controlar la radiación solar en verano o
aprovecharla en invierno, siendo estanco al agua en posición cerrada.
Sus aplicaciones más habituales son en: terrazas, pérgolas, áticos, restaurantes y cafeterías al aire libre, discotecas al aire libre, patios, colegios o guarderías, hoteles, accesos a piscinas, y en general, cualquier espacio de uso
público o privado, contribuyendo a su máximo disfrute al
mejorar su confortabilidad.
Solisysteme puede integrarse sobre cualquier estructura
o pérgola preexistente. También puede suministrarse la
estructura portante con postes de 150 x 150 mm y vigas
de 105 x 50 mm o de 210 x 50 mm.
El accionamiento de las lamas puede ser manual o motorizado.
más información
Tel.: 945 290 058
Fax: 945 290 860
PÁG. 24
A.S.K. SYSTEMS
[email protected]
www.asksystems.es
Especial Cerrando Exteriores
Tecnología y diseño
en sistemas plegables
TENISPAI viene desarrollando desde 1.980 sistemas de
cerramiento plegables de alta calidad. El resultado de dicho trabajo le da la oportunidad de ofrecer al mercado
una amplia gama de productos, que además de aportar
soluciones a todas las necesidades, brinda la posibilidad
de instalar cierres exteriores e interiores de alta calidad y
en consecuencia de alta durabilidad.
la revista del sector
De la gama de cierres plegables compuesta por SEIS modelos, destacamos el sistema para divisiones de interior
fabricado con el modelo S-30 PERFILERIA OCULTA.
Utilizando como punto de partida el cerramiento S-30 de
base, se ha desarrollado el sistema para poder panelar
FDGDXQDGHODVKRMDVSRUHQFLPDGHORVSHUÀOHVGHMDQ
GRSUiFWLFDPHQWHODWRWDOLGDGGHODSHUÀOHUtDRFXOWDHQHO
panel.
Dicho panel puede ir revestido en diferentes acabados,
más información
SDQHOHVPHODPtQLFRVHVWUDWLÀFDGRVHLQFOXVRHQPDGHUD
noble barnizados, pudiéndose además rellenar los paneles con materiales fono-absorventes, al objeto de mejorar
las condiciones acústicas del local.
El sistema S-30 PERFILERIA OCULTA, es idóneo para realizar separaciones de zonas como restaurantes, escuelas,
RÀFLQDVFRPHUFLRVLQGXVWULDV\DGHPiVHVPX\YHUViWLO
para realización de puertas de armario, cerramientos de
grandes zonas de archivo, etc.
Además del sistema S-30, Tecnispai puede realizar divisiones con cualquiera de sus series, VISUAL-GLASS cristal
VLQSHUÀOHUtD6ELVDJUDRFXOWD\6FRQURWXUDGH
puente térmico (panel hasta 28 mm de espesor).
El objetivo de TECNISPAI es ofrecer a sus clientes soluciones competitivas, calidad y servicio para conseguir la
VDWLVIDFFLyQSOHQDGHOXVXDULRÀQDO
Tel.: 977 860 823
Fax: 977 862 589
PÁG. 26
TECNISPAI
[email protected]
www.tecnispai.com
Especial Cerrando Exteriores
Por: Techos Móviles
la revista del sector
Comercializadora de Techos Móviles,
múltiples soluciones en cerramientos
Comercializadora de Techos Móviles, S.L.U., fabrica y comercializa techos móviles corredizos de policarbonato y
cristal, cortinas de vidrio replegables con deslizamiento
en guía inferior y cortinas de vidrios correderas con combinaciones de 2 a 14 hojas.
Servimos a los talleres de aluminio estos productos en
forma de Kit y de esta manera ayudamos a que optimicen
sus almacenes y reduzcan costes.
Tenemos videos de montaje de nuestros productos, realizados paso a paso, que tanta ayuda ha proporcionado a
nuestros clientes.
En su afán de mejorar día a día, hemos buscado un fabricante de policarbonato que cumpliese nuestras exigen-
cias. Así, hemos conseguido la distribución de la empresa
sueca ARLA, fabricante de planchas de policarbonato y
hemos seleccionado para nuestros techos el policarbonato celular MULTICLEAR™ STRONG.
Estas planchas, tratadas con protección UV por ambas caras no amarillean, gracias al sistema de fabricación coextrusionado y no mediante película, con lo que se consigue
XQDPDJQLÀFDySWLFD
La forma de su estructura la hace más resistente a la carga que otros productos del mercado.
En el año 2010 hemos conseguido un altísimo grado de
satisfacción de nuestros clientes y consumidores y estamos trabajando para ofrecer mejorías próximamente.
más información
Tel.: 955 631 516
Fax: 955 634 066
PÁG. 28
TECHOS MÓVILES
[email protected]
www.techos-moviles.es
Especial Cerrando Exteriores
la revista del sector
Nuevo toldo plano
CRETA
Sistema diseñado para su aplicación en verandas, cubiertas acristaladas, jardines de invierno, etc. Su aplicación
por encima de los acristalados nos aporta una importante
protección solar, mejorando de manera notable el aislamiento térmico, repercutiendo esto directamente en el
confort y el ahorro de energía en la climatización de la
estancia.
0HGLGD Pi[LPD GH VXSHUÀFLH GH P2, con una salida
máxima de 6 m y mínima de 1,4 m. La línea máxima es de
5 m y la mínima de 1 m.
Su montaje es más sencillo al venir los cartuchos de tensión ya montados en su interior, con lo que se evita la
manipulación de este sistema por parte del instalador.
Además de disponer de multitud de sistemas de cerramiento ofrecen otros productos, como las lonas swela
más información
sunsilk. Las lonas para toldos son productos de alta tecnología muy madurados, resultado de muchos años de
investigación y desarrollo técnico. Las lonas de PERSAX
ofrecen una característica muy particular, disponen de
XQD VXSHUÀFLH LPSHUPHDEOH TXH UHSHOH OD VXFLHGDG 'H
ello se encargan moléculas nano, que crean una unión
FRQODVXSHUÀFLHGHOWHMLGR/DHVWUXFWXUDGHODVPROpFXODV
evita que el agua, la suciedad o el aceite se adhieran. El
HIHFWRGHDXWROLPSLH]DSHUPLWHTXHHOSROHQGHODVÁRUHV
o el polvo se eliminen con la propia lluvia o agua limpia.
Esto ofrece al toldo un aspecto limpio y cuidado por mucho tiempo. La resistencia al desgarre de swela sunsilk es
muy superior al resto de lonas del mercado. Además de
las pruebas estandarizadas, en PERSAX prueban sus tejidos en condiciones de uso “reales”. La experiencia acumulada durante los pasados 5 años, ha dejado claro que
los colores de swela sunsilk mantienen en grado máximo
su solidez y brillantez.
Tel.: 902 010 564
Fax: 902 010 565
PÁG. 30
PERSAX
[email protected]
www.persax.com
Especial Cerrando Exteriores
EMBO STEEL TOP
de Paneles Embo
Paneles Embo amplía su gama de paneles para cubierta
con la incorporación del nuevo EMBO STEEL TOP, panel
que como indica su nombre está fabricado con chapa
de acero prelacado blanco con un sistema propio de enVDPEODGR PHGLDQWH SHUÀOHV WHUPRSOiVWLFRV LQWHJUDGRV \
núcleo de poliestireno extrusionado de 35 Kg m³ de densidad.
Estos paneles tienen un formato de 1200 mm de ancho y
52 - 82 mm de espesor y se fabrican en largos comprendidos entre los 2000 mm hasta los 6000 mm. El acabado
que disponen estándar es blanco y para proyectos especiales se podrán fabricar en otros acabados. Consultar
cantidades mínimas.
la revista del sector
Este nuevo panel les permitirá acercarse más al mercado
de los paneles industriales de acero, manteniendo la esWpWLFDGHFDUDVOLVDVVLVWHPDGHHQVDPEODGRHÀFD]\OD
calidad que ofrece el producto.
EMBO STEEL TOP está pensado para ser aplicado en verandas y cerramientos, y puede ser utilizado con el sistePDGHSHUÀOHUtDSDUDYHUDQGDV(0
más información
Tel.: 936 333 840
Fax: 936 333 841
PÁG. 32
PANELES EMBO
[email protected]
www.panelesembo.com
Especial Cerrando Exteriores
Por: Espai Sistemas
Espai Sistemas, soluciones de alta calidad
con todas las garantías
Nuevas soluciones
MOVIGLASS M32-2
la revista del sector
Producidos con materiales de alta calidad, los cerramientos
de cristal MOVIGLASS ofrecen versatilidad, múltiples combinaciones y son adaptables a cualquier tipo de decoración.
Así se constata que entre los objetivos de ESPAI SISTEMAS
se encuentra la incorporación de nuevas series para ofrecer el máximo número de posibilidades a sus clientes.
Nuevo Sistema Apilable ESPO A35 y MOVIGLASS A32
Hemos desarrollado un nuevo sistema de herrajes que aseJXUDQODÀDELOLGDGGHORVPLVPRV\ODVHQFLOOH]GHXWLOL]D
FLyQSDUDHOFOLHQWHÀQDO
El sistema plegable apilable, con sus series MOVIGLASS
A32 y ESPO A35, representa la solución ideal para cerrar
dinámicamente espacios. Está compuesto de hojas independientes y se pueden deslizar por cualquier ángulo, logrando una apertura total al recogerse en el extremo.
También se ha rediseñado el sistema de cierre y unión enWUHSHUÀOHVSDUDDXPHQWDUODUREXVWH]GHOVLVWHPD
Presentan un área de almacenaje de hojas que puede ubicarse en cualquier extremo.
PÁG. 34
Especial Cerrando Exteriores
Están disponibles con guía superpuesta, empotrada o sin
guía inferior y se le pueden acoplar manillas simples o cerraduras.
Como opción en las aplicaciones donde las hojas pasen
por ángulo, no es necesario retranquearse hacía el interior;
ya que las hojas no sobresalen del marco.
La serie A35 nos ofrece una mayor hermeticidad con su
sistema de doble junta de estanqueidad. Está disponible
con huecos de 10, 18, 24 ó 35 mm para la colocación de
cualquier vidrio o panel, admitiendo así mismo la colocación de uno o varios parteluces.
Máxima garantía
superado todos los controles de calidad de Espai Sistemas,
GHPRGRTXHSRUYLUWXGGHO&HUWLÀFDGR(VSDL6LVWHPDVJD
rantiza en todo el territorio español sus productos frente
a cualquier defecto de fabricación y en particular 5 años
desde la fecha de factura sobre corrosión, decoloración y
estructura.
&HUWLÀFDGR7pFQLFRGHOD(GLÀFDFLyQ
El Marcado CE
Cidemco ha realizado los ensayos para calcular el valor de
transmitancia térmica de la serie Rotura Puente Térmico
de los cerramientos plegables ESPO.
Como resultado cumplimos con lo indicado en el CTE sobre
HOFRHÀFLHQWH8\SRUORWDQWROD6537SXHGHLQVWDODUVH
en todas las zonas marcadas por el Código Técnico de la
(GLÀFDFLyQ
En ESPAI SISTEMAS estamos preparados, nuestros productos tienen el marcado CE desde hace más de 2 años.
Disponemos de toda la documentación necesaria y de los
SHUWLQHQWHVHQVD\RVUHDOL]DGRVSRUXQODERUDWRULRFHUWLÀFD
do, con lo que dispone de los requisitos marcados por la
normativa del MARCADO CE (UNE-EN 13659:2004. Persianas y UNE-EN 14351-1:2006. Ventanas y puertas peatonales exteriores).
