(A) = H o

Comentarios

Transcripción

(A) = H o
Resonancia Magnética Nuclear en
proteínas
Rodolfo Rasia, Abril 2012
Esquema
Cosas
generales
El fenómeno de RMN
Parámetros
El experimento de RMN
Los experimentos más usuales
Asignación
Cálculo
de estructuras
Otras cosas…
Muestras
¿Que nos puede decir la RMN de proteínas?
Cálculo de estructuras
Dinámica
Proteínas desestructuradas
Análsis de alteraciones estructurales
Wild-type
Partially
destabilized &
heterogeneous
Partially
destabilized
Unfolded
Ohi et al., NSB (2003)
Interacción proteína-ligando
Diseño de drogas
Estudios estructurales in vivo
High-Resolution
Macromolecular NMR
Spectroscopy
Inside Living Cells
JACS 2001, 123, 2446-2447
Estados excitados
Y no está limitado a moléculas pequeñas
El límite es la imaginación … Que es RMN (NMR!)
Nuclear
Magnética
Resonancia
Nuclear y Magnética: Spin nuclear
Núcleo, spin
Estados cuantizados m = I,I-1, … , -I+1, -I
I múltiplo de 1/2
Nos
interesan solamente núcleos con I = m=±1/2
Asociado
nuclear, momento de spin
=•I
al spin, momento magnético
En presencia de B0
Interacción
de con B0
Se pierde la degeneración
Para núcleos de spin , 2 estados
Los llamamos y RMN
transiciones entre y B0=0
B0>0
Propiedades de los isótopos
Elementos
en proteínas
Lo ideal: spin y abundancia natural alta
Isótopos útiles en bio-RMN
Sólo 1H
y 31P son naturalmente abundantes
13C y 15N
baja abundancia
baja sensibilidad
Enriquecimiento isotópico
O…
no sirve
1H
13C
15N
31P
¿Por qué resonancia?
E = h
¿De cuánta energía estamos hablando?
Energía
de un espín en un campo magnético
E=IzhB0/2
E=-1/2hB0/2
E=1/2hB0/2
E=hB0/2
E= h
= Bo / 2
Poniendo números
Para núcleos de 1H en magnetos de uso en RMN
Bo= 2.35 – 23.5 T
= 100 - 1000 MHz.
Para 1H a = 400 MHz (Bo = 9.5 T)
E= 3.8 x 10-5 Kcal / mol < 200 cm-1
N/N = e E / kT = 1.000064
Magnetización macroscópica (señal) proporcional a la
diferencia de población … muy poquito ¿Qué implica esto …?
Baja relación señal-ruido (acumular experimentos)
Regreso al equilibrio (relajación) lento (limita repetición)
Estado excitado: tiempos de vida media s, ms
Medición con mucha precisión B0 y determinan la sensibilidad
E= h
=B0/2
N/N = e E / kT
A 300 K, kT >> hB0 N/N 1+hB0/kT
A
> B0 > sensibilidad
Núcleos con > son más sensibles
Sensibilidad •E•flujo inducido 3
1H64•13C1000•15N
Cada
núcleo absorbe a una dada
Cada núcleo absorbe a una E= h
=B0/2
600 MHz
1H
No
150 MHz
13C
60 MHz
15N
se pueden detectar todos los núcleos
simultáneamente Se puede “trabajar” con los núcleos por separado Separar resonancias
Medir interacciones
Resumiendo I
En
RMN se miden transiciones de spin nuclear
Las diferencias de energía son bajas
Baja S/N
Alta precisión
En
proteínas trabajamos con núcleos de spin : 1H
(natural), 13C y 15N (precisan enriquecimiento isotópico)
Cada núcleo resuena a una frecuencia particular,
dependiendo de su El espectrómetro
“An
NMR machine is basically a big and expensive FM
Bo
radio”
N
S
Magnet
B1
Recorder
Frequency
Generator
Detector
Componentes necesarios
Imán
(superconductor a baja temp.)