Garantía 5 años
(VSDL6LVWHPDVHPSUHVDTXHIDEULFDHVWHVLVWHPDFHUWLÀ
ca que los productos que suministra son fabricados y han
más información
$(125KDUHQRYDGRHOFHUWLÀFDGR,62D(63$,
SISTEMAS, que evidencia la conformidad de su Sistema de
Gestión de la Calidad con la norma.
Tel.: 902 400 090
PÁG. 35
ESPAI SISTEMAS
www.espo.es
la revista del sector
Con la serie A32 disfrutaremos de la transparencia y estéWLFDGHXQVLVWHPDVLQSHUÀOHVYHUWLFDOHV6HWUDWDGHXQFH
rramiento de cristal templado de 6, 8 y 10 mm de espesor
con cantos pulidos para su manipulación segura, el cual
dispone opcionalmente de juntas de hermeticidad transparentes entre cristales.
Especial Cerrando Exteriores
Por: RENSON®
la revista del sector
Aquasol Medioambiente instala
4 pérgolas RENSON® Lagune® en la terraza
del hotel Puerto Sherry, en el Puerto de
Santa María (Cádiz)
RENSON®, innovador en ventilación y protección solar, aumenta el confort en la terraza del hotel Puerto Sherry en el
Puerto de Santa María (Cádiz). Los clientes del hotel pueden
disfrutar del ambiente en la terraza del hotel, desde el desayuno hasta la copa por la noche, durante todo el año, sin molestias causadas por el sol, la lluvia, el viento o el frío, gracias
a las pérgolas Lagune® de Renson®. Las 4 Lagune® tienen
una anchura y una salida de 5 metros, cubriendo así 100
m² de la terraza del bar/ restaurante del hotel. Las Lagune®
están compuestas de una estructura de aluminio en la cual
YLHQHLQWHJUDGDXQDSURWHFFLyQVRODUWH[WLO]HQLWDO5RRIÀ[
que resiste al viento y al agua pero deja pasar la luz, estos
módulos se pueden abrir y cerrar según conviene. En 2 pérgolas Lagune® también se ha integrado una protección solar
WH[WLOODWHUDO6LGHÀ[PRWRUL]DGD
El grupo HACE (Hoteles Andaluces con Encanto), un grupo de
hoteles en Andalucía, se fundó en 1969, cuando el Sr. Jan
PÁG. 36
De Clerck decidió durante su viaje de luna de miel adquirir el
hotel Playa de la Luz, en la pequeña ciudad de Rota que hoy
en día es un hotel 4 estrellas con 235 habitaciones. Durante
los años 90 se han ido sumando 3 hoteles más al grupo:
Hotel Jerez, en Jerez de la Frontera (1996 – 129 habitaciones), hotel Duque de Nájera en Villa de Rota (1998-92 habitaciones), y el hotel Guadacorte Park en Campo de Gibraltar
(1999 – 116 habitaciones). Una mansión en el centro de
Jerez fue renovada al hotel Villa Jerez, con 18 habitaciones.
El 19 de marzo 2010 el hotel Puerto Sherry se ha sumado al
grupo Hace. Este hotel cuenta con 59 habitaciones con una
terraza grande, con vistas al puerto deportivo Puerto Sherry,
la bahía de Cádiz y el puerto de Santa María, o una pineda
extensa. 3 restaurantes, 1 bar, sauna, jacuzzi, solarium, piscina interior y exterior, cine,… son sólo algunas de las muchas instalaciones del hotel. En 8 salas de conferencia, con
una capacidad de entre 2 y 400 plazas, los invitados pueden
Especial Cerrando Exteriores
participar en eventos de todo tipo: reuniones, bodas,… Fuera
los huéspedes pueden disfrutar en una terraza enorme del
sol y la mar. La terraza está dividida en 3 zonas: se puede
tomar el sol al lado de la piscina, se puede charlar o bailar
en el bar-lounge-disco o disfrutar de una bebida o una cena
en la terraza del hotel. Es en esta terraza donde se sirve
el desayuno del hotel, en la que se han instalado las 4 pérgolas Lagune®. En el sur de España las temperaturas son
elevadas, y de vez en cuando un chubasco tropical puede
intervenir. Por eso la dirección del hotel Puerto Sherry buscaba una solución para poder utilizar esta terraza de forma
continua, tanto si el sol empuja las temperaturas por encima
de los 40 ° C como si una tormenta hace diluviar durante un
breve momento.
La dirección del hotel estaba instantáneamente convencida
de la calidad de esta solución y se instalaron 4 Lagune® de
5 x 5 metros. “A pesar del calor extremo la colocación fue
sencilla”, dice Juan Rodriguez –Rubio de Aquasol Medioambiente. “Las primeras 2 unidades se instalaron con la ayuda
experta de un técnico de RENSON®. Gracias a esta formación práctica e intensiva nosotros estuvimos preparados
para elevar las otras 2 Lagune®. Además se ha pensado en
todos los detalles al desarrollar esta pérgola: fácil montaje
de la estructura de aluminio, montaje sencillo de los estores,
un diseño innovador para el desagüe y los puntos de anclaje
casi invisibles.”
do del todo. Un par de semanas después de su instalación
en el hotel Puerto Sherry ya se ha demostrado la excelente
estanqueidad de este sistema. Durante un chubasco veraniego los clientes podían permanecer debajo de la Lagune®
sin ningún problema.
Además se pueden añadir screens laterales o frontales en
la pérgola. En 2 unidades® en Puerto Sherry se integraron
HVWDVSURWHFFLRQHVVRODUHVWH[WLOHVHQHOODWHUDO6LGHÀ[FRQ
ventanas de tejido transparente integradas. Estos laterales
junto con una solución integrada de triángulo permiten cerrar parcialmente una zona, y crear un ambiente protegido,
sin tener la sensación de estar encerrado. Se mantiene la
visibilidad hacia el exterior ya que el tejido es parcialmente
translucido y las ventanas completamente. Se enrollan junto
con los screens.
Estas pérgolas Lagune® de Renson ofrecen protección contra el calor del sol, pero también hacen que los clientes
nunca estén molestados por una repentina lluvia, viento o
frío. Gracias a esta pérgola no sólo se pueden recibir más
clientes al mismo tiempo, sino también permite utilizar la
terraza el día entero, durante todo el año; desde la primera
sol primaveral, durante los chubascos de la pretemporada,
GXUDQWHHOVRODVÀ[LDQWHHQYHUDQRHLQFOXVRGXUDQWHORVGtDV
más fríos en otoño o invierno. Resumiendo: un espacio extra
durante todas las estaciones del año.
Esta pérgola elegante Lagune® de RENSON es un valor añadido para cualquier negocio de hostelería: extra confort,
extra negocio. El sistema cuenta con una estructura de aluminio patentada en el cual viene integrada una protección
solar textil motorizada, que deja pasar luz pero es estanca al
agua y resistente al viento. La Lagune® combina un sistema
patentado de guía con cremallera con un sistema de tensión innovador, que hacen que el tejido resista al viento y se
quede bien tensado en cualquier posición. El agua de lluvia
que cae en el tejido está guiada a través de canalones de
desagüe hacia el tubo de desagüe integrado en los postes
de la estructura. Funciona también si el tejido no está cerra-
más información
PÁG. 37
RENSON
www.renson.es
la revista del sector
Aquasol Medioambiente de Jerez de la Frontera fue la empresa encargada de ofrecer una solución adecuada. Especialista en tratamiento de aguas y energía, y muy activo en
el sector hotelero, siempre está buscando sistemas innovadores y complementarios, con los cuales pueden ampliar
VXV DFWLYLGDGHV 8QD SpUJROD VLJQLÀFD SDUD HOORV XQ FRP
plemento interesante, porque en el sector hotelero no sólo
hay mucha piscina, sino también amplias terrazas. Aquasol
Medioambiente proponía con la pérgola de Renson® Lagune® la solución ideal para su problema, no sólo para proteger del sol, sino también para proteger contra el viento, la
lluvia y el frío.
Especial Cerrando Exteriores
Por: Blind Glass
Persianilla ScreenLine® de Blind Glass,
la solución que estabas buscando
da muchísimo en la reducción del
factor solar, el principio es simple: la
mayor parte de la radiación solar es
UHÁHMDGD SRU ODV ODPDV KDFLD HO H[
terior; pero la pequeña parte que es
absorbida y reenviada como infrarroMRHVUHÁHMDGDSRUHOORZHGHOYLGULR
interno y se dispersa entonces por el
vidrio externo por su mayor convección. De esta manera el calor que se
transmite al ambiente interior es mucho menor y la temperatura del vidrio
interno es muy reducida.
ScreenLine® es un tipo de fachada.
Está siendo usada para proyectos
cada vez mayores como “CAMG” en
Brasil de Oscar Niemeyer (aprox.
30.000 m2 de fachada), y en proyectos de excelencia energética como
“Santander” de Mario Cucinella (priPHUHGLÀFLRGHRÀFLQDVHQVHUFODVLÀ
cado en Clase Energética A en Milán).
La persianilla ScreenLine® se encuentra
aislada del ambiente exterior y del usuario. De esta manera siempre vive en las
condiciones previstas de proyecto, las
cuales son testadas en nuestro laboratorio y en nuestras cámaras climáticas
a 20 años (en condiciones mucho más
exigentes que en la realidad). Por todo
ello tiene una perfecta durabilidad y no
necesita ningún tipo de mantenimiento.
Todos los modelos de ScreenLine® tieQHQ FHUWLÀFDFLRQHV GH ,)7 GH 5RVHQ
heim para la norma EN1279.
Además de resistir en el tiempo, ScreenLine® tiene unas prestaciones energéticas excelentes. El principio de protección
solar de ScreenLine® es muy diferente al
de otras soluciones. La presencia de un
low-e en posición #3, por ejemplo, ayu-
más información
Tel.: 965 340 929
Fax: 965 801 577
PÁG. 38
BLIND GLASS
[email protected]
www.blindglass.com
Especial Cerrando Exteriores
Para disfrutar de la terraza todo el año
Home Motion by Somfy
la revista del sector
Nuevo calefactor para la terraza
Somfy presenta Heating Modulis Ramp RTS, un nuevo calefactor con receptor radio integrado, para ajustar la intensidad desde el mando a distancia del toldo. Se trata de
una solución pensada para permitir disfrutar de la vida en
la terraza durante todo el año, y no sólo en verano.
Realizado en aluminio, el calefactor mide medio metro de
largo, y proporciona una calefacción radiante. Está pensado para dar calor a una mesa para 8 o 10 personas
(aproximadamente un área de 16 m2). Puede instalarse
en la pared de la terraza. Funciona conectado a la red
eléctrica (el 92% de la energía eléctrica consumida se
convierte en calor, cifra considerablemente superior a la
habitual en estufas).
que puede instalarse sobre la pared de la terraza o la
barra de carga del toldo, y se conecta a la red eléctrica.
Accionada mediante el mando a distancia Telis Modulis
RTS, que incorpora una rueda moduladora (igual que la
del ratón de ordenador), la intensidad de la luz se puede
ajustar con total precisión.
Toda la gama de motores y automatismos Somfy está
pensada para garantizar al usuario el más alto grado de
comodidad y facilidad de uso, con toda la garantía de una
marca líder en el sector.