Sonda (bobinas)
Consola
Generadores de frecuencias
Amplificadores
Evoución de los espectrómetros comerciales
1949
1952
1956
1957
1964
1971
1972
1979
1982
1987
1988
1992
1993
1993
1994
1999
2010
First commercially available NMR instrumentation
First high-resolution NMR spectrometer (30 MHz) (Varian)
40 MHz spectrometer (Varian)
60 MHz spectrometer (Varian)
220 MHz, first commercial supercond. NMR spectrometer (only 1H) (Varian)
180/270/360 MHz HFX and HX series (Bruker)
400 MHz WH (Bruker)
500 MHz WM. First commercial 500 MHz spectrometer (Bruker)
AM-Series (200-500 MHz) (Bruker)
AM-600. First commercial 600 MHz spectrometer (Bruker)
AMX series (200-600 MHz) (Bruker)
First NMR spectra at 750 MHz acquired on an AMX-750 (Bruker)
Unity-plus 750. First commercial 750 MHz spectrometer installed (Varian)
DMX, DRX, DSX series (300-750 MHz) (Bruker)
First 800 MHz spectra, DRX-800 (Bruker)
First 900 MHz spectra, DRX-900 (Bruker)
First 1GHz specrometer (Bruker)
B0 grande y estable: Superconductor
Autopsia de un magneto
270 MHz
Coraza acero inox.
3 mm
Material aislante
térmico (165 capas)
Termo de N2
(aluminio)
Autopsia de un magneto
Termo de N2
(interior)
Espacio lleno con N2
(77 K)
Sensor de N2
Autopsia de un magneto
Magneto
Superconductor
Aleación
Cu-Nb-Ti
(12 km de cable
enrollado)
Autopsia de un magneto
Magnetos más grandes, termos más grandes
600 MHz
750 MHz
O maior …
Imán de 1 GHz (Lyon,
France)
11.7 millones
¿Para qué gastar tanta plata?
Un núcleo
Una señal
Una sonda
Parámetros Espectrales
Propiedades de cada núcleo (, J, T1, T2)
Interacciones spin-spin
¿Cómo luce un espectro de RMN?
Estricnina
400
en CDCl3, 22 1H
MHz
Cada 1H da una señal identificable
En proteínas es más complicado
Parámetros espectrales: desplazamiento
químico ()
Elelctrones
spin I =1/2.
Producen pequeños campos magnéticos que se oponen a
B0 constante de apantallamiento =B0(1-)/2
B0
En los espectros
HO-CH2-CH3
low
field
high
field
o
Dependencia con el campo. Desplazamiento
químico en ppm
Los
campos producidos son proporcionales a B0 entre dos núcleos es proporcional a B0
es proporcional a B0
El apantallamiento se expresa como desplazamiento
químico ()
= (–ref)/ref 106 (ppm)
¡ indep. B0!
Rangos de variables:
1H, ca. 15 ppm
113Cd, ca. 300 ppm
Desplazamientos químicos 1H en prots.
Desplazamientos químicos 13C en prots.
Interacciones entre núcleos
Proveen
información sobre conectividad (asignación) y
estructural
Interacciones escalares (a través de enlaces)
Conexion por enlace
Ángulos diedros
Interacciones
dipolares (a través del espacio)
Distancia
Orientación relativa
Acoplamiento escalar
Influencia
del estado de un
núcleo sobre otro mediada por
e- a través de enlace
nJ, n= nº de enlaces
Constante en Hz
Separación de líneas
Heff (A) = Ho ± Hind (B)
Acoplamientos vecinales entre 1H
J
entre 1H vecinales depende del ángulo diedro
Relacionados por la ecuación de Karplus
A, B
y C, determinación empírica
Estimación de la conformación molecular
J()
Acoplamiento vecinal HN-H
Acoplamientos escalares en proteínas
Acoplamiento dipolar
Directa a través del espacio
Si =cte, muy grande
En solución, se promedia a 0… pero es la contribución más
importante a la relajación NOE!