Para completar una gestión completa de la terraza desde
el mando a distancia del toldo, Somfy presenta también
Lighting Modulis Ramp RTS, una unidad de alumbrado
más información
PÁG. 40
SOMFY
www.somfy.es
Especial Cerrando Exteriores
Por: Grupo 77
InGnio de Grupo 77: El mejor software,
con el mejor servicio para el mejor cliente
Grupo 77, empresa desarrolladora de InGnio, el programa informático especializado en la Carpintería de Aluminio y PVC, Cristalería y Protección Solar, cuenta con más de 30 años de experiencia en el sector de las tecnologías de la información. La fórmula: proporcionar el mejor software con el mejor servicio para el mejor cliente.
\iUHDVJHRJUiÀFDV(VSDxD0DUUXHFRV/DWLQRDPpULFD«
ha dotado a InGnio de una gran cantidad de funcionalidades que abarcan todas las áreas de la empresa.
Descargue una demo gratuita en www.inGnio.com
la revista del sector
InGnio, como software especializado en el mundo del cerramiento permite al usuario calcular el presupuesto de
cualquier ventana o puerta de aluminio o PVC. Para ello
cuenta con módulo de diseño asistido por ordenador denominado Diseño Visual de Cerramientos (DVC), el cual
como su propio nombre indica permite al usuario diseñar los cerramientos de aluminio totalmente a escala,
FRQWRGRVVXVGHWDOOHVSHUIHFWDPHQWHGHÀQLGRVQ~PHUR
GHKRMDVSDQHOHVGHFRUDGRVÀMRVVXSHULRUHV\ODWHUDOHV
PRQWDQWHV WUDYHVDxRV SHUÀOHV HVTXLQHURV SHUÀOHV \ YL
drios curvos, con persiana (compacto o monoblock) etc.
Con la tecnología 3D el diseño adquiere un aspecto aún
más realista, lo cual facilita enormemente la utilización
del software y más importante aún, el cliente receptor
del presupuesto puede hacerse una idea más clara del
UHVXOWDGRÀQDOGHOWUDEDMR(OXVXDULRSXHGHPRYHUODYLV
ta 3D del cerramiento hasta encontrar la mejor posición
del mismo en la que se aprecien todos los detalles de
calidad.
$VtPLVPR,Q*QLRYHULÀFDVLHOFHUUDPLHQWRFXPSOHORVUH
quisitos impuestos por el CTE en cuanto al ahorro energético, reducción sonora, e
imprime su etiqueta CE y
declaración de conformidad, la cual en muchas
ocasiones al tratarse de
cerramientos complejos,
personalizados a la estancia y gustos del cliente deben ser tratados
como “productos por unidad” a efectos de la normativa del Marcado CE.
Grupo 77, gracias a la experiencia acumulada y a
su amplia base de clientes de todos los tamaños
más información
Tel.: 902 307 777
Fax: 902 021 224
PÁG. 41
GRUPO 77
[email protected]
www.InGnio.com
Especial Cerrando Exteriores
Gesfácil®: software para diseño
y cálculo de cerramientos interiores
y exteriores
Fácil Ingeniería Informática comercializa Gesfácil®, software para fabricantes de ventanas, puertas y cerramientos interiores y exteriores tanto en aluminio como en pvc.
la revista del sector
Con Gesfácil® puede gestionar por completo un taller o
fábrica de ventanas:
Presupuestación de cualquier estructura de forma rápida.
Diseño de cerramientos exteriores en 3D.
Proceso de creación de una estructura con Gesfácil®
Completo estudio de costes para poder ajustar los presupuestos con datos reales.
Detalle de la sección de corte de cualquier estructura.
Posibilidad de recalcular presupuestos de forma rápiGDPRGLÀFDQGR
Facturación y recibos, incluyendo completo control de
riesgos e impagos.
‡ La serie presupuestada (incluso cambiando correderas por practicables).
‡ El color de las ventanas.
‡ El compacto y la persiana.
‡ Las medidas de las estructuras.
‡ Etc.
-
Conexión con programas estándar de contabilidad.
Gestión de proveedores.
Completo control de stocks, con posibilidad de gestionar el proceso de lacado o anodizado.
Optimización tanto de barras como de planchas de
chapa o vidrio.
Pedidos de material al proveedor.
Cálculo del CTE térmico del presupuesto.
Marcado CE de las estructuras vendidas, incluyendo la
impresión de la etiqueta.
Gestión del control de producción en fábrica de Marcado CE.
Diseño y presupuesto de muros cortina.
PÁG. 42
3ODQLÀFDFLyQGHSHGLGRVFRQ*HVIiFLO®
Especial Cerrando Exteriores
Conexión con tronzadoras automáticas, centros de mecanizado, líneas de corte y mecanizado, soldadoras,
ajunquilladoras, etc.
carpintería de manera especializada, es decir, no trata de
ODPLVPDPDQHUDXQSHUÀOGHDOXPLQLRTXHXQYLGULRRXQ
monobloc.
Gestión de la producción para control exhaustivo de tiempos
de fabricación y planiÀFDFLyQ
Gesfácil® se adapta
tanto al pequeño taller
como a la gran empresa, ya que ofrece una
gran variedad de versiones desde programas monopuesto hasta
grandes redes de área
local y remotas.
Taller sin papel.
Acceso remoto a sus
datos desde cualquier
lugar.
Gesfácil® permite la introducción de todos los artículos relacionados con la
Pida una demostración
sin compromiso y podrá
comprobar la potencia
y sencillez de uso de
Gesfácil®.
Stand en Veteco 2010
más información
Tel.: 902 101 660
FÁCIL INGENIERÍA
[email protected]
www.facilsoft.net
PÁG. 43
Carpintería de aluminio
FICHA TÉCNICA:
la revista del sector
Obra:
Hotel Husa Abad de San Antonio ****
Arquitectos:
Virginia González Rebollo
José María Ruiz Sanz
Carpintería metálica:
Cortizo
Solución utilizada:
Fachada ligera: Muro Invertido Tapeta Vertical
COR 60 con Rotura de Puente Térmico
Instalador:
&$53,17(5Ì$&(3('$1$,QVWDODGRU2ÀFLDO&257,=2
Cortizo en el Hotel Husa Abad de San Antonio:
Confort, estética y adaptación al entorno
PÁG. 44
Carpintería de aluminio
La obra, situada en una encrucijada entre el hospital, la
circunvalación de la ciudad y un barrio en plena expansión cumple con creces las premisas con las que fue diseñada: “Convertirse en un referente de desahogo y relax
en la ciudad de León y a la vez dar servicio al hospital.”,
como apunta la arquitecta Virginia González Rebollo, responsable de la construcción junto a José María Ruiz Sanz.
El origen del proyecto fue un concurso público organizado
por el ayuntamiento de León que planteaba además de
la construcción del Hotel, un parking con capacidad para
1.650 vehículos, una zona de comercio y restaurante. La
apuesta de los arquitectos fue “llevar el parking hacia el
interior de la construcción, dando fachada a ambos lados del hotel y solucionando así los temas de ventilación,
iluminación y todas las necesidades que un parking tiene”. Este planteamiento además, facilita situar amplias
VXSHUÀFLHV DFULVWDODGDV KDFLD OD ]RQD VXU GHVGH GRQGH
se puede contemplar una vista privilegiada de la ciudad
y a la vez evadirse del complejo hospitalario situado a escasos metros.
Con el objetivo de cohesionar todas las partes del complejo, se optó por crear una gran estructura para salvar el
desnivel de más de 20 metros entre la plaza situada en la
zona norte y la calle que transcurre por la zona sur. Esta
decisión permite conectar internamente las diferentes
zonas y ampliar enormemente las zonas comunes. Asimismo, actúa como base para la colocación de una gran
VXSHUÀFLHDFULVWDODGD
La Fachada Sur se caracteriza por “la integración de elementos bastante diferenciados como es el cerramiento
metálico de chapa perforada del parking, dotado de un
aspecto más industrial; un degradado de colores en realizado con paneles en la zona de las habitaciones y una
gran cercha en la que se optó por una cubierta de zinc
escalonada totalmente abierta al exterior con el sistema de fachada ligera Muro Invertido Tapeta Vertical de
CORTIZO.” La elección del sistema fue determinante para
“dotar al complejo de un ritmo vertical visible desde el exterior, pero que al mismo tiempo conservase la planidad
del conjunto.”
Por su parte la Fachada Norte destaca por sus amplios
muros cortina que se encargan de dotar de luz natural
PÁG. 45
la revista del sector
El hotel Husa Abad de San Antonio de León, catalogado como cuatro estrellas, representa un nuevo tipo de
construcciones en el que confort, estética y adaptación
al entorno se unen para crear espacios únicos. Caracterizado por una clara tendencia minimalista, cuenta con 97
habitaciones y amplias salas de reuniones creadas para
albergar todo tipo de eventos.
la revista del sector
Carpintería de aluminio
a los salones, el restaurante y la cafetería del complejo.
Se utilizó el mismo sistema que en la fachada sur, pero
en esta ocasión el ritmo vertical se refuerza sobremanera con la instalación de unas tapetas de aluminio más
contundentes que continúan incluso rodeando la parte
superior del vidrio.
Dada la localización del complejo, situado en una de las
zonas climáticas más exigentes de España, y la ausencia
total de ruidos que debe ofrecer una construcción de estas características; se requería un sistema de carpintería
con las máximas prestaciones térmicas y acústicas. En
la zona de las habitaciones se optó por el sistema COR
60 con R.P.T. de CORTIZO. Un ventanal versátil dotado
con varilla de poliamida de 24 mm. y con capacidad de
acristalamiento de hasta 50 mm., que permite optimizar
al máximo el aislamiento en el interior de las estancias.
“De hecho se han realizaron ensayos con resultados muy
por encima de los niveles exigidos por el CTE.”
HMHFXFLyQGHJUDQGHVREUDV\HGLÀFDFLRQHVVLQJXODUHV(O
responsable de la Carpintería para esta obra, Angel Cavero Prieto, destaca la ausencia de problemas “gracias a la
intensa colaboración con el Departamento de Arquitectura e Ingeniería de CORTIZO. Domingo Brión –su Directorse desplazó a León no solo para ofrecer soluciones en
plano, sino para involucrarse en la instalación en obra y
su problemática. Creo que hicimos un buen equipo. ” Domingo Brión, por su parte, destaca que “la experiencia y
know-how de Carpintería Cepedana resultó fundamental
SDUDDOXPEUDUXQSUR\HFWRFRQODPD\RUHÀFLHQFLDHQHO
que destacan los más de 2.700 m² de fachadas ligeras
CORTIZO instaladas.” Una obra singular para un enclave
tan singular y arquitectónicamente relevante como León.
En cuanto al acabado se optó por un anodizado natural
mate, “siguiendo un planteamiento claro de marcar volúmenes, jugando con algún color, pero manteniendo la
estructura de toda la carpintería en un tono neutro.”
La instalación de los sistemas fue realizada por CarpinteUtD&HSHGDQDPLHPEURGHOD5HGGH,QVWDODGRUHV2ÀFLD
les CORTIZO, que cuenta con una dilatada experiencia en
más información
Tel.: 902 313 150
PÁG. 46
CORTIZO
www.cortizo.com
Carpintería de aluminio
Para cada situación
ODÀMDFLyQDGHFXDGD
Dr. Hahn acelera la fabricación de puertas
/DVYHQWDMDVGHOQXHYRVLVWHPDGHÀMD
ción son obvias: El montaje de las bisagras de las series 60AT y Tuerband 4
es más rápido y el anclaje resulta más
estable. Estas características han sido
probadas y documentadas en diferentes ensayos de laboratorio.
UHÀHUHWDQWRDODHOHYDGDHVWDELOLGDGGHOVLVWHPDGHÀMDFLyQ
como a su montaje rápido.
/DLGHDSULQFLSDOHVVLPSOH3DUDFRQVHJXLUXQDÀMDFLyQHV
WDEOH VREUH WRGR HQ FDVR GH SHUÀOHV FRQ FiPDUDV H[WHU
nas altas y débiles, se puentea la distancia entre refuerzo
\ VXSHUÀFLH H[WHULRU D WUDYpV GH XQDV FODYLMDV PHWiOLFDV
que expanden directamente dentro del
refuerzo, debido a la introducción de un
tornillo. El proceso de montaje en general
HVSUiFWLFDPHQWHLJXDOTXHFRQÀMDFLRQHV
habituales.
Acabar con las deformaciones de
SHUÀOHV
Sobre todo en casos, donde las aplicaciones que requerían casquillos distanciadores para puentear las cámaras
H[WHUQDV GH ORV SHUÀOHV GH DOXPLQLR
DKRUDHVVXÀFLHQWHDWRUQLOODUODELVDJUD
GLUHFWDPHQWHVREUHHOSHUÀOFRQORVWRU
nillos especiales de Dr. Hahn. El resultado no solo es un ahorro en el tiempo
de montaje sino también en el coste
GHHOHPHQWRVGHÀMDFLyQDGLFLRQDOHV
Clavijas metálicas especiales añaden estabilidad al anclaje de la bisagra y así evitan
de una manera más efectiva la inclinación
de la hoja – hablando aún después de
1.000.000 de ciclos y condiciones desfaYRUDEOHV /D GHIRUPDFLyQ GHO SHUÀO GH OD
hoja, causado por el apriete de la bisagra,
es imposible, gracias a una geometría esSHFLDOGHORVHOHPHQWRVGHÀMDFLyQ
(QXQSULPHUSDVRODÀMDFLyQ.7)L[HVWDUi
disponible en la bisagras KT-N 6R y KT-V
6R, que pueden soportar pesos hasta
NJVHJ~QORVGHWDOOHVGHORVSHUÀOHV
Hasta en casos de puertas ya montadas en obra o en casos de reparaciones, cambiar o añadir bisagras resulta
simple y rápido. Una condición para el
XVR GH ODV ÀMDFLRQHV GLUHFWDV VRQ HV
pesores de mínimo 1,6mm de las paUHGHVGHOSHUÀO
Ventajas adicionales sin complicaciones
Nuevo: Bisagras de Dr. Hahn con
KT-Fix
KT-Fix no solo resulta atractivo al fabricante de puertas por sus características
técnicas. Debido a un pre-montaje casi
FRPSOHWRGHORVHOHPHQWRVGHÀMDFLyQVH
ahorra tiempo de montaje y como consecuencia dinero en el proceso de producción.
KT-Fix se llama la última innovación de
Dr. Hahn para puertas de PVC. Fix se
Informaciones adicionales en castellano
se encuentran en www.Dr-Hahn.com.
Los expertos alemanes también pueGHQSUHVHQWDUXQDÀMDFLyQLQQRYDGRUD
HVSHFtÀFDSDUDSHUÀOHVGH39&
más información
Fax: +49 (0)2166-954579,
PÁG. 47
DR. HAHN GMBH & CO. KG
[email protected]
www.Dr-Hahn.de
la revista del sector
/DHYROXFLyQGHOXVRGHSODFDVGHÀMDFLyQKDVWDHOWRUQLOOR
GHDQFODMHGH'U+DKQSDUDODÀMDFLyQGHELVDJUDVHQSHU
ÀOHVGHDOXPLQLRHVFRPSDUDEOHFRQHOSDVRGHODELVDJUD
soldada a la bisagra atornillada. Después de dudas iníciales ya cada vez más fabricantes de puertas aprovechan el
HOHPHQWRGHÀMDFLyQLQQRYDGRUGH'U+DKQHVSHFLDOLVWDHQ
bisagras para puertas.
Carpintería de aluminio
la revista del sector
La barandilla de vidrio sin marco
marco con SentryGlas® de DuPont™
contribuye a la sensación “al aire libre” en
el Aer bar de Bombay
El Aer bar and lounge del Four Seasons Worli de Bombay, en India, posee una balaustrada de vidrio laminado
de gran transparencia, que proporciona a sus huéspedes una visión sin obstáculos de la ciudad. No se trata
sólo de la resistencia del vidrio de seguridad laminado hecho con intercalarios estructurales SentryGlas®, con
capacidad de soportar cargas de viento e impactos, sino también de la rigidez de la capa intermedia SentryGlas®
que también colabora a mantener en su lugar el panel autosoportado ante la remota probabilidad de rotura.
PÁG. 48
Carpintería de aluminio
La utilización de DuPont™ SentryGlas® eleva tanto el grado de seguridad como el placer de la visión de los visitantes del Aer bar and lounge del Four Seasons Worli de
Bombay, en India. El intercalarlo estructural , que se utiliza en paneles de vidrio laminado con un marco mínimo
para formar la barandilla alrededor del lounge, proporciona mayor resistencia, rigidez y seguridad frente a la rotura
que las capas intermedias de seguridad tradicionales, al
tiempo que su claridad natural proporciona una visión de
Bombay y sus alrededores que hace contener el aliento.
Encaramado en el aire sobre 34 plantas, el Aer bar and
lounge se está convirtiendo en un destino popular entre
turistas y residentes. Es el bar más alto de la ciudad, con
vistas espectaculares sobre el mar y el paisaje urbano.
“Te sientes como transportado a otro lugar. Todo lo que
puedes ver es el mar y las luces de Bombay esparcidas
como en una sábana frente a ti,” ha dicho el gerente del
Aer, Aditya Ramani.
Una de las claves para experimentar la sensación de aire
libre y las vistas que quitan el aliento que ofrece el Aer bar
es la elección del diseñador de vidrios de seguridad en la
balaustrada que rodea el lounge. Situado en el extremo
del ático, la cristalera crea una capa protectora casi invisible entre los huéspedes y la impresionante vista hacia
fuera y sobre la ciudad que tienen por debajo.
Además de garantizar la seguridad de los huéspedes del
hotel, el equipo de diseño quería crear una pared de vi-
China Southern Glass se
encargó del laminado de los
paneles de la balaustrada
de vidrio, con unas dimensiones de 1,7 por 2,3 metros cada uno. Los paneles
se sujetan con una línea en
su parte inferior. Cada plancha se compone de dos paneles de vidrio de 12 mm, que
se han laminado juntos utilizando un intercalario de SentryGlas® de 3 mm. El vidrio fue instalado por Permasteelisa, una multinacional especialista en acristalamientos
arquitecturales avanzados.
SentryGlas® - intercalario de seguridad que contribuye a
la resistencia y claridad
Entre las ventajas de utilizar el intercalario SentryGlas®
en laminados de balaustradas con un marco mínimo, se
encuentra la elevada rigidez y dureza del material en comparación con los intercalarios de seguridad tradicionales.
Incluso si se rompiera el panel de vidrio, la rígida capa
intermedia de SentryGlas® ayuda a que el panel autosoportado se mantenga en su lugar hasta que pueda ser
reemplazado. Los intercalarios tradicionales son blandos
y pueden dar lugar a que la balaustrada de vidrio se desmorone tras romperse, lo que puede dejar un peligroso vacío frente a la protección en azoteas y a riesgos de caída.
SentryGlas® también es excepcionalmente claro, lo que
ayuda a mantener unas vistas naturales y abiertas. Y, a
diferencia de los intercalarios tradicionales, SentryGlas®
es más resistente a la penetración de humedad por los
cantos, lo que ayudó en el diseño del Aer bar a evitar la
necesidad de utilizar cubiertas metálicas o protección de
los cantos de los laminados. Los paneles se despliegan
con claridad de extremo a extremo y a través del ático,
para una vista perfectamente diseñada.
más información
PÁG. 49
DUPONT
www.Dr-Hahn.de
la revista del sector
drio de gran transparencia
que no se notara y que virtualmente
desapareciera
de la vista. Para lograr este
efecto, eligieron un diseño
sin marco, que reposara en
la propia fortaleza del vidrio
para soportar las cargas de
viento e impacto. El vidrio laminado de seguridad hecho
con intercalarlo estructural
SentryGlas® se adapta perfectamente a esta necesidad.
Carpintería de aluminio
Por: Grupo Fromm
El grupo FROMM ha presentado
sus últimas novedades en maquinaria
Flejadora neumática P380
(VSHFLDOSDUDHOÁHMDGRGHSURGXFWRVSHTXHxRV\UHGRQ
GRVXVDÁHMHGH3HWGHDPPGHDQFKR\KDVWD
mm de grueso, con una elevada tensión (hasta 1800N)
esta es la única máquina en el mundo con estas características. El principal objetivo de este producto es cambiar
HOÁHMDGRGHSURGXFWRVSHTXHxRVTXHDFWXDOPHQWHVHÁH
MDEDQFRQÁHMHGHDFHURDSROLpVWHUPDWHULDOPiVOLJHUR\
económico y con la soldadura evitar el uso de enlazadores metálicos.
Nueva AP250
Es una maquina de la línea de protección y relleno de muy
fácil manejo, más pequeña y rápida y con un mínimo mantenimiento, permite mantener un buen nivel de producción a un bajo coste, no necesita compresor ni material
especial preformado.
0DTXLQDHQYROYHGRUDFRQÀOPHVWLUDEOH)6&(172
Esta es una máquina pensada para los clientes que actualmente envuelven manualmente, es una máquina sencilla económica, diseñada con los estándares de calidad
FROMM pero logrando ser asequible para cualquier clienWHTXHXVHÀOPHVWLUDEOHHQVXSURFHVRVyORFRQHODKRUUR
TXHJHQHUDUiHQHOXVRGHÀOPSDUDPiTXLQDORJUDUiXQD
rápida amortización.
más información
FROMM sigue ampliando su gama de productos, adecuándose a los momentos actuales del mercado, el I+D
de FROMM no descansa sigue investigando y poniendo
nuevos productos a disposición de sus clientes.
Tel.: 902 29 52 86
PÁG. 50
FROMM EMBALAJES
[email protected]
www.fromm.es
Carpintería de aluminio
Fluidos de corte sin bactericidas
y sin crecimiento bacteriano
la revista del sector
+HQNHOKDGHVDUUROODGRQXHYRVÁXLGRVGHFRUWHVLQEDFWHULFLGDVTXHVHSXHGHQPH]FODUFRQDJXD\QRQHFHVLWDQ
añadir posteriormente bactericida. Los nuevos productos Multan son fáciles de usar, reducen los riesgos para la
salud de los empleados y permiten la implantación con éxito de la directiva de la UE sobre biocidas.
Henkel ha conseguido desarrollar con éxito una reformulación de su tecnología emulsionante patentada, iniFLDQGR XQD UHYROXFLyQ HQ HO GHVDUUROOR GH ORV ÁXLGRV GH
corte de nueva generación. La nueva tecnología impide el
aumento de las bacterias por la absorción de nutrientes
procedentes de la degradación de los emulsionantes, una
vez se ha llegado a un mínimo de concentración bacteriaQD'HHVWHPRGRORVÁXLGRVGHFRUWHGH+HQNHOFXPSOHQ
completamente con las directivas de la UE sobre biocidas.
Superando las tecnologías anteriores, la fórmula de los
nuevos productos Multan 71-2 y 77-4 evita completamente el crecimiento bacteriano, que ocurre habitualmente
FRQHOXVRGHÁXLGRVGHFRUWHVLQXWLOL]DUQLQJ~QDGLWLYR
bactericida.