1 2 h(3cos2 1)
D = 8 2 r 3
Resumiendo II
Un
núcleo una señal una sonda
Desplazamiento químico, una resonancia por núcleo en un
entorno
Interacciones entre núcleos
A través de enlace, acoplamiento escalar
A través del espacio, acoplamiento dipolar
Cómo se obtiene un espectro
Al
principio CW
Barrido de frecuencias
detección de absorción
Ahora, FT
Pulso de RF excita todos los núcleos
Se detecta la respuesta de la muestra
FT
s(t)
s()
Espectros de proteínas
RNAsa A, 1146 1H
Lisozima, 959 1H
La
información está ahi…
40 MHz
900 MHz
Dispersión de plegamiento
Plegado
Sac Y, regulador bacteriano
(50 aa)
600 MHz
Desplegado
Manival et al EMBO Journal (1997) 16, 5019 - 5029
Idea experimentos 2D (o nD)
Secuencias
diseñadas para detectar diferentes tipos de
acoplamientos
Escalar: COSY, TOCSY, HMQC, HSQC, HNCO, …
Dipolar: NOESY (en infinidad de variantes…)
Detección de la señal
antes y después del acoplamiento
pulso 90º
t1
t1
igual que 1D
Transferencia entre
espines acoplados
t2
t2
Experimentos 2D RMN homonuclear
Explotar
acoplamientos para resolver degeneraciones
t1
Espines acoplados
t2
Resolución de señales superpuestas
1D
2 señales superpestas
2D
2 picos resueltos
Experimentos 2D RMN homonuclear
COSY,
TOCSY, NOESY
Experimentos 2D heteronuclear
2D HSQC
Una señal por residuo
Heteronuclear! no diagonal
R
R
-15N - C- CO -15N - C
H
H
Experimentos 3D heteronuclear
Extensión
del HSQC a otra dimensión
Cada señal HN-N “ve” las resonancias de 1H acoplados
TOCSY-HSQC
Experimentos 3D, triple resonancia
Se
transfiere magnetización entre 1H, 15N y 13C
Experimentos nD, APSY
Más
dimensiones, más tiempo
1D, 10s
2D, 20’
3D, 5h
4D, 4-5d
nD …
APSY, proyección
para nD
4D HNCACB
5D HNCOCACB
…
No
hay superposición !
Resumiendo III
Espectros
de RMN: adquisición en dominio del tiempo,
transformación y análsis en dominio de frecuencia (FT)
Espectros de proteínas, muchas señales, muy densos
Separación en n-dimensiones
Correlaciones entre 1H y heteronúcleos marcados
Cómo saber quien es quien?
Asignación
de resonancias determinar la frecuencia a la
que resuena cada núcleo de la proteína
Ejemplo, CS-PNP (11 kDa)
784 1H
509 13C
150 15N
Determinación
de correlaciones acoplamientos
Posibles correlaciones H-H 6x105
Posibles corelaciones H-C 4x105
Posibles correlaciones H-N 1x105
No
todo el mundo ve a todo el mundo!. Estructura
covalente (acoplamiento escalar), sistemas de espín
Sistemas de espín
Conjunto
de núcleos que se correlacionan a través de
enlaces
Depende del experimento
TOCSY-HSQC
HNCO
Asignación: degeneración en Ubiquitina, 8.6
kDa, 76 residuos, 500 1H
Separar las resonancias en otra dimensión
Punto de partida: 1H amida
Señales
aisladas de la zona más poblada (alifáticos)
Conexión directa al resto del sistema de espín
Sidechain CH, CH2
Aromatic ring
protons and
pidechain NH2
Sidechain CH3
Backbone
H
Backbone HN
1H
Chemical Shift (ppm)
Punto de partida: 1H-15N hsqc
Señales
aisladas de la zona más poblada (alifáticos)
Conexión directa al resto del sistema de espín
Cada señal es base para “buscar” el resto
de la cadena
Estrategia de asignación homonuclear
Paso
1: Acoplamiento escalar (TOCSY, COSY), para
identificar las resonancias
Paso 2: Acoplamiento dipolar (NOESY) para ponerlas en
su lugar
Basado en los NH del esqueleto región del espectro
con máxima dispersión y mínima superposición
Identificar cadenas laterales y ponerlas en secuencia
COSY: 1H vecinales
H
H
A N—C
H
H
B N—C
H
H
C N—C
TOCSY: Todos los espines acoplados
H H H H
A
N—C—C—C—COOH
H H
H H H H H H
B
N—C—C—C—C—C—NH3
H H H H
H H
C
N—C—CH3
NOESY, une los sistemas de espín
H
N
H
C
C
H
R
H
O
C
C N C
H H
R
O
H
C N
H
C
C
H
R
O
C N
H
Los picos noesy aparecen por proximidad espacial
Permiten reconocer sistemas de espin secuenciales
Paso 2, poner los residuos en secuencia
s
A-B-C
Picos en los espectros NOESY
Iguales que en TOCSY
Pico del residuo i+1
A B (B C)
En otras épocas…
Asignaciones
limitadas a1H
PM max 10/12 kDa
Limitaciones: cantidad de señales y ensanchamiento
Solución marcado isotópico y experimentos
heteronucleares
Transferencia a través de J
Tiempo
de trasnferencia 1/4J (máxima transferencia)
Menor J, más tiempo
Más tiempo, más relajación, menos señal Correlación
homonuclear (1H-1H) 3J (2-10 Hz,
heterogéneo)
Correlación heteronuclear 1J (90-150 Hz,
homogéneo!)