/RV ÁXLGRV GH FRUWH PLVFLEOHV HQ DJXD FRQYHQFLRQDOHV
utilizados habitualmente en el mecanizado de metales
presentan una alta exposición bacteriana debido a las
sustancias orgánicas que contienen. Debido a este fenómeno biológico natural, el crecimiento bacteriano causa
numerosos problemas técnicos en los procesos productivos y genera riesgos para la salud de los empleados. A
partir de un determinado contenido en bacterias, una roWXUDGHODHPXOVLyQGHOÁXLGRGHFRUWHHVLQPLQHQWH&RPR
8QDQXHYDWHFQRORJtDGHHPXOVLRQDQWHVHYLWDODSUREOHPiWLFDIRUPDFLyQGHEDFWHULDVHQORVÁXLGRVGHFRUWHVLQDJUHJDUEDFWHULFLGDVWy[LFRV
PÁG. 52
Carpintería de aluminio
/RVQXHYRVÁXLGRVGHFRUWHUHGXFHQDOPtQLPRORVULHVJRVSDUDODVDOXGGHORVWUDEDMDGRUHV
consecuencia, la emulsión no puede seguir usándose y
necesita ser cambiada. Además, el metabolismo bacteriano provoca una reducción del valor del pH e incrementa
los riesgos de corrosión. Por otra parte, el crecimiento incontrolado de microorganismos puede ser una amenaza
para la salud de las personas.
Hasta ahora, existían dos maneras de resolver el problePDGHOFUHFLPLHQWREDFWHULDQR(QHOFDVRGHORVÁXLGRV
de corte sin bactericida, el crecimiento bacteriano se tolera hasta cierto grado. Sólo a partir de un alto contenido
en bacterias se introduce una desinfección como tratamiento de choque. Este tratamiento reduce el número de
bacterias y el ciclo de crecimiento bacteriano se repite.
Sin embargo, la desventaja de este método es que los
empleados están expuestos permanentemente a las
bacterias y a los productos del
metabolismo bacteriano, así como a altas concentraciones
de biocidas. Ello conlleva riesgos de salud para el personal.
Los gérmenes eliminados proporcionan un medio nutriente
excelente para la siguiente generación de gérmenes, lo que
hace necesario incrementar la frecuencia de las desinfecFLRQHV(QHOFDVRGHÁXLGRVGHFRUWHTXHFRQWLHQHQEDFWH
ricidas, el crecimiento bacteriano se evita cuando se usan
de forma adecuada. Sin embargo, si la fórmula incluye bac-
más información
tericidas, los empleados tienen un alto riesgo para su salud
FXDQGRHVWiQH[SXHVWRVDORVÁXLGRVGHFRUWH
Ahora, Henkel ofrece una solución a estos problemas con
su nueva línea de productos que proporcionan altas presWDFLRQHVVLQQLQJ~QDGLWLYREDFWHULFLGD/RVQXHYRVÁXLGRV
de corte Multan evitan que los empleados estén expuestos a riesgos para su salud derivados de la presencia de
bacterias o bactericidas, mientras que se mantienen las
prestaciones con una alta calidad. Actualmente, Henkel
ofrece dos productos con la nueva tecnología:
Multan 71-2 es un producto multiusos. Debido a su
alto poder lubricante es adecuado para el mecanizado
JUXHVR 3URSRUFLRQDQGR XQD GLVSHUVLyQ ÀQD WDPELpQ
HVWiFDSDFLWDGRSDUDHOUHFWLÀFDGR
Multan 77-4 es un producto para el mecanizado de
acero altamente aleado y el aluminio, el especialista
ideal que proporciona alta lubricación incluso a bajas
concentraciones.
Con la utilización de los nuevos productos Multan, los
clientes cumplen completamente la legislación revisada
sobre biocidas de la UE que entrará en vigor en 2014 y
que limitará considerablemente el uso de bactericidas.
Tel.: 93 290 40 00
Fax: 93 290 47 35
PÁG. 53
HENKEL IBÉRICA
[email protected]
www.henkel.es
Carpintería de aluminio
Por: Ittalum
Nuevas soluciones...
ITTALUM adapta nuevos productos con la tecnología de iluminación LED.
Nuestro reto diario es la calidad, la innovación y mejora de
nuestros productos. Hoy es el único patrimonio del que disponemos para sortear el incierto futuro de nuestra economía
nacional.
la revista del sector
Somos conscientes que la iluminación con leds es ahorro
energético y queremos adelantarnos en el tiempo para incorporar una tecnología de iluminación que tiene un rendimiento
superior a la iluminación incandescente. La relación precio,
calidad, durabilidad, consumo y mínima emisión de calor, no
tiene comparación.
+HPRVDGDSWDGR~OWLPDPHQWHDQXHVWURVSHUÀOHVODLOXPLQD
ción led en las cubiertas de techos móviles, paneles sándwich
y vallas de protección para piscinas. El resultado lo dicen las
imágenes de las instalaciones que publicamos en esta revista.
más información
Tel.: 96 241 83 60
Fax: 96 241 76 13
PÁG. 54
ITTALUM
[email protected]
www.ittalum.com
Carpintería de aluminio
KAWNEER y ESPINET,
innovación y funcionalidad
con un aire sencillo
la revista del sector
KAWNEER, única marca del sector de la construcción del Grupo Alcoa con más de 100 años de experiencia en sistemas
de fachadas y muros cortina, ha participado junto al estudio
PÁG. 56
de arquitectos Espinet-Ubach en un conjunto residencial
que, bajo una apariencia sencilla, esconde las innovaciones de la arquitectura más funcional de nuestro tiempo.
la revista del sector
Carpintería de aluminio
El conjunto residencial, situado en la ciudad metropolitana de Barberá del Vallés, cuenta con 209 viviendas,
locales comerciales, aparcamientos subterráneos y plaza
comunal. La obra se destina a primera residencia para
sectores de población con poder adquisitivo medio, por
lo que la apuesta de los arquitectos, Espinet-Ubach, y el
grupo de colaboradores, entre ellos KAWNEER, demuestra que la arquitectura moderna no está reñida con una
calidad elevada a precios razonables.
Este concepto se ha hecho realidad gracias a soluciones arquitectónicas que emplean materiales reiterativos y fáciles
de aplicar, obteniendo como resultado un conjunto contundente en términos formales, que resulta a la vez elegante.
Las fachadas emplean la repetición de terrazas extendidas
con protección de vidrio, voladizo de hormigón visto y toldos enrollables. La ubicación de estas terrazas, alternando vacíos y llenos, da a la fachada un cuerpo dinámico.
En su momento, el estudio Espinet-Ubach se embarcó
en la búsqueda de soluciones que se adaptaran tanto a
las exigencias técnicas como a las económicas. En este
sentido, KAWNEER ha jugado un papel fundamental, ofreciendo soluciones que se basan en su extensa gama de
productos estándar que permiten solventar necesidades
muy diversas, cumpliendo al mismo tiempo plazos de
obra ajustados.
En palabras del propio arquitecto, Miquel Espinet, el principal valor añadido a la destacada calidad de producto ha
VLGRODHÀFDFLDGHOHTXLSRWpFQLFRGH.$:1((5TXHVH
KDLPSOLFDGRHQHOSUR\HFWRGHSULQFLSLRDÀQ´/DUHODFLyQ
FRQ.$:1((5KDVLGRLPSHFDEOHHVXQDHPSUHVDÀDEOH\
cumplidora. Esto es especialmente importante en el mercado del aluminio, ya que el arquitecto arriesga mucho, se
atreve cada vez más, y no siempre obtiene la respuesta
adecuada. Los técnicos de KAWNEER dan mucha tranquilidad por la forma en que se coordina todo el proceso y
SRUTXHHVWiQDKtGHSULQFLSLRDÀQµ
Entre los productos de KAWNEER que se han utilizado
destacan el muro cortina K1202 para la piel exterior de
la fachada y los sistemas K1450 Kassiopée para las ventanas y K1770 Kasting para las correderas, ambos con
detalles de hoja oculta. Además, los sistemas KAWNEER
KDQDSRUWDGROX]LQWHULRU\HÀFLHQFLDHQHUJpWLFDHQHODF
ceso al vestíbulo gracias a la puerta K1424 Kamelia y los
lucernarios K1202 en los áticos.
PÁG. 57
Carpintería de aluminio
la revista del sector
Información técnica de productos Kawneer
‡ 0XUR FRUWLQD VHULH ..
Fachada con opción a Parrilla
tradicional que propone distinWDVSURIXQGLGDGHV\ÀMDFLRQHV
de montantes y travesaños
para adaptarse a todas las
GLÀFXOWDGHV GH SUR\HFWRV GH
muro cortina. Para una anchura de 50mm, la profundidad
de los montantes y travesaños
se calculará según la inercia
requerida en cada ocasión.
El acristalamiento del muro
cortina puede realizarse con
tres juntas intercalarías de
diferentes dimensiones según
las necesidades del propio
acristalamiento. Todas las juntas, ya sean de interior o exterior, son de EPDM. La
ÀQDOL]DFLyQ GHO DFULVWDODPLHQWR VH HIHFW~D FRORFDQGR
una tapa tanto en montantes como en travesaños que
SXHGHWHQHUGLVWLQWLWRVGLVHxRV\TXHRFXOWDODÀMDFLyQ
del presor o contratapa.
‡ 9HQWDQD GH KRMD RFXOWD .DVVLRSHp. Ventana
abisagrada de hoja oculta de aluminio con rotura de
puente térmico y ensamblado por tiras de poliamida
UHIRU]DGD FRQ ÀEUD GH YLGULR 3URIXQGLGDG GH PDUFR
de 50mm. y hojas de 58mm. que permiten integrar
un doble acristalamiento térmico y de alta prestación
DF~VWLFDGHKDVWDPP/RVSHUÀOHVVRQH[WUXVLRQD
dos según EN 755 y 573 en aleación AL MG SI 0,5
F22. Objetos diseñados y fabricados según ISO 9001
que cuentan con una calle que garantiza el ensamble
y otra que garantiza el drenaje. Herrajes de aluminio o
zamac. Maneta de aluminio lacada RAL estándar. Incluido sellado perimetral y colocación en obra.
‡ &RUUHGHUD RFXOWD .DVWLQJ con rotura de puente
WpUPLFR 6ROXFLyQ GH GREOH WDELTXH GRQGH ORV SHUÀ
les utilizados permiten realizar cercos correderos en
los que se alojarán las hojas en posición de abierto,
quedando ocultas tras el tabique de pared aislante.
8QDSURIXQGLGDGGHPDUFRVXÀFLHQWHSHUPLWHLQWHJUDU
un doble acristalamiento térmico y de alta prestación
acústica. Admite un espesor máximo de vidrio de
PP/RVSHUÀOHVVRQH[WUXVLRQDGRVVHJ~Q(1
y 573 en aleación AL MG SI 0,5 F22. Elemento diseñado y fabricado según ISO 9001. La estanqueidad de
la hoja se garantiza por una doble barrera de pelo con
lama sean feal de refuerzo de estanqueidad al agua.
La tornillería es de acero inoxidable y los herrajes de
aluminio o zamac. Incluido sellado perimetral y colocación en obra.
‡ 3XHUWD.DPHOLD con hojas visibles del exterior y
distintitos tipos de apertura interior y exterior. Puerta
con umbrales tanto planos, estancos o para minusválidos. Cuenta con marco de vista de aluminio de
48,5mm., acristalamiento hasta 31mm y distintas líneas de manilla. Hay que tener en consideración su
cerradura multipuntos, comodidad acústica, que debilita hasta 31dB, y la posibilidad de acristalamiento de
seguridad.
FICHA TÉCNICA
CONJUNTO RESIDENCIAL
BARBERÁ DEL VALLÉS:
Arquitecto: Espinet/Ubach Arquitectes
Promotor: Volumètric S.A.
Constructora: Volumètric S.A.
Fachada: CGPR, Gabón
Productos Kawneer:
Muro cortina 1202 de tapeta
Ventana de hoja oculta 1450 Kasiopée // Balcones abisagrados K1450 Kassiopée
Sistemas K1770 Kasting (ventanas correderas)
Puerta batiente tradicional K1424 Kamelia
Lucernario K1202
más información
PÁG. 58
KAWNEER
www.kawneer.com
Carpintería de aluminio
Amplitud de miras
Llegar a cualquier lugar del mundo con una maquinaULDSDUDDOXPLQLRÀDEOH\FRQÀDEOHHVWDHVODYLVLyQGH
Ozgenc Makina, atrás quedaron los tiempos en los que
había que esperar a que llegara la pieza del extranjero
y que por un pequeño contratiempo mecánico o eléctrico nos veíamos obligados a parar la producción. Ahora,
cualquier persona con los conocimientos técnicos necesarios puede acceder al corazón de la máquina con total
garantía de éxito, ya que los recambios son de marcas
de reconocido prestigio, con referencias reconocidas en
cualquier lugar del Mundo.
más información
la revista del sector
Innovación en el Servicio de Asistencia Técnica, esta es
la apuesta de Ozgenc Makina, un área en la que tradicionalmente las marcas han reservado para si mismas,
o para sus distribuidores. Imaginemos por un momento
como sería poder encontrar todos los repuestos vitales
de nuestros vehículos en cualquier tienda especializada,
y en cualquier lugar del mundo, Ozgenc Makina ha seleccionado a sus proveedores de componentes entre los
líderes mundiales, obteniendo como resultado la excelencia en mantenimiento.
Tel.: +90 224 272 00 43
Fax: +90 224 272 00 44
PÁG. 59
ÖZGENç
[email protected]
www.ozgencmakina.com.tr
Carpintería de aluminio
Rauvolet, el sistema de persianas
para armarios de Rehau
RAUVOLET Metallic-line es un sistema de persianas con
acabados de aluminio y acero inoxidable de alta calidad.
Con un tacto de lo más agradable, seduce por la eleganFLDGHVXVVXSHUÀFLHV$VLPLVPRFRQWULEX\HDXQPD\RU
confort en el hogar, pues presenta un deslizamiento fácil
y silencioso.
RAUVOLET Metallic-line
La falta de espacio se está convirtiendo en uno de los
principales problemas tanto en el ámbito del hogar, como
en los entornos laborales. Por este motivo, REHAU nos
propone innovadoras soluciones con su programa de sisWHPDV GH SHUVLDQDV SDUD PRELOLDULR GH RÀFLQD \ FRFLQD
RAUVOLET. Gracias a su experiencia y know how, REHAU
se ha convertido en uno de los mayores proveedores brindando un atractivo programa que destaca por la amplia
oferta de productos y servicios.
Por otro lado, RAUVOLET Vetro-line está realizada en cristal, un material que aporta claridad y transparencia a la
estancia, así como una extraordinaria amplitud a la cocina con la ventaja añadida de que, al ser translúcido, no
deja ver el contenido interior del armario. Una innovadora
solución que contribuye al diseño de cocinas al más alto
nivel. RAUVOLET Vetro-line está disponible en distintos colores: satinado, blanco brillante y negro brillante Gracias
a sus lamas de cristal de seguridad (ESG), Vetro-line crea
XQDVXSHUÀFLHDUPyQLFD\SODQDTXHVRSRUWDODVPi[LPDV
cargas y no se raya. Además, el material que se utiliza es
de fácil limpieza y cuidado.
Además, la instalación de ambos sistemas es muy sencilla, gracias a las propiedades de deslizamiento de los
sistemas casette REHAU, cuyo módulo premontado sólo
tiene que ser atornillado en la estructura.
Los sistemas de persianas constituyen una solución ideal
SDUD HO VHFWRU GH ORV PXHEOHV GH FRFLQD \ RÀFLQD WDQWR
por su diseño, pues son un elemento atractivo que cautiva la mirada allí donde se coloquen, como por su capacidad sin igual para aligerar los frontales de los muebles
aportando la máxima funcionalidad.
8QDGHVXVSULQFLSDOHVYHQWDMDVUHVLGHHQVXÁH[LELOLGDG
y en que permiten ahorrar espacio. Además, facilitan la
FRQÀJXUDFLyQGHGLVHxRVDOJXVWRGHFDGDXQRFRPELQDQ
GRGLIHUHQWHVSHUÀOHVHVFRJLHQGRHOVLVWHPDGHJXLDGR\
seleccionando entre múltiples accesorios y colores.
Entre los distintos sistemas de persianas premontados para cocinas destacamos RAUVOLET Metallic-line y Vetro-line.
RAUVOLET Vetro-line
más información
PÁG. 60
REHAU
www.rehau.es
Carpintería de aluminio
la revista del sector
Reynaers Aluminium impartió
una jornada técnica en el COAC Colegio
2ÀFLDOGH$UTXLWHFWRVGH&DWDOXxD
Reynaers Aluminium, líder Europeo en soluciones innovadoras en aluminio para la arquitectura, siguiendo con
su campaña de apoyo a los profesionales, impartió el pasado 23 de Noviembre una jornada técnica sobre cálcuORVGHYDORUHVWpUPLFRV\HVWUXFWXUDOHVHQHO&ROHJLR2ÀFLDOGH$UTXLWHFWRVGH&DWDOXQ\D
Alex Peral, Director Técnico de Reynaers durante su exposición sobre cálculos térmicos y estructurales
PÁG. 62
Carpintería de aluminio
La jornada con el título “cálculos térmicos y estructurales
en cerramientos de aluminio” se llevó a cabo en BarceloQDHQOD(VFROD6HUWGHO&ROHJLR2ÀFLDOGH$UTXLWHFWRVGH
Catalunya.
De izquierda a derecha: Francesc Freixes, Director de Proyectos de
Reynaers, Lluís Alonso arquitecto de Alonso i Balaguer y Alex Peral,
Director Técnico de Reynaers
%RGHJDV3URWRV3HxDÀHO9DOODGROLG
Lluís Alonso, de Alonso Balaguer y Arq. Asociados durante su intervención
La segunda parte de la Jornada contó con la intervención
del arquitecto Lluís Alonso, arquitecto de Alonso i Balaguer Arquitectes Associats, enfocada a 2 de los grandes
proyectos realizados por este despacho de arquitectos en
colaboración con Richard Rogers y en los que se han utilizado sistemas de Reynaers Aluminium: Bodegas Protos
HQ3HxDÀHO\+RWHO+HVSHULDHQ%DUFHORQD
más información
Hotel Hesperia. Barcelona
Tel.: 93 721 95 59
Fax: 93 721 31 59
PÁG. 63
REYNAERS
[email protected]
www.reynaers.es
la revista del sector
Alex Peral (Director Técnico) realizó una breve exposición
de la gama de sistemas de Reynaers aluminium, para
posteriormente entrar de lleno en los cálculos que se deben realizar a los cerramientos desde el proyecto ejecutivo cumpliendo con las normativas vigentes. En primer
lugar se realizó una descripción de los cálculos térmicos
que describe el CTE, (comparándolo con la normativa EN
10077-1), para seguidamente realizar un ejemplo práctico con el software U-Tool que Reynaers tiene disponible
en Internet para arquitectos y prescriptores. Esta potente
herramienta calcula los valores térmicos (U) de cualquier
tipo de cerramiento ya sean ventanas, puertas o muros
cortina y proporciona los resultados directos para rellenar
ODVÀFKDVMXVWLÀFDWLYDVTXHHO&7(
Carpintería de aluminio
Panel STACBOND®
El panel STACBOND® se consolida como marca en el mercado nacional e internacional.
El panel composite STACBOND® está compuesto de dos láminas de aluminio unidas por un núcleo de polietileno. En
el caso del STACBOND® FR, de mayor resistencia al fuego,
el núcleo de polietileno es aditivado con partículas minerales. En ambos casos el panel posee un recubrimiento de
pintura PVDf, la cual aporta un acabado de alta resistencia
y gran durabilidad.
la revista del sector
La misión de STACBOND se puede resumir en dos puntos
fundamentales:
1. Para poder ofrecer un producto técnico de calidad, hay
que controlar la producción. STACBOND es fabricante
de Panel Composite y su control de calidad comienza
con el análisis de la bobina de aluminio, adherencia de
la pintura, resistencia al rayado y agentes externos, y
ensayos sobre todas las materias primas. Un completo
laboratorio equipado con las últimas tecnologías se encarga de realizar ensayos tanto en los componentes del
panel como en el panel fabricado, para ofrecer así las
máximas garantías. En unas modernas instalaciones
de 10.000m2 ubicadas en Galicia se ha centralizado la
producción y el almacenaje de Panel con una capacidad
productiva total de 800.000 m2/año.
2. Para dar un servicio de calidad es necesario estar cerca de los clientes, por eso una amplia red comercial y
un equipo técnico formado por profesionales de áreas
como Ingeniería y Arquitectura, dan el apoyo técnico sobre cuál es la mejor solución a cada proyecto concreto.
STACBOND® ofrece a arquitectos, instaladores y diseñadores posibilidades ilimitadas en cuanto al diseño y la ejecuFLyQ GH IDFKDGDV \D VHD HQ HGLÀFLRV GH QXHYD FRQVWUXF
ción, ó en rehabilitaciones; como es el caso del HOSPITAL
DE CONXO (Santiago de Compostela), con 9000m2 de panel composite.
Los campos de aplicación del panel composite STACBOND® son múltiples; desde centros comerciales hasta
QDYHVLQGXVWULDOHVIDFKDGDVVLQJXODUHVHGLÀFLRVS~EOLFRV
\HQJHQHUDOFXDOTXLHUWLSRGHHGLÀFDFLyQ/DVQXPHURVDV
PÁG. 64
$HURSXHUWRGH2XMGD0DUUXHFRV
propiedades mecánicas y la variedad de posibilidades de
este material, hacen de él un producto líder para la ejecución de fachadas ventiladas:
Amplia gama de acabados en carta estándar, formada por un abanico de diez colores sólidos y once colores metálicos. Además, bajo pedido mínimo Stacbond
ofrece la posibilidad de fabricación de cualquier color
de la carta RAL.
Alto grado de aislamiento térmico y acústico
Reducido peso
Alta resistencia a impactos
Alta durabilidad de color y brillo debido al acabado de
pintura PVDf.
Elevada rigidez
Extraordinaria planitud
Prueba de ello es la utilización del panel composite STACBOND® en obras emblemáticas como el centro comercial
“MARINEDA CITY” (A Coruña), con 18.000m2, el mayor centro comercial de España y el segundo de Europa, donde el
panel juega un lugar muy importante en la estética de la
Carpintería de aluminio
+RVSLWDOGH&RQ[R6DQWLDJRGH&RPSRVWHOD
$XGLWRULRGH9LJR3RQWHYHGUD
fachada. Obras de carácter privado como de administración pública; como el AEROPUERTO DE VIGO y A CORUÑA,
el HOSPITAL DE LOURES (Portugal) con 11.000m2 de fachada, la COMISARIA DE POLICIA DE VIGO, ó la de FUENCARRAL, entre otras; hospitales, auditorios, hoteles y todo
tipo de obra, tanto de nueva ejecución como rehabilitación,
realizadas en todo el ámbito nacional.