Tiempos de transferencia:
80 ms (1H-1H TOCSY)
5.4 ms (1H-15N HSQC)
Dispersión de señales
Transferencia
heteronuclear, correlaciones 1H-15N,
1H-13C, 13C-15N
13C y 15N, mayor rango de ppm
Dispersión de las señales en regiones espectrales diferentes e
independientes
Dispersión en 15N 1H-1H TOCSY
tres resonancias superpuestas
con el mismo ppm HN
Al agregar una tercera dimensión, las separo según su
15N
Dispersión en 15N 1H-1H TOCSY
3 resonancias superpuestas
Mismo HN, distinto N
F2
TOCSY HSQC
1H
t1
1H
t2
15N
t3
F1
F3
TOCSY-HSQC
Dispersión en 15N 1H-1H TOCSY
Estrategias triple resonancia (1H,13C,15N)
Un
enlace por vez (todos los átomos son activos, excepto
el O)
Aun las superposiciones HN-N se resuelven por la
dispersión de 13C
3D/4D/5D/ … incrementa la resolución
Funciona en proteínas más grandes porque el
acoplamiento escalar de un enlace es mayor (menor
tiempo de transferencia, menor pérdida de señal)
Acoplamientos escalares
Superiores a los 1H-1H
(<20Hz!)
Experimentos triple resonancia, HNCO
Visualización de espectros 3D por planos
HSQC
HNCO
Visualización de espectros 3D por tiras
Experimentos para la asignación del
esqueleto
Nombres basados
en los átomos
detectados
No hace falta NOESY para linkear
residuos consecutivos!
Experimentos para la asignación de cadenas
laterales.
La redundancia aumenta la confiabilidad de la asignación
Asignación con CA y CB
H
N
CA
CB
O
H
CO
N
CA
CB
O
H
CO
N
O
CA
CB
En principio la asignación del esqueleto se puede completar con
solamente dos espectros
CBCA(CO)NH
CBCANH
CO
CBCA(CO)NH
H
N
CA
O
H
CO
N
CB
CA
O
H
CO
N
O
CA
CB
CO
CB
N
Correlaciona:
Ej: Ala-Gly
115 ppm
- Hi en una dimensión
- Ni en otra dimensión
- CBi-1, y CAi-1 en otra dimensión
CA
H
8.5 ppm
50 ppm
CB
19 ppm
C
CBCANH
H
N
CA
O
H
CO
N
CB
CA
O
H
CO
N
O
CA
CB
CO
CB
N
Correlaciona:
Ej: Ala-Gly
115 ppm
- Hi en una dimensión
- Ni en otra dimensión
- CBi-1, CAi-1, CBi-1, y CAi-1 en otra
dimensión
H
CA
CA
8.5 ppm
50 ppm
45 ppm
CB
19 ppm
C
Viendo el plano HC o NC
Ej: Ala-Gly
CBCA(CO)NH
CBCANH
HC
HC
NC
NC
N
50 ppm
115 ppm 50 ppm
H
45 ppm
CA
CA
8.5 ppm
50 ppm
45 ppm
CB
19 ppm
19 ppm
19 ppm
C
8.5 ppm
115 ppm
8.5 ppm
115 ppm
Alternando HNCACB (azules) con
HN(CO)CACB (rojos)
Identificación de tipo por desplazamiento
químico
Identificación de cadena lateral por tocsyhsqc
Identificación cadena lateral por HCCHTOCSY
Resultado del proceso
Lista
de desplazamientos químicos de todos los núcleos
de mi proteína
Permite identificar resonancias en cualquier tipo de
espectro
El “caballito de batalla”: 1H-15N HSQC
•Un pico por residuo (N-HN backbone)
•Barato, rápido, sonda distribuída homogéneamente en la
proteína
11
10
9
8
31V
110
73S
34G
61G
7
6
66S
54G
Asn/Asp
NH2
10T
5G
56T
62E
69K
76V
83N
27S
25M
21K
52D
48V
18C 80E
43T 75A
53R
68K
32K
19L
82L
16D
72D
41R 20R
15N
57D
42F 29R
85T
84K74A
79L37A 71K
23W
81L
9F
46V
17I
40K