Actualmente STACBOND® apuesta por consolidar la marca
también en el mercado internacional del panel composite,
participando en grandes proyectos como el AEROPUERTO
DE OUJDA, en Marruecos, con 22.000m2 de fachada. La
LQJHQLHUtDUHVSRQVDEOHGHODHMHFXFLyQGHOSUR\HFWRFRQÀy
plenamente en la tecnología de última generación para la
fabricación de los paneles STACBOND® sin la necesidad de
ser mecanizados posteriormente a su fabricación.
(GLÀFLRGH6DQ3DLRGH1DYLD9LJR3RQWHYHGUD
La inquietud de STACBOND® por la calidad y la homologación de sus productos y sistemas de montaje, lo ha llevado
a ensayar minuciosamente su panel composite para determinar así sus características técnicas y lograr la ejecución
GHIDFKDGDVYHQWLODGDVTXHPHMRUHQODHÀFLHQFLDHQHUJpWL
FDGHORVHGLÀFLRVDSRUWiQGROHDORVPLVPRVXQEXHQDLV
lamiento térmico y acústico.
Destacar también, que el panel STACBOND® FR se desmarca en el mercado como uno de los paneles composite más
UHVLVWHQWHV DO IXHJR REWHQLHQGR OD FODVLÀFDFLyQ %VG
según norma UNE-EN-13501-1:2007.
Los sistemas de montaje de panel composite STACBOND®
STB-CH (Sistema de cuelgue) y STB-REMACHADO, han obtenido además el documento de idoneidad técnica (DIT
ORTXHJDUDQWL]DHOFXPSOLPLHQWRGHO&7(\ODHÀ
ciencia de los mismos.
más información
&HQWUR0HWHRURORJLFR6DQWDQGHU
Tel.: +34 981 817 036
Fax: +34 981 817 231
PÁG. 65
STAC
www.stac.es
Carpintería de aluminio
la revista del sector
Soluciones Schüco en el desarrollo
del nuevo Hospital Universitario
La Fe de Valencia
Se trata del principal proyecto sanitario de los últimos años en la Comunidad Valenciana y Schüco ha participado
activamente con sus soluciones en cerramientos de aluminio.
17.500 m2 de carpintería de aluminio exterior y casi 6.000 m2 de muros cortina y lucernarios, sobre una superÀFLHFRQVWUXLGDGHP2, son cifras que describen este gran proyecto.
PÁG. 66
Carpintería de aluminio
Schüco International KG, el referente en ventanas y energía solar, ha jugado un papel determinante en el Hospital
Universitario La Fe de Valencia, recientemente terminado.
tes al año; y el área de cirugía, a cerca de 30.000 pacientes al año. Por otro lado, el área de urgencias contará con
más de 600 pacientes al día y más de 240.000 al año).
Este nuevo centro hospitalario está ubicado en la zona
VXU GH OD FLXGDG FRQ XQD VXSHUÀFLH WRWDO FRQVWUXLGD GH
260.000m2. Los arquitectos Alfonso Casares y Ramón EsWHYHKDQFUHDGRXQFRQMXQWRGHHGLÀFLRVTXHHVWiQIRUPD
GRVSRUFXDWURJUDQGHVEORTXHV/DVXSHUÀFLHFRQVWUXLGD
dedicada a la hospitalización y atención ambulatoria es
de 171.000 m2(OUHVWRGHiUHDVGHOHGLÀFLRRFXSDQXQD
VXSHUÀFLHGHPiVGHP2.
Diseño y confort, unidos gracias al aluminio Schüco
El hospital atenderá una media de 4.000 pacientes al día;
el área de hospitalización recibirá 125 nuevos ingresos
diarios; el área de consultas externas, a 690.000 pacien-
La solución de carpintería, integrada con los paneles de
hormigón que conforman la fachada, permite que quede
todo en el mismo plano, tanto interior como exterior, de
Schüco se ha encargado de la carpintería de aluminio exWHULRUFRQXQDVROXFLyQFRP~QDWRGRVORVHGLÀFLRVTXH
SHUPLWHODPLVPDSURIXQGLGDGGHODSHUÀOHULDTXHORVEOR
ques de hormigón, ofreciendo una destacada estanqueiGDG \ XQ DVSHFWR XQLIRUPH HQWUH SDUWHV ÀMDV \ SUDFWLFD
bles del cerramiento.
PÁG. 67
Carpintería de aluminio
forma que la fachada adquiere una imagen de gran calidad y modernidad.
los Centros de Salud Silvano y Pirámides o el Hospital de
Majadahonda, entre otros.
Respecto a las zonas de conexión, entre las cuatro torres
destinadas a hospitalización, existen zonas comunes de
escaleras y pasillos, que se han cerrado con una solución
de muro cortina de trama horizontal realizado con la serie
FW 50+ de Schüco.
Schüco es consciente de la importancia de la rentabilidad hoy y en el futuro en la construcción de hospitales y
FHQWURVGHVDOXG/DWHQGHQFLDHVPHMRUDUODHÀFLHQFLDGH
las instalaciones y las medidas constructivas de modernización y de ahorro energético, como el empleo de energía
solar térmica para generar agua caliente o el aislamiento
térmico, aspectos a tener en cuenta a la hora de afrontar
un proyecto.
7DPELpQ GHVWDFD OD FXELHUWD GHO HGLÀFLR SULQFLSDO HQ
cuyas zonas comunes hay una serie de lucernarios con
SHQGLHQWHDXQDJXDUHDOL]DGRVFRQSHUÀOHULDGHDOXPLQLR
HVSHFtÀFDGHODVHULH):GH6FKXFRTXHJDUDQWL]DOD
correcta estanqueidad en todo momentro.
5HQWDELOLGDG \ HÀFDFLD PHGLRDPELHQWDO SLODUHV
en las Instituciones Médicas
la revista del sector
(VWH SUR\HFWR YLHQH D UHDÀUPDU OD LPSRUWDQWH SUHVHQFLD
que Schüco está teniendo en distintos proyectos de ediÀFLRV GH OD $GPLQLVWUDFLyQ 3~EOLFD FRQFUHWDPHQWH HQ
Instituciones Médicas, como son el Hospital de Manises,
Cada vez más los proyectos cumplen los requisitos neFHVDULRV SDUD OD SODQLÀFDFLyQ GH ODV REUDV FRQ GLVHxRV
modulares, donde los distintos servicios especializados
del hospital están agrupados alrededor de un centro. Esto
SHUPLWHODDGDSWDFLyQÁH[LEOHGHODHVWUXFWXUDGHOHGLÀFLR
a desarrollos posteriores, su ampliación hasta cierto punto y la posibilidad de hacer frente a nuevos retos. Schüco
DSRUWD VROXFLRQHV D WRGRV HVWRV UHWRV TXH EHQHÀFLDQ OD
HÀFLHQFLD\ODHÀFDFLDGHOHGLÀFLRFRPRSDUWHGHVXPL
sión Energy2, ahorrando y generando energía, Ahora.
más información
PÁG. 68
SCHÜCO
www.schueco.es
Carpintería de aluminio
FICHA TÉCNICA:
la revista del sector
Obra:
Hotel Husa Abad de San Antonio ****
Arquitectos:
Virginia González Rebollo
José María Ruiz Sanz
Carpintería metálica:
Cortizo
Solución utilizada:
Fachada ligera: Muro Invertido Tapeta Vertical
COR 60 con Rotura de Puente Térmico
Instalador:
&$53,17(5Ì$&(3('$1$,QVWDODGRU2ÀFLDO&257,=2
Soluciones Technal en la reforma
de la Universidad de Magisterio de Valencia
En la reordenación de la zona universitaria Els Tarongers de Valencia se plantea la creación de un espacio hoPRJpQHRSDUDWRGRVORVHGLÀFLRVGHO&DPSXV(QOD8QLYHUVLGDGGH0DJLVWHULRVHKDQFRQVWUXLGRWUHVHGLÀFLRV
que se han cerrado con muro cortina MX de Technal, que ha permitido conseguir múltiples aspectos en función
de las necesidades del proyecto.
PÁG. 70
Carpintería de aluminio
la revista del sector
El estudio AIC Equip ha creado un conjunto alineado de
WUHVHGLÀFLRVLQGHSHQGLHQWHVFRQHFWDGRVPHGLDQWHHVSD
cios públicos y ajardinados. En el extremo este, la biblioteca presenta un núcleo de doble altura que concentra las
FLUFXODFLRQHV \ FRQHFWD YLVXDOPHQWH HO LQWHULRU GHO HGLÀ
cio. A su lado, el comedor universitario se caracteriza por
su fachada, retranqueada en la planta baja a sur y este
para proteger los interiores del sol, y presenta lamas verticales en el nivel superior de las caras este y oeste para
suavizar la entrada de luz y crear diversos ambientes. En
el extremo oeste, el pabellón deportivo se hunde ligeramente para acoger la pista, creando un zócalo exterior.
El confort necesario para la vida estudiantil
En todo el conjunto se han utilizado cerramientos Technal para potenciar la iluminación natural y asegurar un
aislamiento acústico óptimo. En la biblioteca, la fachada
VHKDFRQÀJXUDGRFRQHOVLVWHPD0;&RQWUDWDSD&RQWLQXD
en su versión parrilla tradicional, que permite una buena entrada de luz natural, muy conveniente en las áreas
de lectura y estudio. Los huecos se han completado con
practicables Saphir FXi 65 que, gracias a los espesores
de acristalamiento que admiten, logran el aislamiento
acústico óptimo para el estudio.
El muro cortina de Technal también se ha utilizado en el
pabellón deportivo, dotando de iluminación natural la pista y las gradas, y en el comedor, favoreciendo una buena
conexión con la vida exterior del campus.
(Q ORV WUHV HGLÀFLRV VH KDQ LQVWDODGR SXHUWDV 7LWDQH 3+
que por su robustez son ideales para estos lugares con
altas frecuencias de paso, donde los estudiantes pasan
parte de sus horas no lectivas.
más información
Tel.: 902 22 23 23
Fax: 93 562 22 50
PÁG. 71
TECHNAL
[email protected]
www.technal.es
Carpintería de aluminio
Fachada modular en planos verticales
quebrados de Wicona
la revista del sector
Esta solución a medida ha sido creada
SDUDXQHGLÀFLRGHOD3OD]D(XURSDXQR
de los ejes generadores de la nueva
Gran Vía de l’Hospitalet de Llobregat,
ciudad colindante con Barcelona. Viaplana Arquitectes, que se encargó de
la reordenación de la zona, ha proyecWDGRHQODSOD]DGRVHGLÀFLRVSROLJRQD
les irregulares, de veinticuatro metros
de altura, que se sitúan cada uno a un
lado de esta arteria de la ciudad.
En el que se ubica al sudeste, los bloques están delimitados por planos verticales escalonados en altura de ocho
PHWURVFX\DVXSHUÀFLHFRPSOHWDPHQ
te acristalada, se ha concebido con
una solución especial de muro cortina
de Wicona creada a partir del sistema
Wictec EL. En la fachada cada módulo
se descompone en planos verticales quebrados que se
hacen más pronunciados a medida que nos desplazamos
KDFLDODSDUWHHVWHGHOHGLÀFLR
Los materiales seleccionados para dar forma y textura
buscan minimizar al máximo la presencia de la obra en
su entorno, por eso se ha optado por una fachada modular con vidrio exterior encolado en la que se combinan los
paneles transparentes con los opacos. Además, la planta
baja y primera están atravesadas en su parte central por
las calles principales, mientras que en sus extremos se
ha creado un porche de cuatro metros por debajo del bloque acristalado para generar una sensación etérea.