47R 78L
58E
55W
64M
67V 70A
4N
28Y
33E
60I
59C49N
45G
39A
15N ppm
115
120
125
Trp
ole
le
le
indole
10
115
77L
120
125
35G
44F
4
44
F
130
11
110
9
8
1H ppm
7
130
6
Resumiendo IV
Asignación
de proteínas, base HN(-N)
Homonuclear/15N (hasta 10 kDa):
COSY-TOCSY sistemas de espin
NOESY posición en la secuencia
Triple
resonancia, 1H-13C-15N (>10 kDa)
HNCXXXX correlación del HN con carbonos intra/inter
Solo esqueleto, tipo de residuo CA, CB
Cadenas laterales, expt. tipo TOCSY
No necesita noesy!! no ambiguo
Y que hacemos con la asignación?
Información
(no 3D) sobre la estructura y función de la
proteína
Evaluación del estado de la proteína en diferentes
condiciones: conformación (plegada/desplegada),
condiciones de solución (pH, Temp, presión, potencial
redox)
Determinación localizada de elementos de estructura
secundaria
Medición de constantes de disociación por variaciones de
d en titulación con ligando
Inspección de regiones de interacción
Y, en algunos casos, estructuras 3d a partir de los CS
Ensayo directo de mutaciones que afecten la
estabilidad de proteínas
Wild-type
Partially
destabilized &
heterogeneous
Partially
destabilized
Unfolded
Ohi et al., NSB (2003)
Chemical shif index
Desplazamiento
químico del esqueleto depende de
estruct. secundaria determinación hélice/lámina
Nucleus
-Helix
-strand
1H
-0.38
0.38
1HN
-0.19
0.29
13C
2.6
-1.4
13C`
1.7
-1.4
15N
-1.7
1.2
Determinación de estructuras …
Interacción porteína-RNA
Y llegamos a las estructuras (“de verdad”)
PDB, mayo de 2011
Exp.Method
Proteins
Nucleic Acids
Protein/NA
Complexes
X-RAY
59271
1275
2858
NMR
7741
944
171
ELECTRON
MICROSCOPY
250
22
94
HYBRID
28
3
1
other
132
4
5
Total
67422
2248
3129
NMR tiene mayor participación en ácidos
nucleicos
Proteins
Nucleic Acids
X-RAY
X-RAY
NMR
NMR
ELECTRON
MICROSCOPY
ELECTRON
MICROSCOPY
HYBRID
HYBRID
other
other
Información estructural en RMN
Chemical Shift
Problemas de la resolución de estructuras
por RMN
Las
proteínas tienen cientos (miles!) de señales
Hay que asignarlas específicamente
Hay que asignar miles de interacciones entre átomos
Convertir la representación de interacciones medidas en
coordenadas espaciales
Información de RMN utilizable en el cálculo
de estructuras
Desplazamiento
Ángulos de torsión
Puente H
Acoplamientos
de intercambio de 1H
Puentes H, estructura secundaria
Acoplamientos
dipolares (NOEs)
distancias
d
istancias entre núcleos
Acoplamientos
escalares
ángulos de torsión
Velocidad
químico
Orientación
dipolares residuales
NOESY: Conectividad dipolar, restricciones
de distancias
El problema del NOESY
NOE
significativo asignación no
ambigua de los núcleos A y B
MUY dificil
Incertidumbre de Exactitud limitada en la posición de los
picos
Estrategia general para la resolución de
estructuras de proteínas
Resonance
Assignment
Stereospecific assignment
and intraresidue-sequential
distance restraints
Identification of secondarystructure elements
Iterative
cycle
3D-structure
determination
Refinement
Tertiary long-range
distance restraints
High-resolution
n
3D structure
Protocolo de cálculo de estructuras en
CYANA
Protocolo de cálculo de estructuras en
CYANA
Los desplazamientos químicos son sensibles
a los ángulos de torsión
TALOS, Torsion Angle Likelihood
Obtained from Shift and sequence similarity
H Cb
N
H
Ca
H
C
O
H
N
Chemical Shift and Backbone Structure Motif
Base de datos de CS y ángulos
Comparación de tripletes de residuos con los
desplazamientos medidos. CS + término de
homología
El residuo central predice phi y psi
Estructura secundaria, patrones de NOE
da(i)N(j)
i+4
C
i+3
dab(i, i+3)
daN(i, i+3)
dNN(i, i+3)
daN (i, i+4)
i+2
i+1
i
N
N
C
C
N
N
i-1
-helix
-sheet
C
Estructura secundaria, distancias cortas
N
H
H C
O
C
H
C
dNN
C H
N
H
C
H
dN
C
O
dN
N
H
Estructura secundaria, distancias cortas
N
H
H C
O
C
H
C
C H
N
H
dNN
Intense NOEs for helix
< 3.6 Å for a-helix
C
H
dN
C
O
N
H
daN
Intense NOEs for b-strand
< 2.7 Å for b-strand
Angulos diedros a partir de acoplamientos
escalares
•
•
• •
6 Hz
3JHN = 6.4 cos2 - 1.4 cos + 1.9 with = | - 60°|
•J medido, múltiples soluciones
•las conformaciones están limitadas
Angulos diedros a partir de acoplamientos
escalares
•
•
6 Hz
•J medido, múltiples soluciones
•las conformaciones están limitadas
• •
Estructura secundaria
Sequence
MALRRVETTYGDAWCSTQNLIVWRSTERLN
dNN
daN
daN(i,i+3)
3JHNa
sheet
helix
sheet
3JHNa
> 7 Hz
Estimación de la calidad de una estructura
de RMN
Las “estructuras”
son modelos
Número de restricciones
RMSD del conjunto (precisión, no exactitud)
Violaciones de restricciones, cantidad, dimensión
Energías
Comparación con estructuras conocidas (PROCHECK)
Recálculo de parámetros experimentales
La resolución es variable a lo largo de las
estructuras
•
Estructura secundaria bien definida, loops variables
•
Interior bien definido, superficie variable
•
Vale para esqueleto y para cadenas laterales
Dinámica en loops/superficie
Menor cantidad de restricciones en loops/superficie
Restricciones e incertidumbre
Mayor # de restricciones = menor
RMSD
Mayor # de restricciones en
cadenas laterales hidrofóbicas
clave
Resumiendo IV
Cálculo
de estructura: modelado de acuerdo con
restricciones estructurales (distancias, ángulos)
Restricciones:
Distancias, NOEs
Diedros:
3J
CS
H-bond
H exchange
Requerimientos de muestra para RMN
Proteína
soluble… en lo posible hasta 1mM (mínimo
operativo, 300-500uM)
MW X kDa X mg/ml
Muestra 500 l X/2 mg
Estable
Y
a, digamos, 25ºC por … unas dos semanas
En lo posible estable a 40-50ºC (menor c)
en lo posible a bajo pH (intercambio) y baja sal (probe)
Para completar el cuadro, marcación isotópica …
¡EL CUELLO DE BOTELLA EN CUALQUIER ESTUDIO
DE RMN DE PROTEINAS ES LA OBTENCION DE UNA
MUESTRA DE BUENA CALIDAD!