DATOS TÉCNICOS:
Obra:(GLÀFLRHQOD3OD]D(XURSD/·+RVSLWDOHWGH/OR
bregat, Barcelona)
Arquitectos: Viaplana Arquitectes
Cliente: FCC / Comapa Inmobiliaria
Fachadista: Garcia Faura
Fachada ligera: Wicona
Solución utilizada: Adaptación de Wictec EL
más información
Tel.: 902 22 23 23
PÁG. 72
WICONA
www.wicona.es
Carpintería de aluminio
Por: Röchling Plásticos Técnicos
Röchling Plásticos Técnicos,
el complemento ideal para la carpintería
de aluminio
un material ligero con densidad 0,96gr/cm³ de poro cerrado que no absorbe humedad y que puede ser aditivado
para ser empleado en ambientes externos.
([LVWHQGLIHUHQWHVWLSRVGHSHUÀOHVH[WUXLGRVHQGLYHUVDV
IRUPDVWDOHVFRPRSHUÀOHV=/78&3LQ]D*XtDODWHUDO
cuadrados, clips, especiales y banda plana.
la revista del sector
/RVSHUÀOHVVHVXPLQLVWUDQHQXQDORQJLWXGHVWDQGDUGGH
PPRHQUROORV/RVSHUÀOHVPHFDQL]DGRV\ODVJXtDV
cadenas son todavía más versátiles en la fabricación en
cuanto a calidades, dimensiones y cantidades mínimas
de fabricación.
La Banda Plana rebanada se oferta en un tamaño máximo de 300 mm de ancho y espesores entre 0,25 y 3 mm.
Otras dimensiones especiales son posibles bajo pedido.
Para más información: www.mecanizadosplasticos.es
5|FKOLQJ 3OiVWLFRV 7pFQLFRV ÀOLDO HQ (VSDxD GH OD PXO
tinacional alemana Röchling Engineering Plastics, fabrica componentes para la industria de transmisión como
SHUÀOHVH[WUXtGRV\PHFDQL]DGRVWRUQLOORVVLQItQJXtDVGH
cadena y piezas mecanizadas bajo plano.
/RVSHUÀOHV\ODVJXtDVGHFDGHQDVMXHJDQXQSDSHOUHOH
vante en lugares donde existe un elevado grado de desgaste y abrasión. Estos materiales están siendo aplicados
en una escala cada vez mayor para máquinas e instalaciones de alto nivel tecnológico. Para estas aplicaciones
RIUHFHPRV SHUÀOHV H[WUXLGRV HQ FDOLGDG 3RO\VWRQH® M
(PE-UHMW / PE 1000). Además de los colores estándar
natural, negro y verde, pueden fabricarse otros colores y
PHGLGDVEDMRSHGLGRDVtFRPRODHODERUDFLyQGHSHUÀOHV
FX\RGLVHxRVHDHVSHFtÀFRGHOFOLHQWH
Nuestro material Polystone® M, es un polietileno de ultra
alto peso molecular (UHMW PE) caracterizado por su alta
resistencia al desgaste y al impacto, su excelente deslizamiento y su elasticidad (no se rompe). Se puede utilizar a
una temperatura de entre los –250ºC y 80ºC. Se trata de
más información
3HUÀOHVPHFDQL]DGRVH[SXHVWRVHQOD)HULD.GH'XVVHOGRUI
Tel.: 962 350 165
Fax: 962 351 025
PÁG. 74
RÖCHLING PLÁSTICOS TÉCNICOS, S.A.U.
[email protected]
www.roechling-plastics.es
Carpintería de aluminio
la revista del sector
Manilla con teclado digital integrado
SDUDXQFRQWUROGHDFFHVRVVLPSOH\HÀFD]
CodeHandle es un juego de manillas de control de acFHVRVVLQWDUMHWDVQLOODYHVVLPSOH\HÀFD](VWiLQGLFDGR
para cualquier tipo de puerta interior, tanto en entornos
residenciales como institucionales, en los que la comodidad y la facilidad de uso son una prioridad. CodeHandle
HVODVROXFLyQSDUDODPD\RUtDGHiUHDVUHVWULQJLGDVRÀFL
nas, almacenes, áreas privadas, armarios, etc.
‡ Señales visuales y acústicas
Diseño atractivo y facilidad de instalación
‡ Acabado combinado acero inoxidable y cromo mate.
Al integrar el teclado en la manilla, CodeHandle es una
opción más atractiva que los aparatosos teclados murales. Además, es fácil de instalar: sin cables, sin taladros
especiales... se monta como cualquier otra manilla.
Normativa
‡ Fácil de instalar, sin cables.
‡ Modelos de mano derecha e izquierda.
‡ Sólo para uso interior.
Marcada CE de acuerdo a EN 61000-6-1, EN 61000-6-3,
EN 61000-4-2, EN 61000-4-3, EN61000-4-8
Características técnicas:
‡ En puertas: Manilla patentada de control de accesos
con código para puerta interior. Para puertas de espesor 35-80 mm.
‡ En ventanas, se suministra la manilla con tornillos de
ÀMDFLyQHLQVWUXFFLRQHV
‡ Un código maestro y hasta nueve códigos diferentes de
usuario – se pueden variar sin límites.
‡ Función de auto-cierre o bloqueo automático tras la
apertura opcional.
‡ Dos pilas de litio tipo CR2, 3V en la manilla exterior.
más información
Tel.: 943 669 100
Fax: 943 633 221
PÁG. 75
TESA
www.tesa.es
espacio Sapa
Una ventana al mercado
la revista del sector
Sistemas de muro cortina Sapa
y nuevos desarrollos
76
(O VLVWHPD 0& GHVDUUROODGR SRU 6DSD 3UR¿OHV
(VSDxDHQHODxRGHQWURGHODJDPD$O¿OGH
productos de aluminio para la construcción, constituye un sistema integral de muros cortina proyectado para satisfacer las necesidades y exigencias de
la moderna arquitectura de las fachadas continuas.
Según la tipología de los elementos externos de
cerramiento empleada, el sistema de MC60 permite la realización de las siguientes modalidades
constructivas: sistema de tapetas, sistemas de
trama horizontal, sistema de paneles y sistema de
acristalamiento estructural.
El sistema es del tipo de retícula base portante formada por montantes y travesaños de aluminio de
PPGHVXSHU¿FLHIURQWDO\FRQURWXUDGHSXHQWH
térmico.
Ahora, a partir de la última feria de Veteco (Mayo
GH6DSD3UR¿OHV(VSDxDKDGHVDUUROODGRXQ
nuevo sistema Todo-Vidrio (MC60 STV) en el que
los elementos externos de cerramiento están for-
espacio Sapa
Una ventana al mercado
mados por vidrios “desnudos”,
esto es, sin ningún bastidor
perimetral de aluminio. Estos
YLGULR VH ¿MDQ PHFiQLFDPHQWH
a la estructura a través de piezas intercaladas en la cámara
del vidrio y atornilladas a montantes y travesaños. La estanqueidad se garantiza con una
MXQWDH[WHULRUTXHFXEUHORV
mm de llaga exterior o con silicona de sellado.
la revista del sector
La estética exterior es muy
similar a la que presenta el
sistema de acristalamiento
estructural. La diferencia radiFD HQ ODV VLJXLHQWHV YHQWDMDV
este sistema reduce los procesos de fabricación y por tanto
ahorro de tiempos en taller
de un 75%, reduce el tiempo
GH PRQWDMH HQ REUD KDVWD XQ
VLPSOL¿FDQGR HO WUDEDMR
del montador y reduce el peso
de material de aluminio utilizaGRHQXQORTXHVLJQL¿FD
una reducción muy importante
en lo que respecta al costo de
sistema por metro cuadrado.
$GHPiV PHMRUD ODV SUHVWD
ciones térmicas hasta en un
25%, lo cual, hace que el sistema esté optimizado y adaptado a los nuevos tiempos que
corren.
77
Noticias
la revista del sector
Manuel Del Pino,
nuevo director general de Schüco Iberia
Schüco, el referente en ventanas y energía solar, ha designado a Manuel Del Pino como director general de Schüco Iberia. Manuel Del Pino sustituye a Thomas Knobloch,
quien ha estado al frente de Schüco Iberia desde el año
2005 y que emprende un nuevo proyecto como presidente de operaciones de Schüco Estados Unidos.
Manuel Del Pino cuenta con una dilatada experiencia internacional en dirección de equipos de diferentes compañías del sector de la construcción y tecnología relacionada
FRQ HO PHGLRDPELHQWH 3HUÀO TXH HQFDMD SHUIHFWDPHQWH
con la misión corporativa de Schüco: Energy2 - Ahorrando
y generando energía.
Manuel Del Pino ha sido director general de Toshiba Climatización para España y Portugal, del negocio residencial de Carrier (United Technologies Corporation) en España y recientemente director general de Airwell Ibérica.
Es Ingeniero Industrial por la Universidad Politécnica de
Madrid y Executive MBA por el Instituto de Empresa.
Manuel Del Pino se incorpora a Schüco Iberia coincidiendo con el inicio de la nueva etapa de la compañía,
TXHGHVGHHOSDVDGRGHVHSWLHPEUHSDVyDVHUÀOLDOGH
Schüco International KG, comenzando, así, un futuro prometedor formando parte de una red global de empresas
presente en más de 75 países.
más información
PÁG. 78
SCHÜCO
www.schueco.es
Noticias
Por: Sevasa
SEVASA estrena web
www.sevasa.com
No es sólo una actualización, sino un nuevo espacio de
consulta totalmente renovado y mejorado de Sevasa, con
nuevos contenidos y novedades en vidrio arquitectónico y
decorativo satinado al ácido.
la revista del sector
Dirigido a la cristalería profesional, arquitectos y prescriptores en general, Sevasa presenta una nueva estructura e
LPDJHQJUiÀFDTXHIDFLOLWDODQDYHJDFLyQ\SHUPLWHORFDOL
zar rápidamente los productos más adecuados y la información más útil, un espacio práctico e intuitivo.
Un nuevo motor de búsqueda permite la elección de sus
productos adaptándose al criterio del visitante: Marcas,
Categorías, Funciones o Prestaciones, proporcionando la
información ampliada de sus vidrios satinados y sus prestaciones técnicas, así como dos nuevas secciones infor-
más información
mativas muy útiles:
la Información Técnica acerca del vidrio satinado al
ácido y su función arquitectónica y decorativa, con
recomendaciones para la prescripción y su posterior
transformación, consultas frecuentes y terminología,
y una sección de Sostenibilidad medioambiental referente a cómo el vidrio satinado al ácido de Sevasa conWULEX\HHQODFRQVWUXFFLyQ\HGLÀFDELOLGDGVRVWHQLEOHV
el ahorro energético y de respeto con el medioambiente que arquitectos, constructores y sociedad en general reclaman.
Le invitamos a visitarnos y descubrir los nuevos lanzamientos en www.sevasa.com, actualmente la más completa web especializada en vidrio satinado al ácido.
Tel.: 93 828 03 33
Fax: 93 828 07 45
PÁG. 80
SEVASA
[email protected]
www.sevasa.com

Documentos relacionados