Sistema de expresión
Alto costo de nutrientes marcados isotópicamente maximizar la expresión (mg/l de cultivo)
En gral. se usa E. coli
Vectores de expresión comerciales
Optimización de condiciones de expresión
pET
pGEX
pMAL
OD inducción
Temp. inducción
[inductor]
Nivel de expresión y solubilidad en E. Coli
Etiquetas de purificación
Fusiones traduccionales, purificación por resina de afinidad
His-tag (1.5-2 kDa)
GST (26 kDa)
MBP (42 kDa)
Fusiones para estabilización/solubilización
Ubiquitin
SUMO
GB1
Salvo His-tag, consume marca “inutilmente” (rendimiento total
para las dos proteínas)
Sitio de digestión para proteasa (Trombina, Factor Xa, TEV…)
Sistema de clonado NESG
Condiciones de solubilidad (pH, sales,
estabilizadores)
Muestra
Si
pura:
Sacarle sal (malo para los pulsos)
Bajar el pH a 6-5
Concentrar lo más que se pueda
no anda… probar
cosolventes
Glicerol
Arg + Glu
Sacarosa
Detergentes (Tween, Triton, CHAPS, …)
otros sitemas de Buffer/ pH
Sales caotrópicas o cosmotrópicas (GdnHCl, MgSO4)
Estadísticas NESG
Estadísticas NESG
ExpressedSoluble (ES >=
10)
ExpressedInsoluble
No HSQC
HSQC spectra
recorded
Expressed (E
> 0)
Not purified
not expressed
Purified (>=
0.5 mg yield)
Not good
hsqc
No structure/
assign
"Good" or
"Promising"
HSQC spectra
NMR
structures in
PDB
Marcación isotópica
Crecer E. coli en mínimo
Baja en el rendimiento
Uso de medios ricos marcados (hidrolizados de algas) $$$
M9:
Medio base:
pH 7-7.4. Autoclavar. Agregar:
6g Na2HPO4
3g KH2PO4
0.5g NaCl
1g NH4Cl
Glucosa (0.2-0.4 %)
MgSO4
CaCl2
Vitaminas/minerales/quaker/vitina….
Biomasa total conc. Glucosa
Optimo para batch 2-4 g/l
Que más se puede
hacer?
RMN para seguir interacciones
Seguimiento
de unión de moléculas
Determinación de constantes de afinidad y velocidades
Identificación de superficies de unión
Mapeo de superficies de interacción
Determinación de la conformación de un ligando unido
Determinación de la conformación de un complejo
Schematic of a spectral perturbation
mapping experiment
15N (ppm)
Interacción proteína-ligando
unida
libre
1H (ppm)
Interacción proteína-ligando
15N (ppm)
INTERCAMBIO LENTO
1H (ppm)
Interacción proteína-ligando
15N (ppm)
INTERCAMBIO LENTO
1H (ppm)
Interacción proteína-ligando
15N (ppm)
INTERCAMBIO LENTO
1H (ppm)
Interacción proteína-ligando
15N (ppm)
INTERCAMBIO LENTO
1H (ppm)
Interacción proteína-ligando
15N (ppm)
INTERCAMBIO LENTO
1H (ppm)
Interacción proteína-ligando
15N (ppm)
INTERCAMBIO LENTO
1H (ppm)
Interacción proteína-ligando
15N (ppm)
INTERCAMBIO RÁPIDO
1H (ppm)
Interacción proteína-ligando
15N (ppm)
INTERCAMBIO RÁPIDO
1H (ppm)
Interacción proteína-ligando
15N (ppm)
INTERCAMBIO RÁPIDO
1H (ppm)
Interacción proteína-ligando
15N (ppm)
INTERCAMBIO RÁPIDO
1H (ppm)
Interacción proteína-ligando
15N (ppm)
INTERCAMBIO RÁPIDO
1H (ppm)
Titulación seguida por hsqc
6
-
Libre
5 equivalentes
-
8
-
10
L3
L7
- 110
15N (ppm)
110 -
L10
- 120
120 -
- 130
130 -
8
1H (ppm)
-
-
10
6
Intercambio
químico
rápido
titulación seguida por hsqc
CSP = (
(1H)2 + (15N)2/25)1/2 ppm
L3
L7
L10
Ácido 2-mercaptonicotínico
Titulación seguida por hsqc
L10
Las mayores
perturbaciones se
observan en los
residuos ubicados en
y cerca del sitio
activo (Loop L10)
0,3
0
CSP (ppm)
1bc2 (Fabiane et al. Biochemistry, 1998)
Ácido 2-mercaptonicotínico
Titulación seguida por hsqc
Proteínas intrínsecamente desordenadas
Parámetros
de RMN
preferencias conformacionales
exploración del espacio
contactos transientes
Proteínas intrínsecamente desordenadas
Parámetros
de RMN
preferencias conformacionales
exploración del espacio
contactos transientes
Proteínas intrínsecamente desordenadas
Parámetros
de RMN
preferencias conformacionales
exploración del espacio
contactos transientes
Proteínas intrínsecamente desordenadas
In-cell
NMR
Conf.-Folding
Binding
Post-Trasl.modifs.
In cell NMR, methods
FlgM is unfolded in vitro, but is folded in the
E. coli cytoplasm due to molecular crowding.
FlgM in E.coli
FlgM in solution
Dedmon, Matthew M. et al. (2002) Proc. Natl. Acad. Sci. USA 99, 12681-12684
Copyright ©2002 by the National Academy of Sciences
In vivo, oocitos, microinyección
(fosforilación)
In vivo, HeLa, transducción (proteólisis)
Tipos de marcación isotópica
Uniforme
Fraccional
al azar
Fraccional selectiva (metabólica)
Uso de precursores marcados
Selectiva
en aminoácidos auxótrofos
Vias metabólicas en E coli
Sintetiza todos los
aminoácidos de única fuente:
Carbono: glucosa, piruvato,
acetato, succinato o glicerol
Nitrógeno: sales de amonio
(cloruro, nitrato, sulfato)
Metabolitos ciclo de Krebs
mezcla precursores
Inclusión de precursores
directos, marcación selectiva
-cetobutirato y cetoisovalerato Ile,Val/Leu
Deuteración
Simpifica
el espectro (sólo veo 1H que decido dejar)
Reduce relajación
[2H]/[1H]=0.15
Anula contribuciones de relajación dipolar 1H-1H
Reduce relajación dipolar 1H-13C 15x
a 50-70% deuteración, T2 13C 8x
Perdeuteración, uso
de 2H glucosa en D2O
1H de glucosa retenidos en aromáticos
Acetato, intercambia con solvente, pero poco rendimiento
Deuteración
H2O/D2O
fraccional, 1H glucosa, fracción variable de
Perdeuteración @ 30 kDa
HNCA, 23 kDa, 75% 2H
Reprotonación selectiva
Asignación proteosoma
“Core particle” del proteosoma 20S de Thermoplasma acidophilum
(670 kDa)
Estequiometría 2x77
Temperatura de trabajo 65º (¡!), c180 ns
Muestras 25 M 350 M monómero
Marcado 1H-Ile, 1H Leu + Val
No expts triple resonancia estandar!
Disección del complejo
2x77 670 kDa
2x7 360 kDa (formado sin )
monómero 7, 21 kDa (mutaciones)
Asignación monómero estandar
Transferencia al complejo (COSY-TROSY, NOESY)
Completada con mutaciones (necesita asign. previa!)
Asignación proteosoma
Asignación proteosoma
Desplazamiento químico de pseudocontacto
Restricción
angular y de distancia
Largo alcance (>20Å)
Pintacuda et al., Acc. Chem. Res., 2007, 40 (3), pp 206–212
Hay lantánidos para todos los gustos…
Pintacuda et al., Acc. Chem. Res., 2007, 40 (3), pp 206–212
Determinación de estructuras de complejos
Marcado de proteínas con tag
“Carga” con Dy3+ y Er3+
Cálculo del tensor pcs en la prot 1
Cáclulo en prot 2
¡Estructura del complejo!
Pintacuda et al., Acc. Chem. Res., 2007, 40 (3), pp 206–212
Spin labeling polinucleótidos
Radical
NO unido a iodoacetamida
Marcado del ácido nucleico
ATP--S + T4 PNK (sólo extremo 5’)
Síntesis con base modificada
Cai et al, Biochemistry 2007
Spin labeling polinucleótidos
Tag
paramagnético, induce relajación (depende de r, hasta
25 Å)
Estimación de R2 a partir de I/I0 constraint de dist.
Cai et al, Biochemistry 2007
En resumen
Núcleos
en B0, E medición
Desplazamiento químico, una resonancia por núcleo en un
entorno
Interacciones entre núcleos
A través de enlace
A través del espacio
Correlación entre núcleos
Anisotropía de El
apantallamiento (shielding) es un tensor
Distribución de e- no esférica
depende de la orientación en B0
Promediado
por rotación rápida: =1/3(11+22+33)
¡Contribuye a la relajación!
anisotropía parcial-> RDC
Alineamiento
en medio anisotrópico
No se muestrean homogéneamente
El acoplamiento residual informa sobre orientación

Documentos relacionados